Citrus Sinensis ID: 012521

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MNQKNVDKDNARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLRKEILMFPRGSKTCNIEFF
ccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccccccccEEEEEccEEcccccccccccccccEEEEEEEEccccHHHHHHccccccccEEcccEEcccccEEEEEEEcccccEEEEEEEEEEccccccEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEEEEEEEcccccccccccHHHHHHHHccccccEEEEcccccEEEEEEccccccccccccEEEEEEcccccHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccccccccEEEEc
ccccccccccccccHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccccEEccccEEEcccEEEEEEEEEEcccccccccccHHHHEEEEEEEEccHHHHHHHHHcccHHHEEEEEEEccccccEEEEEEEccccEEEEEEEccccccccccEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEEEEccccccccccccHHHHHHHHHccccEEEEEcccccEEEEcccccccccccccEEEEEEEccccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccHHHHHHEEEEEEEcccccHHHHHHHHHHHHHHHHHcEEEEEEcccccHHHHHHHHHHccccccccEEEEc
mnqknvdkdnargditsrlpDHLLCRIlsclptedaVRTCILSSRWRDLWTSIHGLyfdggnekprsWFLNFVERVLGLcqlkdihnfhlrsstlrekdfSRVSEWICFAIQRNVRHLFLDVystsnftrhkrilelpqsiLTCETLVELKLCSDividipgsgicfpslkilhfgfchpdrglmqkffsscptleeltiegilhprdnvqTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAyfvldeipflKKAFVLVEFNVLrrnssgifenDARSALELVKRIKSMkilslpdsmTVLSFVlnnnlptfsnLISLELHIDscfgwklltpflkrspslkvlnldfskahkltpntlqdiVFEDlvcvepecapnclsSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSvgfaedapednlrkeilmfprgsktcnieff
mnqknvdkdnargditsrlpdHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHlrsstlrekdfsRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIegilhprdnvQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLrrnssgifendarSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVgfaedapednlrkeilmfprgsktcnieff
MNQKNVDKDNARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLRKEILMFPRGSKTCNIEFF
*****************RLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAED********EILMF************
******************LPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLRKEILMFPRGSKTCNIEFF
*********NARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLRKEILMFPRGSKTCNIEFF
*************DITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAH****NTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLRKEILMFPRGSKTCNIEFF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQKNVDKDNARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLRKEILMFPRGSKTCNIEFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
Q9FWZ1451 F-box/LRR-repeat protein yes no 0.917 0.937 0.303 2e-36
Q9FZ52449 F-box/FBD/LRR-repeat prot no no 0.915 0.939 0.283 5e-36
Q84X02405 FBD-associated F-box prot no no 0.845 0.962 0.303 5e-33
Q9FGQ3444 F-box/FBD/LRR-repeat prot no no 0.887 0.921 0.297 1e-32
Q9FJC1426 Putative FBD-associated F no no 0.891 0.964 0.282 2e-32
Q9SCQ5427 Putative FBD-associated F no no 0.893 0.964 0.304 2e-32
Q9ZV94452 Putative F-box/FBD/LRR-re no no 0.919 0.938 0.289 3e-32
Q9FJ30540 Putative F-box/LRR-repeat no no 0.724 0.618 0.302 5e-32
Q9FNJ4443 Putative F-box/FBD/LRR-re no no 0.889 0.925 0.308 1e-31
Q9FLA2438 Putative F-box/FBD/LRR-re no no 0.869 0.915 0.303 2e-31
>sp|Q9FWZ1|FBL13_ARATH F-box/LRR-repeat protein 13 OS=Arabidopsis thaliana GN=FBL13 PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (388), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 141/465 (30%), Positives = 220/465 (47%), Gaps = 42/465 (9%)

Query: 8   KDNARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGGNEKPRS 67
           K +   D  S+LPD LLC +L  LPT+D V+T +LS RWR+LW  + GL  D  + +  +
Sbjct: 12  KGSDEVDWISKLPDCLLCEVLLNLPTKDVVKTSVLSRRWRNLWKHVPGLDLDNTDFQEFN 71

Query: 68  WFLNFVERVLGLCQLKDIHNFHLRSSTLRE--KDFSRVSEWICFAIQRNVRHLFLDVYST 125
            FL+FV+  L       +  F L+     E   D   +  WI   + R V+H  +DV   
Sbjct: 72  TFLSFVDSFLDFNSESFLQKFILKYDCDDEYDPDIFLIGRWINTIVTRKVQH--IDVLDD 129

Query: 126 SNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCH--PDRG 183
           S  +     ++LP SI TCE+LV LKLC  + +  P   +  PSLK++         D G
Sbjct: 130 SYGSWE---VQLPSSIYTCESLVSLKLCG-LTLASP-EFVSLPSLKVMDLIITKFADDMG 184

Query: 184 LMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRT 243
           L +   + CP LE LTIE      D ++ + +  Q+L R +      +G V   +  I  
Sbjct: 185 L-ETLITKCPVLESLTIERSFC--DEIEVLRVRSQSLLRFTHVADSDEGVVEDLVVSIDA 241

Query: 244 PNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFEND-------ARSALE 296
           P LEYL +  + +A F+L++   L KA + + FN+   +S   F  D        R+ L 
Sbjct: 242 PKLEYLRLSDHRVASFILNKPGKLVKADIDIVFNL---SSVNKFNPDDLPKRTMIRNFLL 298

Query: 297 LVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSL 356
            +  IK M I S      +  F     LP F NL  L +     + W++L  FL+  P+L
Sbjct: 299 GISTIKDMIIFS-STLEVIYDFSRCERLPLFRNLSVLCVEF-YGYMWEMLPIFLESCPNL 356

Query: 357 KVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITN-LKREDYELEM 415
           K L +  +   +   N +                P    S +E ++I   LK E  E+++
Sbjct: 357 KTLVVKSASYQEKGENIILP-------------GPRRFLSSLEYVKIERPLKGEAMEMKL 403

Query: 416 VRYLLENSKVLEKFSVGFAEDAPEDN--LRKEILMFPRGSKTCNI 458
           V YLLENS +L+K ++   +   +++  + KE+L  PR S +  +
Sbjct: 404 VSYLLENSTILKKLTLCLDDSVKKEDSVILKELLAIPRLSTSSKV 448

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FZ52|FDL3_ARATH F-box/FBD/LRR-repeat protein At1g16930 OS=Arabidopsis thaliana GN=At1g16930 PE=2 SV=1 Back     alignment and function description
>sp|Q84X02|FBD7_ARATH FBD-associated F-box protein At2g26860 OS=Arabidopsis thaliana GN=At2g26860 PE=2 SV=2 Back     alignment and function description
>sp|Q9FGQ3|FDL37_ARATH F-box/FBD/LRR-repeat protein At5g53840 OS=Arabidopsis thaliana GN=At5g53840 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJC1|FBD31_ARATH Putative FBD-associated F-box protein At5g53635 OS=Arabidopsis thaliana GN=At5g53635 PE=4 SV=1 Back     alignment and function description
>sp|Q9SCQ5|FBD10_ARATH Putative FBD-associated F-box protein At3g50710 OS=Arabidopsis thaliana GN=At3g50710 PE=4 SV=1 Back     alignment and function description
>sp|Q9ZV94|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760 OS=Arabidopsis thaliana GN=At1g78760 PE=4 SV=1 Back     alignment and function description
>sp|Q9FJ30|FBL88_ARATH Putative F-box/LRR-repeat protein At5g41840 OS=Arabidopsis thaliana GN=At5g41840 PE=4 SV=1 Back     alignment and function description
>sp|Q9FNJ4|FDL32_ARATH Putative F-box/FBD/LRR-repeat protein At5g22670 OS=Arabidopsis thaliana GN=At5g22670 PE=4 SV=1 Back     alignment and function description
>sp|Q9FLA2|FDL34_ARATH Putative F-box/FBD/LRR-repeat protein At5g44950 OS=Arabidopsis thaliana GN=At5g44950 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
147812093 607 hypothetical protein VITISV_040899 [Viti 0.893 0.678 0.358 2e-48
224114976462 predicted protein [Populus trichocarpa] 0.906 0.904 0.331 5e-38
15222387451 F-box/LRR-repeat protein 13 [Arabidopsis 0.917 0.937 0.303 1e-34
116831005452 unknown [Arabidopsis thaliana] 0.917 0.935 0.303 1e-34
15219959449 F-box/RNI-like/FBD-like domains-containi 0.915 0.939 0.283 3e-34
297844624452 F-box family protein [Arabidopsis lyrata 0.921 0.940 0.288 2e-33
297841687428 F-box family protein [Arabidopsis lyrata 0.880 0.948 0.291 2e-33
296086770411 unnamed protein product [Vitis vinifera] 0.811 0.909 0.313 3e-31
15225804405 FBD-associated F-box protein [Arabidopsi 0.845 0.962 0.303 3e-31
91806275403 F-box family protein [Arabidopsis thalia 0.845 0.967 0.303 4e-31
>gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  199 bits (506), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 170/474 (35%), Positives = 233/474 (49%), Gaps = 62/474 (13%)

Query: 14  DITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDG----------GNE 63
           DI S LPD LLC ILS LPT+ AV T ILS RWR LW S+  L FD             E
Sbjct: 10  DIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVELE 69

Query: 64  KPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNVRHLFLDVY 123
           +    F NFV+ VL   ++  I  F L     R+ +   V  WIC A++R V+   LD++
Sbjct: 70  ERIIMFQNFVDGVLRHSEVSCIKKFRL---GYRDNNLDSVYSWICIALERRVQE--LDLH 124

Query: 124 STSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFC-HPDR 182
              ++      +ELP     C+TLV +KL   + +DIP + +  PSLK LH     + D 
Sbjct: 125 LLIDWR-----VELPPMFFICKTLVVVKLSCALFLDIP-TTVWLPSLKALHLKSVEYSDD 178

Query: 183 GLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFE-- 240
             +QK  S CP LEEL IE     RDN   +N+   +LK L I  F   G+      E  
Sbjct: 179 DSIQKLLSGCPVLEELVIER--EERDNQWVVNVSNPSLKILRI-FFFTDGFAHPYEQEDQ 235

Query: 241 -----IRTPNLEYLSIIAN-SLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSA 294
                +  PNLEYLSI    S  YFV D +P L KAF+ VE        S  FE    + 
Sbjct: 236 DYKVVVDAPNLEYLSITDYLSKDYFVKD-LPSLVKAFIDVE------QDSEEFEESPHNG 288

Query: 295 --------LELVKRIKSMKILSLPD-SMTVLSFVLNN-NLPTFSNLISLELHIDSCFGWK 344
                    EL+ RI ++K LSL   ++  LS  + +  LPTF N+  LE      F W 
Sbjct: 289 GISYHGPIYELLGRISNVKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWD 348

Query: 345 LLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEIT 404
            L  FL  SP+L+ L ++    ++L P             + P   P CL   ++ IEI 
Sbjct: 349 FLPNFLHSSPNLEALVIETGYTNELIPEGW----------LMPLQVPACLVLHLKEIEIR 398

Query: 405 NLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDN--LRKEILMFPRGSKTC 456
            +  EDYELE V YLL+N++VL++ ++   E   +    + K++L  PRGS++C
Sbjct: 399 RIVGEDYELEAVEYLLKNAEVLQQMTIDCHESYMDQEFCVCKKLLGLPRGSRSC 452

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224114976|ref|XP_002316907.1| predicted protein [Populus trichocarpa] gi|222859972|gb|EEE97519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15222387|ref|NP_177121.1| F-box/LRR-repeat protein 13 [Arabidopsis thaliana] gi|75263128|sp|Q9FWZ1.1|FBL13_ARATH RecName: Full=F-box/LRR-repeat protein 13 gi|10092292|gb|AAG12704.1|AC021046_5 hypothetical protein; 7662-9196 [Arabidopsis thaliana] gi|12325183|gb|AAG52534.1|AC013289_1 hypothetical protein; 77728-79262 [Arabidopsis thaliana] gi|91806059|gb|ABE65758.1| F-box family protein [Arabidopsis thaliana] gi|332196836|gb|AEE34957.1| F-box/LRR-repeat protein 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116831005|gb|ABK28458.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15219959|ref|NP_173137.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] gi|75263252|sp|Q9FZ52.1|FDL3_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At1g16930 gi|9802769|gb|AAF99838.1|AC051629_5 Hypothetical protein [Arabidopsis thaliana] gi|332191402|gb|AEE29523.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297844624|ref|XP_002890193.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297336035|gb|EFH66452.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297841687|ref|XP_002888725.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297334566|gb|EFH64984.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296086770|emb|CBI32919.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15225804|ref|NP_180254.1| FBD-associated F-box protein [Arabidopsis thaliana] gi|142993877|sp|Q84X02.2|FBD7_ARATH RecName: Full=FBD-associated F-box protein At2g26860 gi|3426040|gb|AAC32239.1| hypothetical protein [Arabidopsis thaliana] gi|330252805|gb|AEC07899.1| FBD-associated F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|91806275|gb|ABE65865.1| F-box family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
TAIR|locus:2026761451 AT1G69630 [Arabidopsis thalian 0.934 0.955 0.311 2.9e-39
TAIR|locus:2015681449 AT1G16930 "AT1G16930" [Arabido 0.939 0.964 0.284 7e-38
TAIR|locus:505006456468 AT4G14096 "AT4G14096" [Arabido 0.928 0.914 0.308 1.9e-37
TAIR|locus:2101674427 AT3G50710 "AT3G50710" [Arabido 0.496 0.536 0.325 8.5e-36
TAIR|locus:2037578458 AT1G78750 "AT1G78750" [Arabido 0.939 0.945 0.276 3.6e-34
TAIR|locus:2162484466 AT5G22730 "AT5G22730" [Arabido 0.906 0.896 0.289 3.6e-34
TAIR|locus:2155327438 AT5G44950 "AT5G44950" [Arabido 0.915 0.963 0.292 2e-33
TAIR|locus:2057422442 AT2G26030 "AT2G26030" [Arabido 0.906 0.945 0.290 8.5e-33
TAIR|locus:2020537492 AT1G55660 "AT1G55660" [Arabido 0.941 0.882 0.278 1.8e-32
TAIR|locus:2081157520 AT3G59200 "AT3G59200" [Arabido 0.902 0.8 0.302 4.6e-32
TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 419 (152.6 bits), Expect = 2.9e-39, P = 2.9e-39
 Identities = 146/468 (31%), Positives = 227/468 (48%)

Query:     3 QKNVD-KDNARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTSIHGLYFDGG 61
             +K+V  K +   D  S+LPD LLC +L  LPT+D V+T +LS RWR+LW  + GL  D  
Sbjct:     6 EKHVRAKGSDEVDWISKLPDCLLCEVLLNLPTKDVVKTSVLSRRWRNLWKHVPGLDLDNT 65

Query:    62 NEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLRE--KDFSRVSEWICFAIQRNVRHLF 119
             + +  + FL+FV+  L       +  F L+     E   D   +  WI   + R V+H+ 
Sbjct:    66 DFQEFNTFLSFVDSFLDFNSESFLQKFILKYDCDDEYDPDIFLIGRWINTIVTRKVQHI- 124

Query:   120 LDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVIDIPGSGICFPSLKILHFGFCH 179
              DV   S  +     ++LP SI TCE+LV LKLC  + +  P   +  PSLK++      
Sbjct:   125 -DVLDDSYGSWE---VQLPSSIYTCESLVSLKLCG-LTLASP-EFVSLPSLKVMDLIITK 178

Query:   180 --PDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQTLKRLSISVFVMQGYVSKR 237
                D GL +   + CP LE LTIE      D ++ + +  Q+L R +      +G V   
Sbjct:   179 FADDMGL-ETLITKCPVLESLTIERSFC--DEIEVLRVRSQSLLRFTHVADSDEGVVEDL 235

Query:   238 IFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFN---VLRRNSSGIFENDA-RS 293
             +  I  P LEYL +  + +A F+L++   L KA + + FN   V + N   + +    R+
Sbjct:   236 VVSIDAPKLEYLRLSDHRVASFILNKPGKLVKADIDIVFNLSSVNKFNPDDLPKRTMIRN 295

Query:   294 ALELVKRIKSMKILSLPDSMTVL-SFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKR 352
              L  +  IK M I S   ++ V+  F     LP F NL  L +     + W++L  FL+ 
Sbjct:   296 FLLGISTIKDMIIFS--STLEVIYDFSRCERLPLFRNLSVLCVEFYG-YMWEMLPIFLES 352

Query:   353 SPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCVEVIEITNLKREDYE 412
              P+LK L +  +   +           E+++   P      LSS   V     LK E  E
Sbjct:   353 CPNLKTLVVKSASYQEKG---------ENIILPGPR---RFLSSLEYVKIERPLKGEAME 400

Query:   413 LEMVRYLLENSKVLEKFSVGFAEDAP-EDN-LRKEILMFPRGSKTCNI 458
             +++V YLLENS +L+K ++   +    ED+ + KE+L  PR S +  +
Sbjct:   401 MKLVSYLLENSTILKKLTLCLDDSVKKEDSVILKELLAIPRLSTSSKV 448
GO:0005634 "nucleus" evidence=ISM
GO:0007059 "chromosome segregation" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006456 AT4G14096 "AT4G14096" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162484 AT5G22730 "AT5G22730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155327 AT5G44950 "AT5G44950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057422 AT2G26030 "AT2G26030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020537 AT1G55660 "AT1G55660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FWZ1FBL13_ARATHNo assigned EC number0.30320.91750.9379yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
smart0057972 smart00579, FBD, domain in FBox and BRCT domain co 7e-17
pfam0838751 pfam08387, FBD, FBD 1e-07
pfam0064648 pfam00646, F-box, F-box domain 1e-04
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 5e-04
pfam1293747 pfam12937, F-box-like, F-box-like 0.001
>gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information 
 Score = 74.5 bits (184), Expect = 7e-17
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 393 CLSSCVEVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAEDAPEDNLR--KEILMFP 450
           CL S +EV+EI   +  + E E+V+Y LEN+  L+K ++       E+ L   KE+L  P
Sbjct: 2   CLLSSLEVLEIKGYRGTEEEKELVKYFLENAPCLKKLTISVETSDDEEKLEILKELLSLP 61

Query: 451 RGSKTCNIEF 460
           R S +C ++F
Sbjct: 62  RASSSCQVQF 71

Length = 72
>gnl|CDD|203925 pfam08387, FBD, FBD Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
KOG4341483 consensus F-box protein containing LRR [General fu 99.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.69
smart0057972 FBD domain in FBox and BRCT domain containing plan 99.43
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 99.09
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.8
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.74
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.66
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.6
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.5
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.33
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.31
KOG4341483 consensus F-box protein containing LRR [General fu 98.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.22
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.09
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.92
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.85
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.69
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.53
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.43
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.22
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.85
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 96.83
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 96.59
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.52
KOG0617264 consensus Ras suppressor protein (contains leucine 96.38
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.54
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 95.4
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.25
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 93.84
KOG0281499 consensus Beta-TrCP (transducin repeats containing 93.55
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 93.48
KOG0472565 consensus Leucine-rich repeat protein [Function un 93.48
KOG4237498 consensus Extracellular matrix protein slit, conta 93.45
PRK15386426 type III secretion protein GogB; Provisional 93.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.69
KOG2997366 consensus F-box protein FBX9 [General function pre 92.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 91.63
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.56
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 91.1
PLN03150623 hypothetical protein; Provisional 90.99
PRK15386 426 type III secretion protein GogB; Provisional 90.09
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 88.57
KOG0617264 consensus Ras suppressor protein (contains leucine 88.49
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 88.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 87.12
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.64
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 85.16
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.99
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 84.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.78
PLN03150623 hypothetical protein; Provisional 81.88
PF13013109 F-box-like_2: F-box-like domain 81.52
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.75  E-value=3.5e-20  Score=170.16  Aligned_cols=345  Identities=16%  Similarity=0.132  Sum_probs=220.0

Q ss_pred             CCChHHHHHHHcCCCccchhhhcccchhhHHh------hcccceeeecCCCCCCcchHHHHHHHHHhccCCCCeeEEEEE
Q 012521           18 RLPDHLLCRILSCLPTEDAVRTCILSSRWRDL------WTSIHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLR   91 (461)
Q Consensus        18 ~LPd~vl~~Ils~Lp~~~~~~~s~vsrrWr~l------w~~~~~l~~~~~~~~~~~~~~~~v~~~l~~~~~~~i~~l~l~   91 (461)
                      .||+|++..|||+|+++.+++++++|+.|..+      |+++..++|..+.  +..    .|..+. .+.+..+++++++
T Consensus        74 ~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv--~g~----VV~~~~-~Rcgg~lk~LSlr  146 (483)
T KOG4341|consen   74 SLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDV--DGG----VVENMI-SRCGGFLKELSLR  146 (483)
T ss_pred             cCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcC--CCc----ceehHh-hhhcccccccccc
Confidence            49999999999999999999999999999864      7777666665443  111    122222 2223466666666


Q ss_pred             EcccCcCCcccHHHHHHHHHhcCccEEEEEEeecccccccceecccCCcccCCCCccEEEeceeee-cc--CCCCccccC
Q 012521           92 SSTLREKDFSRVSEWICFAIQRNVRHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIV-ID--IPGSGICFP  168 (461)
Q Consensus        92 ~~~~~~~~~~~~~~wl~~~~~~~l~~L~l~~~~~~~~~~~~~~~~lp~~l~~~~~L~~L~L~~~~l-~~--~~~~~~~~~  168 (461)
                      ...  ..                                  ....+-.....|++++.|.+.+|.. ++  ...++..|+
T Consensus       147 G~r--~v----------------------------------~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~  190 (483)
T KOG4341|consen  147 GCR--AV----------------------------------GDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCR  190 (483)
T ss_pred             ccc--cC----------------------------------CcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcc
Confidence            444  11                                  1112222233488888888888763 22  112225688


Q ss_pred             CccEEEeee-ecCChhHHHHHHhcCCccCeEEEeeeecC---CCCeeEEEEEcCCcceEEEEEEeecCcccceeEEEecC
Q 012521          169 SLKILHFGF-CHPDRGLMQKFFSSCPTLEELTIEGILHP---RDNVQTINIIVQTLKRLSISVFVMQGYVSKRIFEIRTP  244 (461)
Q Consensus       169 ~L~~L~L~~-~~~~~~~l~~l~~~cp~Le~L~L~~~~c~---~~~~~~~~i~~~sL~~L~l~~~~~~~~~~~~~~~~~~p  244 (461)
                      +|+.|+|.. ..+++..++.+..+||+|+.|++++  |+   ..+++.+.-.+..++.+...+|.....+....+.-.++
T Consensus       191 ~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSw--c~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~  268 (483)
T KOG4341|consen  191 KLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSW--CPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCL  268 (483)
T ss_pred             hhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhcc--CchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccCh
Confidence            888888888 6667788888888899999999988  62   23344445555667777777776554333344444455


Q ss_pred             CccEEEEeecccCc-e---E-eecCCCeeEEEEEEEEceeecCCCCcchhhHHHHhhcCCCceEEEEecCCChHHHhhhh
Q 012521          245 NLEYLSIIANSLAY-F---V-LDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLSFV  319 (461)
Q Consensus       245 ~L~~L~~~~~~~~~-~---~-~~~~~~L~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~L~l~~~~~~~~~l~~~  319 (461)
                      .+..+++..+...+ .   . -..+..|+.+....+...        .+..+.++.+.+++|+.|.+.++..    +++.
T Consensus       269 ~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~--------~d~~l~aLg~~~~~L~~l~l~~c~~----fsd~  336 (483)
T KOG4341|consen  269 EILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDI--------TDEVLWALGQHCHNLQVLELSGCQQ----FSDR  336 (483)
T ss_pred             HhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCC--------chHHHHHHhcCCCceEEEeccccch----hhhh
Confidence            55555533321110 0   0 011223333322222221        2267888999999999999998432    3333


Q ss_pred             ccCCC-CCCCccceEEEEeccCCChhhHHHHHhcCCCCeeEEEeeccccccCCCCCCcccccccccccCCccccccccce
Q 012521          320 LNNNL-PTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLDFSKAHKLTPNTLQDIVFEDLVCVEPECAPNCLSSCV  398 (461)
Q Consensus       320 ~~~~~-~~~~~L~~L~l~~~~~~~~~~l~~ll~~~p~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L  398 (461)
                      .+..+ ..+..|+.|++..+.......+.++-.+||.||+|.++++.. ..+.+.....            ...|...+|
T Consensus       337 ~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslshce~-itD~gi~~l~------------~~~c~~~~l  403 (483)
T KOG4341|consen  337 GFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSHCEL-ITDEGIRHLS------------SSSCSLEGL  403 (483)
T ss_pred             hhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhhhhh-hhhhhhhhhh------------hcccccccc
Confidence            33333 377889999999998866767999999999999999998873 2222111111            345778889


Q ss_pred             EEEEEEeeccchhHHHHHHHHHhcCcccceEEEEecC
Q 012521          399 EVIEITNLKREDYELEMVRYLLENSKVLEKFSVGFAE  435 (461)
Q Consensus       399 ~~v~i~~~~g~~~~~~l~~~ll~~a~~Le~m~i~~~~  435 (461)
                      .++++.+.....  -+..++ +.++++||++.+...+
T Consensus       404 ~~lEL~n~p~i~--d~~Le~-l~~c~~Leri~l~~~q  437 (483)
T KOG4341|consen  404 EVLELDNCPLIT--DATLEH-LSICRNLERIELIDCQ  437 (483)
T ss_pred             ceeeecCCCCch--HHHHHH-HhhCcccceeeeechh
Confidence            999999988764  244444 4778899998887665

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 6e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 98.4 bits (244), Expect = 5e-22
 Identities = 76/470 (16%), Positives = 151/470 (32%), Gaps = 99/470 (21%)

Query: 1   MNQKNVDKDNARGDITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDLWTS---IHGLY 57
           M+ +  +      DI S   D  +     C   +D  ++ +       +  S   + G  
Sbjct: 7   MDFETGEHQYQYKDILSVFEDAFV-DNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTL 65

Query: 58  --FDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHLRSSTLREKDFSRVSEWICFAIQRNV 115
             F     K       FVE VL +       N+    S ++ +          +  QR+ 
Sbjct: 66  RLFWTLLSKQEEMVQKFVEEVLRI-------NYKFLMSPIKTEQRQPSMMTRMYIEQRDR 118

Query: 116 RHLFLDVYSTSNFTRHKRILELPQSILTCETLVELKLCSDIVID-IPGSG---------- 164
            +    V++  N +R +  L+L Q+      L+EL+   +++ID + GSG          
Sbjct: 119 LYNDNQVFAKYNVSRLQPYLKLRQA------LLELRPAKNVLIDGVLGSGKTWVALDVCL 172

Query: 165 ----ICFPSLKI--LHFGFCHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQTINIIVQ 218
                C    KI  L+   C+    +++        ++        H  +    I+ I  
Sbjct: 173 SYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQA 232

Query: 219 TLKRLSISVFVMQGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEI--PFLKKAF----- 271
            L+RL       + Y                    N L   VL  +       AF     
Sbjct: 233 ELRRL----LKSKPY-------------------ENCL--LVLLNVQNAKAWNAFNLSCK 267

Query: 272 VLVEFNVLRRNSSGIF--ENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNN---LPT 326
           +L    +  R             + + L     +   L+  +  ++L   L+     LP 
Sbjct: 268 IL----LTTRFKQVTDFLSAATTTHISLDHHSMT---LTPDEVKSLLLKYLDCRPQDLPR 320

Query: 327 FSNLISLELHIDSCFGWKLLTPFLKRSPSLKVLNLD-FSKAHK-----LTPNTLQDIVFE 380
                +    + S    + +   L    + K +N D  +   +     L P   +  +F+
Sbjct: 321 EVLTTNP-RRL-SIIA-ESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRK-MFD 376

Query: 381 DLVCVEPECAPNCLSSCVEVIEI--TNLKREDYELEMVRYLLENSKVLEK 428
            L  V P  A   + +   ++ +   ++ + D  + +    L    ++EK
Sbjct: 377 RLS-VFPPSAH--IPT--ILLSLIWFDVIKSDVMVVVN--KLHKYSLVEK 419
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.1
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.04
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.99
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.99
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.88
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.85
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.83
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.81
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.8
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.79
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.78
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.78
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.77
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.76
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.76
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.75
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.75
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.75
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.74
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.74
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.74
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.72
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.69
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.67
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.67
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.66
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.66
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.66
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.65
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.65
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.59
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.58
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.57
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.57
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.57
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.56
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.54
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.5
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.48
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.47
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.47
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.46
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.46
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.45
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.43
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.41
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.4
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.39
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.39
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.38
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.37
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.35
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.33
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.3
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.27
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.25
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.24
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.2
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.2
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.1
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.09
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.0
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.98
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.91
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.79
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.78
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.77
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.68
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.66
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.59
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.49
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.41
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.34
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.3
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.29
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.25
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.19
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.93
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.92
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.86
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.02
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 95.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 95.81
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.8
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 95.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 93.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 91.57
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 90.4
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=99.85  E-value=9.6e-22  Score=202.75  Aligned_cols=335  Identities=14%  Similarity=0.149  Sum_probs=179.9

Q ss_pred             CccCCCCChHHHHHHHcCCC-ccchhhhcccchhhHHhhcc-cceeeecCCCCCCcchHHHHHHHHHhccCCCCeeEEEE
Q 012521           13 GDITSRLPDHLLCRILSCLP-TEDAVRTCILSSRWRDLWTS-IHGLYFDGGNEKPRSWFLNFVERVLGLCQLKDIHNFHL   90 (461)
Q Consensus        13 ~D~~s~LPd~vl~~Ils~Lp-~~~~~~~s~vsrrWr~lw~~-~~~l~~~~~~~~~~~~~~~~v~~~l~~~~~~~i~~l~l   90 (461)
                      .|+++.|||||+.+||+||| .+|+++++.|||||+++... ...+.+.......       ...++.+.  +.++++.+
T Consensus         3 ~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~-------~~~~~~~~--~~L~~L~L   73 (594)
T 2p1m_B            3 KRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVS-------PATVIRRF--PKVRSVEL   73 (594)
T ss_dssp             -------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSC-------HHHHHHHC--TTCCEEEE
T ss_pred             ccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccC-------HHHHHhhC--CCceEEec
Confidence            58999999999999999999 99999999999999987211 1224443221111       01222222  35777777


Q ss_pred             EEccc-------CcCCcccHHHHHHHHHh--cCccEEEEEEeecccc-------cc------------cceecccCCccc
Q 012521           91 RSSTL-------REKDFSRVSEWICFAIQ--RNVRHLFLDVYSTSNF-------TR------------HKRILELPQSIL  142 (461)
Q Consensus        91 ~~~~~-------~~~~~~~~~~wl~~~~~--~~l~~L~l~~~~~~~~-------~~------------~~~~~~lp~~l~  142 (461)
                      .....       ...+.+.+..|+.....  .++++|++........       .+            ......++....
T Consensus        74 ~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~  153 (594)
T 2p1m_B           74 KGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAA  153 (594)
T ss_dssp             ECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHHHHCTTCCEEEEESCEEEEHHHHHHHHH
T ss_pred             cCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHHHHHHhCCCCcEEeCCCcCCCCHHHHHHHHH
Confidence            75431       01223456677776654  3677776654321000       00            001111333333


Q ss_pred             CCCCccEEEeceeeecc-----CCCCccccCCccEEEeee-e-cCChhHHHHHHhcCCccCeEEEeeeecC---------
Q 012521          143 TCETLVELKLCSDIVID-----IPGSGICFPSLKILHFGF-C-HPDRGLMQKFFSSCPTLEELTIEGILHP---------  206 (461)
Q Consensus       143 ~~~~L~~L~L~~~~l~~-----~~~~~~~~~~L~~L~L~~-~-~~~~~~l~~l~~~cp~Le~L~L~~~~c~---------  206 (461)
                      .|++|++|+|.+|.+.+     ++.+...+++|++|+|.+ . ..++..+..++.+||+|+.|++.+  |.         
T Consensus       154 ~~~~L~~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~--~~~~~~l~~~~  231 (594)
T 2p1m_B          154 TCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNR--AVPLEKLATLL  231 (594)
T ss_dssp             HCTTCCEEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCT--TSCHHHHHHHH
T ss_pred             hCCCCCEEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCC--CCcHHHHHHHH
Confidence            57888888888877543     112213577899999887 3 345678888888899999999987  51         


Q ss_pred             --CCCeeEEEE--------------------------------------------EcCCcceEEEEEEeecCcccceeEE
Q 012521          207 --RDNVQTINI--------------------------------------------IVQTLKRLSISVFVMQGYVSKRIFE  240 (461)
Q Consensus       207 --~~~~~~~~i--------------------------------------------~~~sL~~L~l~~~~~~~~~~~~~~~  240 (461)
                        +..+..+.+                                            .+++|++|.+.+|. ........+.
T Consensus       232 ~~~~~L~~L~l~~~~~~~~~~~~~~l~~~l~~~~~L~~Ls~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-l~~~~l~~~~  310 (594)
T 2p1m_B          232 QRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYAT-VQSYDLVKLL  310 (594)
T ss_dssp             HHCTTCSEEECSBCCCCCCHHHHHHHHHHHHTCTTCCEEECCBTCCGGGGGGGHHHHTTCCEEECTTCC-CCHHHHHHHH
T ss_pred             hcCCcceEcccccccCccchhhHHHHHHHHhcCCCcccccCCcccchhhHHHHHHhhCCCCEEEccCCC-CCHHHHHHHH
Confidence              122222220                                            23678888877765 2111111112


Q ss_pred             EecCCccEEEEeecccCc---eEeecCCCeeEEEEEEEEceeecCCCCcchhhHHHHhhcCCCceEEEEecCCChHHHhh
Q 012521          241 IRTPNLEYLSIIANSLAY---FVLDEIPFLKKAFVLVEFNVLRRNSSGIFENDARSALELVKRIKSMKILSLPDSMTVLS  317 (461)
Q Consensus       241 ~~~p~L~~L~~~~~~~~~---~~~~~~~~L~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~L~l~~~~~~~~~l~  317 (461)
                      ..+|+|++|.+.++....   .....+++|+.+.+..+...+...........+..+..++++|+.|.+..  +.+....
T Consensus       311 ~~~~~L~~L~l~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~g~~~~~~l~~~~l~~l~~~~~~L~~L~~~~--~~l~~~~  388 (594)
T 2p1m_B          311 CQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFC--RQMTNAA  388 (594)
T ss_dssp             TTCTTCCEEEEEGGGHHHHHHHHHHHCTTCCEEEEECSCTTCSSCSSCCCHHHHHHHHHHCTTCCEEEEEE--SCCCHHH
T ss_pred             hcCCCcCEEeCcCccCHHHHHHHHHhCCCCCEEEEecCcccccccCCCCCHHHHHHHHHhchhHHHHHHhc--CCcCHHH
Confidence            256889999888762211   11234788888777432100000000111144555666677788777665  3332110


Q ss_pred             hhccCCCCCCCccceEEEEe-----ccCCC----hhhHHHHHhcCCCCeeEEEee
Q 012521          318 FVLNNNLPTFSNLISLELHI-----DSCFG----WKLLTPFLKRSPSLKVLNLDF  363 (461)
Q Consensus       318 ~~~~~~~~~~~~L~~L~l~~-----~~~~~----~~~l~~ll~~~p~L~~L~l~~  363 (461)
                      .  ......+++|++|++..     +....    ..++..++++||+|+.|++.+
T Consensus       389 ~--~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~l~~~~~~L~~L~L~~  441 (594)
T 2p1m_B          389 L--ITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSG  441 (594)
T ss_dssp             H--HHHHHHCTTCCEEEEEESSTTCCCTTTCCCTHHHHHHHHHHCTTCCEEECCS
T ss_pred             H--HHHHhhCCCcceeEeecccCCCcccccCCchhhHHHHHHhhCCCccEEeecC
Confidence            0  00011345677777772     22222    345666667777777777754
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 4e-06
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 2e-05
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 5e-04
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 7e-04
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.1 bits (101), Expect = 4e-06
 Identities = 12/36 (33%), Positives = 16/36 (44%)

Query: 14 DITSRLPDHLLCRILSCLPTEDAVRTCILSSRWRDL 49
          D  S LP  L   +LS L  +D ++       WR L
Sbjct: 17 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRIL 52
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.17
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.16
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.68
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.67
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.39
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.25
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.23
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.21
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.19
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.16
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.13
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.11
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.04
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.03
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.99
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.98
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.55
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.53
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.41
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.29
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.08
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.98
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.7
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.05
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 93.68
d2ifga3156 High affinity nerve growth factor receptor, N-term 92.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.06
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 89.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 86.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 83.63
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.17  E-value=2.2e-13  Score=124.24  Aligned_cols=180  Identities=17%  Similarity=0.151  Sum_probs=101.4

Q ss_pred             CCcccCCCCccEEEeceeeecc--CCCCccccCCccEEEeee-ecCChhHHHHHHhcCCccCeEEEeeeecCCCCeeE--
Q 012521          138 PQSILTCETLVELKLCSDIVID--IPGSGICFPSLKILHFGF-CHPDRGLMQKFFSSCPTLEELTIEGILHPRDNVQT--  212 (461)
Q Consensus       138 p~~l~~~~~L~~L~L~~~~l~~--~~~~~~~~~~L~~L~L~~-~~~~~~~l~~l~~~cp~Le~L~L~~~~c~~~~~~~--  212 (461)
                      +..+..|++|++|+|.+|.+.+  +..+ ..+++|++|+|.+ ...++.++..++.+||.|++|++.+  |.  .+..  
T Consensus        64 ~~l~~~c~~L~~L~L~~~~l~~~~~~~l-~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~--c~--~~~~~~  138 (284)
T d2astb2          64 HGILSQCSKLQNLSLEGLRLSDPIVNTL-AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSW--CF--DFTEKH  138 (284)
T ss_dssp             HHHHTTBCCCSEEECTTCBCCHHHHHHH-TTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCC--CT--TCCHHH
T ss_pred             HHHHHhCCCcccccccccCCCcHHHHHH-hcCCCCcCccccccccccccccchhhHHHHhcccccccc--cc--cccccc
Confidence            3334458888888888887643  1222 4578888888887 6667778888888888888888888  52  2211  


Q ss_pred             ----EEEEcCCcceEEEEEEee-cCcccceeEEEecCCccEEEEeecccCceEeecCCCeeEEEEEEEEceeecCCCCcc
Q 012521          213 ----INIIVQTLKRLSISVFVM-QGYVSKRIFEIRTPNLEYLSIIANSLAYFVLDEIPFLKKAFVLVEFNVLRRNSSGIF  287 (461)
Q Consensus       213 ----~~i~~~sL~~L~l~~~~~-~~~~~~~~~~~~~p~L~~L~~~~~~~~~~~~~~~~~L~~~~l~~~~~~~~~~~~~~~  287 (461)
                          +...+++|+.|.+.+|.. ..+.....+...+|+|++|+++++...                     .        
T Consensus       139 ~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~i---------------------t--------  189 (284)
T d2astb2         139 VQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVML---------------------K--------  189 (284)
T ss_dssp             HHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTC---------------------C--------
T ss_pred             chhhhcccccccchhhhcccccccccccccccccccccccccccccccCC---------------------C--------
Confidence                111235666666665432 111111222233455555555432110                     0        


Q ss_pred             hhhHHHHhhcCCCceEEEEecCCChHHHhhhhccCCCCCCCccceEEEEeccCCChhhHHHHHhcCCCCee
Q 012521          288 ENDARSALELVKRIKSMKILSLPDSMTVLSFVLNNNLPTFSNLISLELHIDSCFGWKLLTPFLKRSPSLKV  358 (461)
Q Consensus       288 ~~~~~~~l~~~~~l~~L~l~~~~~~~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~l~~ll~~~p~L~~  358 (461)
                       +.....+..+++|++|.++.+.. +   ++.....+..+++|+.|++..+  ....++..+.++||+|+.
T Consensus       190 -d~~~~~l~~~~~L~~L~L~~C~~-i---~~~~l~~L~~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~i  253 (284)
T d2astb2         190 -NDCFQEFFQLNYLQHLSLSRCYD-I---IPETLLELGEIPTLKTLQVFGI--VPDGTLQLLKEALPHLQI  253 (284)
T ss_dssp             -GGGGGGGGGCTTCCEEECTTCTT-C---CGGGGGGGGGCTTCCEEECTTS--SCTTCHHHHHHHSTTSEE
T ss_pred             -chhhhhhcccCcCCEEECCCCCC-C---ChHHHHHHhcCCCCCEEeeeCC--CCHHHHHHHHHhCccccc
Confidence             11111244677888888876321 1   1222233445677887777655  355667777778888763
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure