Citrus Sinensis ID: 012547

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MVQTNEVVNDSLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
cccccHHHccccccccccccccccHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccccccccccccccEEEEccHHHHHccccEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccHHHHHHHHHccccccEEEEccccHHHHHHcccccEEEEEccHHcHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccHHHHHHHHccccHHHHHHHHcccccEEcHHHHHHHHHHHHHcccEEccccccccccccccccHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHcccccccccccccc
ccccEEEEEcccccccccccccccHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHcHcccHHHHccHHHHHHHHHHHcccccccccccccccccHHHEcccccccccccccccccEEcccHHHHHccccEEEEEccHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccEEEEHHHcHHHHccccHccEEEEccccHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEEcccEEEEEHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHEEEEccccHHHHHHHHHHccccHHHHHHHHccccEEEcHHHHHHHHHHHHHccccEccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHccccccHHccccc
mvqtnevvndslssnglihhtngsLEERLDELRRLMgkaegdplrivgvgagAWGSVFTAMLQDSYGYLRDKVLIRIwrrpgrsvdrATAEHLFEVINSREDVLRRLIRRCAYLKYVEARlgdrtlhadeilkdgfclnmidtplcplkVVTNLQEavwdadivinglpstetKEVFEEISRYWKERITVPVIISLAKGVeaeleavpriitptqminratgvpienilylggpniaseIYNKEYANARICGAEKWRKPLAkflrrphftvwdngdlvtHEVMGGLKNVYAIGAALtnesatsksVYFAHCTSEMVFITHLLaeepeklagpllADTYVTLLKGRnawygqelakgrltldlgdsikgkgmIQGISAVKAFYELLSQsslsvlhpeenkpvatveLCPILKMLYKILIMRESPIQAILEALRdetmndprDRIEIAQThvfyrpsllgqlp
mvqtnevvndslssnglihhtngsLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWrrpgrsvdrataehlfevinsredVLRRLIRRCAYLKYvearlgdrtlhaDEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADivinglpstetkEVFEEISRywkeritvPVIISLAKGVEAeleavpriitptqminraTGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAqthvfyrpsllgqlp
MVQTNEVVNDSLSSNGLIHHTNGSleerldelrrlMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
***************************************EGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRD********RIEIAQTHVFYRP*******
*********************************************IVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEA***************AQTHVFYRPSLLG***
*********DSLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
***TNEVVNDSLSSNGLI****GSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQ**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQTNEVVNDSLSSNGLIHHTxxxxxxxxxxxxxxxxxxxxxPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
Q8S0G4456 Probable glycerol-3-phosp yes no 0.971 0.982 0.830 0.0
Q8S2G5467 Probable glycerol-3-phosp no no 0.954 0.942 0.831 0.0
O22216462 Glycerol-3-phosphate dehy yes no 0.973 0.971 0.832 0.0
Q65X70465 Probable glycerol-3-phosp no no 0.934 0.926 0.822 0.0
B3EI28333 Glycerol-3-phosphate dehy yes no 0.546 0.756 0.259 2e-13
Q8KG76333 Glycerol-3-phosphate dehy yes no 0.546 0.756 0.258 1e-12
Q3V7H1357 Glycerol-3-phosphate dehy yes no 0.514 0.663 0.318 4e-12
Q0SE35335 Glycerol-3-phosphate dehy yes no 0.603 0.829 0.252 5e-12
P61738331 Glycerol-3-phosphate dehy yes no 0.646 0.900 0.225 7e-12
B2V3Z2330 Glycerol-3-phosphate dehy yes no 0.557 0.778 0.253 1e-11
>sp|Q8S0G4|GPDH1_ORYSJ Probable glycerol-3-phosphate dehydrogenase [NAD(+)] 1, cytosolic OS=Oryza sativa subsp. japonica GN=Os01g0939600 PE=2 SV=1 Back     alignment and function desciption
 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/453 (83%), Positives = 412/453 (90%), Gaps = 5/453 (1%)

Query: 11  SLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLR 70
           S+  NG ++  NG+ EERLDELRRL+GK++GD L+IVG+GAGAWGSVF A+LQD+YG  R
Sbjct: 4   SVHVNGSVNGGNGT-EERLDELRRLLGKSDGDLLKIVGIGAGAWGSVFAALLQDAYGRFR 62

Query: 71  DKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADE 130
           +KV IRIWRR GRSVDR TAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTL+ADE
Sbjct: 63  EKVQIRIWRRAGRSVDRTTAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLYADE 122

Query: 131 ILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITV 190
           IL+DGFCLNMIDTPLCPLKVVTNLQEAVWDADIV+NGLPSTET+EVFEEIS+YWKERI+V
Sbjct: 123 ILRDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYWKERISV 182

Query: 191 PVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI 250
           PVIISLAKG+EA L+ +PRIITPTQMI+ ATGVP ENILYLGGPNIASEIYNKEYANARI
Sbjct: 183 PVIISLAKGIEASLDPIPRIITPTQMISSATGVPTENILYLGGPNIASEIYNKEYANARI 242

Query: 251 CGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIG----AALTNESATSKSV 306
           CG+ KWRKPLAKFLR+PHF VWDN DLVTHEVMGGLKNVYAIG    AALTNESATSKSV
Sbjct: 243 CGSNKWRKPLAKFLRQPHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV 302

Query: 307 YFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSI 366
           YFAHCTSEM+FITHLL E+PEKLAGPLLADTYVTLLKGRNAWYGQ LAKG L+ D+GDSI
Sbjct: 303 YFAHCTSEMIFITHLLTEQPEKLAGPLLADTYVTLLKGRNAWYGQMLAKGELSPDMGDSI 362

Query: 367 KGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQA 426
           KGKGMIQGISAV AF+ELLSQ SLSV HPEENK VA  ELCPILK LY+ILI RE   + 
Sbjct: 363 KGKGMIQGISAVGAFFELLSQPSLSVQHPEENKQVAPAELCPILKRLYRILIKRELSTRD 422

Query: 427 ILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQ 459
           IL+ALRDETMNDPR+RIE+AQ+H FYRPSLLG+
Sbjct: 423 ILQALRDETMNDPRERIEMAQSHAFYRPSLLGK 455
May be involved in cell redox homeostasis.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8
>sp|Q8S2G5|GPDH2_ORYSJ Probable glycerol-3-phosphate dehydrogenase [NAD(+)] 2, cytosolic OS=Oryza sativa subsp. japonica GN=Os01g0801600 PE=2 SV=1 Back     alignment and function description
>sp|O22216|GPDHC_ARATH Glycerol-3-phosphate dehydrogenase [NAD(+)] GPDHC1, cytosolic OS=Arabidopsis thaliana GN=GPDHC1 PE=2 SV=1 Back     alignment and function description
>sp|Q65X70|GPDH3_ORYSJ Probable glycerol-3-phosphate dehydrogenase [NAD(+)] 3, cytosolic OS=Oryza sativa subsp. japonica GN=Os05g0495700 PE=2 SV=1 Back     alignment and function description
>sp|B3EI28|GPDA_CHLL2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|Q8KG76|GPDA_CHLTE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|Q3V7H1|GPDA_ACIAD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter sp. (strain ADP1) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|Q0SE35|GPDA1_RHOSR Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 OS=Rhodococcus sp. (strain RHA1) GN=gpsA1 PE=3 SV=1 Back     alignment and function description
>sp|P61738|GPDA_CORDI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|B2V3Z2|GPDA_CLOBA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gpsA PE=3 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
TAIR|locus:2062734462 GPDHC1 [Arabidopsis thaliana ( 0.973 0.971 0.812 4.2e-198
TAIR|locus:2077387466 AT3G07690 [Arabidopsis thalian 0.924 0.914 0.8 6e-190
TIGR_CMR|DET_1397359 DET_1397 "glycerol-3-phosphate 0.507 0.651 0.271 9.7e-11
TIGR_CMR|BA_1526340 BA_1526 "glycerol-3-phosphate 0.490 0.664 0.248 1.4e-10
UNIPROTKB|P95113334 gpsA "Glycerol-3-phosphate deh 0.537 0.742 0.242 2.6e-10
UNIPROTKB|I3LLU0351 GPD1L "Uncharacterized protein 0.492 0.646 0.264 8.3e-10
MGI|MGI:1289257351 Gpd1l "glycerol-3-phosphate de 0.494 0.649 0.261 9.2e-10
UNIPROTKB|F1P0W8380 GPD1L "Uncharacterized protein 0.492 0.597 0.264 1.2e-09
RGD|1560123351 Gpd1l "glycerol-3-phosphate de 0.492 0.646 0.264 1.6e-09
UNIPROTKB|Q8N335351 GPD1L "Glycerol-3-phosphate de 0.492 0.646 0.260 2e-09
TAIR|locus:2062734 GPDHC1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1918 (680.2 bits), Expect = 4.2e-198, P = 4.2e-198
 Identities = 368/453 (81%), Positives = 400/453 (88%)

Query:    11 SLSSNGLIHHTNGSXXXXXXXXXXXMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLR 70
             SL SNG +HH   +           +GK+E DPLRIV VGAGAWGSVF A+LQ+SYG  R
Sbjct:     9 SLQSNGSVHHIGLNLEEKLDEFRRLLGKSEKDPLRIVSVGAGAWGSVFAALLQESYGGFR 68

Query:    71 DKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADE 130
             DK  IRIWRR GR+VDR TAEHLFEVINSRED+LRRLIRRCAYLKYVEARLGDRTL+ADE
Sbjct:    69 DKFQIRIWRRAGRAVDRETAEHLFEVINSREDILRRLIRRCAYLKYVEARLGDRTLYADE 128

Query:   131 ILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITV 190
             ILKDGFCLNM+DTPLCPLKVVTNLQEAVWDADIV+NGLPSTET+EVFEEIS+YWKERITV
Sbjct:   129 ILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYWKERITV 188

Query:   191 PVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI 250
             P+IISL+KG+E  LE VP IITPT+MI++ATGVPI+N+LYLGGPNIA+EIYNKEYANARI
Sbjct:   189 PIIISLSKGIETALEPVPHIITPTKMIHQATGVPIDNVLYLGGPNIAAEIYNKEYANARI 248

Query:   251 CGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGA----ALTNESATSKSV 306
             CGA KWRKPLAKFLR+PHF VWDN DLVTHEVMGGLKNVYAIGA    ALTNESATSKSV
Sbjct:   249 CGAAKWRKPLAKFLRQPHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV 308

Query:   307 YFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSI 366
             YFAHCTSEM+FITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQ LAKG +  D+GDSI
Sbjct:   309 YFAHCTSEMIFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQMLAKGEINRDMGDSI 368

Query:   367 KGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQA 426
              GKGMIQG+SAV AFY+LLSQSSLS+L  EE KPVA VE CPILK LYKILI RE   QA
Sbjct:   369 SGKGMIQGVSAVGAFYQLLSQSSLSILPSEEKKPVAPVESCPILKTLYKILITREQSTQA 428

Query:   427 ILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQ 459
             IL+ALRDET+NDPRDRIEIAQ+H FYRPSLLGQ
Sbjct:   429 ILQALRDETLNDPRDRIEIAQSHAFYRPSLLGQ 461
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004367 "glycerol-3-phosphate dehydrogenase [NAD+
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006072 "glycerol-3-phosphate metabolic process" evidence=IEA;ISS
GO:0009331 "glycerol-3-phosphate dehydrogenase complex" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0046168 "glycerol-3-phosphate catabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2077387 AT3G07690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1397 DET_1397 "glycerol-3-phosphate dehydrogenase, NAD-dependent" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1526 BA_1526 "glycerol-3-phosphate dehydrogenase (NAD(P)+)" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P95113 gpsA "Glycerol-3-phosphate dehydrogenase [NAD(P)+]" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLU0 GPD1L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1289257 Gpd1l "glycerol-3-phosphate dehydrogenase 1-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0W8 GPD1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1560123 Gpd1l "glycerol-3-phosphate dehydrogenase 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N335 GPD1L "Glycerol-3-phosphate dehydrogenase 1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22216GPDHC_ARATH1, ., 1, ., 1, ., 80.83220.97390.9718yesno
Q65X70GPDH3_ORYSJ1, ., 1, ., 1, ., 80.82290.93490.9268nono
Q8S0G4GPDH1_ORYSJ1, ., 1, ., 1, ., 80.83000.97180.9824yesno
Q8S2G5GPDH2_ORYSJ1, ., 1, ., 1, ., 80.83140.95440.9421nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!
4th Layer1.1.1.94LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
pfam07479145 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol- 2e-30
COG0240329 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase 9e-24
PRK00094325 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosp 5e-17
PRK12439341 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-p 1e-13
PTZ00345365 PTZ00345, PTZ00345, glycerol-3-phosphate dehydroge 2e-13
TIGR03376342 TIGR03376, glycerol3P_DH, glycerol-3-phosphate deh 1e-12
pfam01210157 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol- 1e-08
PRK14619308 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-p 5e-07
PRK14618328 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-p 5e-06
PRK14620326 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-p 6e-04
>gnl|CDD|116100 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus Back     alignment and domain information 
 Score =  114 bits (288), Expect = 2e-30
 Identities = 47/164 (28%), Positives = 62/164 (37%), Gaps = 31/164 (18%)

Query: 276 DLVTHEVMGGLKNVYAIGA----ALTNESATSKSVYFAHCTSEMVFITHLLAEEPE---K 328
           D+V  E+ G LKNV AI A     L      +K+        EM+     L   PE    
Sbjct: 2   DVVGVEIGGALKNVIAIAAGILDGLGFG-DNTKAALITRGLMEMIKFGAALGGGPETFFG 60

Query: 329 LAGPLLADTYVTLL--KGRNAWYGQELAKGRLTLDLGDSIKGKGM-IQGISAVKAFYELL 385
           LAG  L D   T     GRN   G+ L KG+    L +  K  G   +G+   K  YEL 
Sbjct: 61  LAG--LGDLITTCTSELGRNRRVGEALGKGK---SLEEIEKELGQVAEGVKTAKEVYELA 115

Query: 386 SQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILE 429
            +  L                 P+   +Y+IL     P +AI  
Sbjct: 116 KRKGLD---------------FPLFTAVYRILYEGLKPEEAIEY 144

NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyzes the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the C-terminal substrate-binding domain. Length = 145
>gnl|CDD|223318 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234629 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|171500 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240373 PTZ00345, PTZ00345, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234190 TIGR03376, glycerol3P_DH, glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>gnl|CDD|201664 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>gnl|CDD|237771 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237770 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173083 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 100.0
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 100.0
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 100.0
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 100.0
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 100.0
PF07479149 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate 100.0
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.94
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.92
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.9
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.9
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.9
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.87
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.87
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.84
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.79
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.79
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.76
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.73
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.7
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.7
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.69
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.65
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.65
PRK07680273 late competence protein ComER; Validated 99.64
PLN02688266 pyrroline-5-carboxylate reductase 99.64
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.61
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.59
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.57
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.55
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.54
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.52
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.52
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.52
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.51
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.51
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.5
PRK15059292 tartronate semialdehyde reductase; Provisional 99.49
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.48
PLN02353473 probable UDP-glucose 6-dehydrogenase 99.47
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.45
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.44
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.43
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.43
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.4
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.38
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.38
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.36
PLN02858 1378 fructose-bisphosphate aldolase 99.36
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.35
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.35
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.35
PLN02858 1378 fructose-bisphosphate aldolase 99.34
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.34
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.34
PRK05479330 ketol-acid reductoisomerase; Provisional 99.33
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.33
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.32
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.31
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.24
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 99.24
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.23
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.2
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.19
KOG0409327 consensus Predicted dehydrogenase [General functio 99.18
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.17
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.15
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.14
PRK07417279 arogenate dehydrogenase; Reviewed 99.13
PRK08655437 prephenate dehydrogenase; Provisional 99.13
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.09
PRK08507275 prephenate dehydrogenase; Validated 99.09
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.08
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.06
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.02
PLN02256304 arogenate dehydrogenase 99.01
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.99
PRK06545359 prephenate dehydrogenase; Validated 98.97
PRK11730715 fadB multifunctional fatty acid oxidation complex 98.95
KOG2666481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 98.94
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.91
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.9
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 98.88
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.83
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.82
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 98.79
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.72
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 98.71
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 98.7
PLN02712667 arogenate dehydrogenase 98.66
PLN02712 667 arogenate dehydrogenase 98.63
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.6
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 98.53
PRK13403335 ketol-acid reductoisomerase; Provisional 98.5
PRK08818370 prephenate dehydrogenase; Provisional 98.49
PRK06223307 malate dehydrogenase; Reviewed 98.43
PRK12480330 D-lactate dehydrogenase; Provisional 98.42
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.38
PTZ00082321 L-lactate dehydrogenase; Provisional 98.32
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.32
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.26
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.26
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.23
PTZ00117319 malate dehydrogenase; Provisional 98.21
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.21
PRK08605332 D-lactate dehydrogenase; Validated 98.2
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 98.19
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.98
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.97
PLN02602350 lactate dehydrogenase 97.91
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.9
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.87
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.86
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.82
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 97.82
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 97.81
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.79
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.75
PRK15076431 alpha-galactosidase; Provisional 97.74
PRK07574385 formate dehydrogenase; Provisional 97.72
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.72
PRK06444197 prephenate dehydrogenase; Provisional 97.71
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.7
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.7
PRK13243333 glyoxylate reductase; Reviewed 97.69
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.68
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.67
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 97.65
PLN03139386 formate dehydrogenase; Provisional 97.63
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.61
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.6
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.59
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.57
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 97.57
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.55
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.55
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 97.55
PRK05442326 malate dehydrogenase; Provisional 97.54
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.52
PRK05225487 ketol-acid reductoisomerase; Validated 97.5
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.45
PRK06141314 ornithine cyclodeaminase; Validated 97.44
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.44
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.41
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.4
PF10100429 DUF2338: Uncharacterized protein conserved in bact 97.4
PRK06436303 glycerate dehydrogenase; Provisional 97.38
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.37
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.32
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 97.31
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 97.31
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.31
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.29
TIGR00036266 dapB dihydrodipicolinate reductase. 97.26
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.24
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.23
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.22
PLN00203519 glutamyl-tRNA reductase 97.21
PRK05086312 malate dehydrogenase; Provisional 97.2
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.19
PRK00048257 dihydrodipicolinate reductase; Provisional 97.17
PRK08618325 ornithine cyclodeaminase; Validated 97.16
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.16
COG2344211 AT-rich DNA-binding protein [General function pred 97.16
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.16
PLN00106323 malate dehydrogenase 97.16
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.14
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.13
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.1
PRK08291330 ectoine utilization protein EutC; Validated 97.09
PLN02928347 oxidoreductase family protein 97.09
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.09
PLN00112444 malate dehydrogenase (NADP); Provisional 97.05
PRK09496453 trkA potassium transporter peripheral membrane com 97.04
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.04
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.04
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.01
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.0
PRK13303265 L-aspartate dehydrogenase; Provisional 97.0
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.99
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.98
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.97
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.94
PRK09496453 trkA potassium transporter peripheral membrane com 96.92
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.91
PRK13940414 glutamyl-tRNA reductase; Provisional 96.91
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 96.88
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.86
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.86
PLN02306386 hydroxypyruvate reductase 96.83
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.8
PRK07589346 ornithine cyclodeaminase; Validated 96.8
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 96.77
PRK07340304 ornithine cyclodeaminase; Validated 96.75
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.74
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.73
PTZ00325321 malate dehydrogenase; Provisional 96.72
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.71
PRK06487317 glycerate dehydrogenase; Provisional 96.69
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 96.67
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.67
PRK06407301 ornithine cyclodeaminase; Provisional 96.66
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.64
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.63
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.63
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.63
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.62
PRK06932314 glycerate dehydrogenase; Provisional 96.62
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 96.62
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.59
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 96.56
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.55
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.54
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.53
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 96.52
PRK06823315 ornithine cyclodeaminase; Validated 96.51
KOG1495332 consensus Lactate dehydrogenase [Energy production 96.51
PRK11579346 putative oxidoreductase; Provisional 96.49
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 96.48
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.46
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 96.45
PLN02494477 adenosylhomocysteinase 96.43
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.39
PRK06046326 alanine dehydrogenase; Validated 96.37
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.3
COG0673342 MviM Predicted dehydrogenases and related proteins 96.29
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.28
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.26
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.24
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.22
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.19
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.17
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 96.16
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.15
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.07
PRK08328231 hypothetical protein; Provisional 96.07
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.04
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.0
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.99
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.96
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.95
PRK06199379 ornithine cyclodeaminase; Validated 95.91
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.88
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.87
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 95.84
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.79
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.78
PRK08300302 acetaldehyde dehydrogenase; Validated 95.77
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.7
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 95.62
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.53
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 95.5
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 95.48
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.47
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 95.41
PRK04148134 hypothetical protein; Provisional 95.36
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.33
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 95.24
PRK10669558 putative cation:proton antiport protein; Provision 95.24
PTZ00075476 Adenosylhomocysteinase; Provisional 95.23
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.2
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.2
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.16
COG4408431 Uncharacterized protein conserved in bacteria [Fun 95.14
PRK06719157 precorrin-2 dehydrogenase; Validated 95.03
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.0
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.96
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.93
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.92
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 94.91
PRK14982340 acyl-ACP reductase; Provisional 94.9
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 94.89
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.84
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 94.72
CHL00194317 ycf39 Ycf39; Provisional 94.71
PRK03659601 glutathione-regulated potassium-efflux system prot 94.68
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 94.58
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 94.57
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
COG2910211 Putative NADH-flavin reductase [General function p 94.51
PRK14027283 quinate/shikimate dehydrogenase; Provisional 94.5
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 94.39
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.38
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 94.33
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 94.32
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 94.3
PRK06153393 hypothetical protein; Provisional 94.16
PRK07236386 hypothetical protein; Provisional 94.07
PRK06753373 hypothetical protein; Provisional 94.07
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 94.04
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.01
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.97
PRK03562621 glutathione-regulated potassium-efflux system prot 93.86
PRK08163396 salicylate hydroxylase; Provisional 93.7
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 93.68
PRK08223287 hypothetical protein; Validated 93.67
PRK06349426 homoserine dehydrogenase; Provisional 93.65
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.64
PLN02383344 aspartate semialdehyde dehydrogenase 93.64
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 93.57
PRK06847375 hypothetical protein; Provisional 93.54
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.54
PRK10206344 putative oxidoreductase; Provisional 93.52
PRK07411390 hypothetical protein; Validated 93.49
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.48
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 93.47
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 93.31
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 93.28
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 93.27
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.23
PRK06270341 homoserine dehydrogenase; Provisional 93.17
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 93.1
PRK08040336 putative semialdehyde dehydrogenase; Provisional 93.0
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.95
PRK05868372 hypothetical protein; Validated 92.94
PRK07588391 hypothetical protein; Provisional 92.93
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 92.86
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 92.81
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 92.77
PRK07538413 hypothetical protein; Provisional 92.7
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 92.7
PRK07877 722 hypothetical protein; Provisional 92.61
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 92.57
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 92.55
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 92.53
PRK06185407 hypothetical protein; Provisional 92.51
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 92.43
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.31
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 92.28
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 92.24
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 92.18
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.14
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.99
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 91.95
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 91.85
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.67
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.62
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 91.59
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 91.57
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 91.38
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 91.26
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.22
PRK11259376 solA N-methyltryptophan oxidase; Provisional 91.19
PRK07045388 putative monooxygenase; Reviewed 91.18
COG0300265 DltE Short-chain dehydrogenases of various substra 91.05
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 90.98
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 90.97
PRK10537393 voltage-gated potassium channel; Provisional 90.84
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 90.82
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 90.82
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 90.77
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 90.76
PLN02172461 flavin-containing monooxygenase FMO GS-OX 90.71
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 90.62
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 90.61
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 90.54
PRK06475400 salicylate hydroxylase; Provisional 90.54
PRK08013400 oxidoreductase; Provisional 90.5
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 90.42
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 90.39
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 90.37
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 90.35
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 90.35
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 90.34
PRK08132 547 FAD-dependent oxidoreductase; Provisional 90.14
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 90.13
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 90.11
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 90.03
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 90.0
PRK06392326 homoserine dehydrogenase; Provisional 89.99
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 89.97
PLN02464 627 glycerol-3-phosphate dehydrogenase 89.75
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 89.75
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 89.73
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 89.67
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 89.64
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 89.56
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 89.55
PRK06126 545 hypothetical protein; Provisional 89.54
PF08484160 Methyltransf_14: C-methyltransferase C-terminal do 89.52
PLN02852491 ferredoxin-NADP+ reductase 89.48
PLN02985514 squalene monooxygenase 89.42
PRK09126392 hypothetical protein; Provisional 89.38
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 89.32
PRK14851 679 hypothetical protein; Provisional 89.29
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 89.29
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 89.24
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 89.16
PRK12770352 putative glutamate synthase subunit beta; Provisio 89.15
PRK08374336 homoserine dehydrogenase; Provisional 89.12
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 88.97
PRK12779 944 putative bifunctional glutamate synthase subunit b 88.89
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 88.89
PLN03075296 nicotianamine synthase; Provisional 88.81
PLN02686367 cinnamoyl-CoA reductase 88.79
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 88.73
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 88.72
COG3349485 Uncharacterized conserved protein [Function unknow 88.62
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 88.61
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 88.54
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 88.52
PRK12814652 putative NADPH-dependent glutamate synthase small 88.48
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.47
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 88.39
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 88.36
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 88.31
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 88.29
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.16
PRK12829264 short chain dehydrogenase; Provisional 88.07
PRK05884223 short chain dehydrogenase; Provisional 88.07
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 88.02
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 87.94
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 87.87
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 87.68
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 87.65
PRK08244493 hypothetical protein; Provisional 87.63
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 87.51
PTZ00188506 adrenodoxin reductase; Provisional 87.45
PRK12831464 putative oxidoreductase; Provisional 87.37
PRK10538248 malonic semialdehyde reductase; Provisional 87.36
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 87.31
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 87.29
PRK07523255 gluconate 5-dehydrogenase; Provisional 87.27
PRK11728393 hydroxyglutarate oxidase; Provisional 87.2
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 87.15
PTZ00367 567 squalene epoxidase; Provisional 87.01
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 87.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 86.99
PRK08340259 glucose-1-dehydrogenase; Provisional 86.93
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 86.91
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 86.8
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 86.8
PRK11445351 putative oxidoreductase; Provisional 86.78
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 86.67
PRK06184502 hypothetical protein; Provisional 86.65
PRK13512438 coenzyme A disulfide reductase; Provisional 86.59
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 86.49
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 86.46
PRK07774250 short chain dehydrogenase; Provisional 86.45
PRK08017256 oxidoreductase; Provisional 86.45
PRK08294 634 phenol 2-monooxygenase; Provisional 86.4
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 86.35
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 86.29
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 86.11
PRK07454241 short chain dehydrogenase; Provisional 86.1
COG1233487 Phytoene dehydrogenase and related proteins [Secon 86.01
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 85.97
PRK00536262 speE spermidine synthase; Provisional 85.94
PRK05257494 malate:quinone oxidoreductase; Validated 85.91
PRK10157428 putative oxidoreductase FixC; Provisional 85.9
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 85.87
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 85.79
PRK07326237 short chain dehydrogenase; Provisional 85.78
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 85.75
PRK07208479 hypothetical protein; Provisional 85.71
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 85.68
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 85.66
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 85.66
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 85.58
PRK00676338 hemA glutamyl-tRNA reductase; Validated 85.55
PRK07233434 hypothetical protein; Provisional 85.55
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 85.47
PRK07102243 short chain dehydrogenase; Provisional 85.44
PLN02214342 cinnamoyl-CoA reductase 85.4
PRK12939250 short chain dehydrogenase; Provisional 85.39
COG2907447 Predicted NAD/FAD-binding protein [General functio 85.37
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 85.32
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 85.28
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.25
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 85.23
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.15
PRK05562223 precorrin-2 dehydrogenase; Provisional 85.12
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.09
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.06
PRK07023243 short chain dehydrogenase; Provisional 84.96
PRK05993277 short chain dehydrogenase; Provisional 84.96
PRK08267260 short chain dehydrogenase; Provisional 84.94
PRK11908347 NAD-dependent epimerase/dehydratase family protein 84.89
PRK06567 1028 putative bifunctional glutamate synthase subunit b 84.85
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.85
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 84.84
PLN02487569 zeta-carotene desaturase 84.82
PRK14852 989 hypothetical protein; Provisional 84.77
PLN02695370 GDP-D-mannose-3',5'-epimerase 84.74
PRK05866293 short chain dehydrogenase; Provisional 84.67
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 84.61
PRK07845466 flavoprotein disulfide reductase; Reviewed 84.51
PRK07190487 hypothetical protein; Provisional 84.31
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 84.27
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.19
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 83.97
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 83.94
PRK08703239 short chain dehydrogenase; Provisional 83.9
PRK08265261 short chain dehydrogenase; Provisional 83.83
PRK06194287 hypothetical protein; Provisional 83.82
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.75
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 83.74
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.4e-70  Score=544.14  Aligned_cols=322  Identities=26%  Similarity=0.414  Sum_probs=294.4

Q ss_pred             CceEEEECccHHHHHHHHHHHHhcCCCCCCeeEEEEecCchhhhhhhhhhHHHHHhhhhhhHHhhhhcccccchhhhhcc
Q 012547           43 PLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLG  122 (461)
Q Consensus        43 ~mkI~IIGaGamG~alA~~La~~~G~~~~~~~V~l~~r~~~~~~~~~~~~l~~~i~~~~~~~~~~~~n~~~l~~~~~~l~  122 (461)
                      +|||+|||+|+||+++|..|+++ |     |+|++|.|+++.+++++         ..+       +|++|+|++.    
T Consensus         1 ~~kI~ViGaGswGTALA~~la~n-g-----~~V~lw~r~~~~~~~i~---------~~~-------~N~~yLp~i~----   54 (329)
T COG0240           1 MMKIAVIGAGSWGTALAKVLARN-G-----HEVRLWGRDEEIVAEIN---------ETR-------ENPKYLPGIL----   54 (329)
T ss_pred             CceEEEEcCChHHHHHHHHHHhc-C-----CeeEEEecCHHHHHHHH---------hcC-------cCccccCCcc----
Confidence            47999999999999999999999 8     99999999998877643         222       5889998762    


Q ss_pred             CCccchhhhhhhcccccCCCCCCCCeEEecCHHHHhcCCCEEEEcCCchhHHHHHHHHHHHhhccCCCCEEEEEeecCcc
Q 012547          123 DRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEA  202 (461)
Q Consensus       123 ~~~l~~~~~~~~~~~~~~~~~~~~~i~~t~dl~~av~~aDiIIiaVps~~~~~vl~~i~~~l~~~~~~~iIIs~tkGi~~  202 (461)
                         +|                  .++.+++|+++++++||+|+++||+++++++++++.+++.+   ++++|+++||+++
T Consensus        55 ---lp------------------~~l~at~Dl~~a~~~ad~iv~avPs~~~r~v~~~l~~~l~~---~~~iv~~sKGie~  110 (329)
T COG0240          55 ---LP------------------PNLKATTDLAEALDGADIIVIAVPSQALREVLRQLKPLLLK---DAIIVSATKGLEP  110 (329)
T ss_pred             ---CC------------------cccccccCHHHHHhcCCEEEEECChHHHHHHHHHHhhhccC---CCeEEEEeccccC
Confidence               32                  26889999999999999999999999999999999988876   7899999999999


Q ss_pred             ccccccccCCHHHHHHhHhCCCCCcEEEEeCcchhHhhhccCceEEEE-eCChhHHHHHHHHhcCCCceEEecCChHHHH
Q 012547          203 ELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI-CGAEKWRKPLAKFLRRPHFTVWDNGDLVTHE  281 (461)
Q Consensus       203 ~~~~~~~~~~~se~i~~~lg~~~~~v~vlsGPn~a~ev~~g~~~~~~~-~~~~~~~~~l~~ll~~~g~~v~~s~Di~gve  281 (461)
                      +     +..++|+++++.++.  .++++++|||||.|++++.|+.+++ +.+.+.++.++++|++++|++|.++|++|+|
T Consensus       111 ~-----t~~l~seii~e~l~~--~~~~vLSGPs~A~EVa~g~pta~~vas~d~~~a~~v~~~f~~~~Frvy~~~Dv~Gve  183 (329)
T COG0240         111 E-----TGRLLSEIIEEELPD--NPIAVLSGPSFAKEVAQGLPTAVVVASNDQEAAEKVQALFSSPYFRVYTSTDVIGVE  183 (329)
T ss_pred             C-----CcchHHHHHHHHcCC--CeEEEEECccHHHHHhcCCCcEEEEecCCHHHHHHHHHHhCCCcEEEEecCchhhhH
Confidence            8     689999999999974  3589999999999999999998876 5678889999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhccC---ccchHHHHHHHHHHHHHHHHHHhCCCchhhccC-hhhhhhhhcc--ccchhHHHHHHhc
Q 012547          282 VMGGLKNVYAIGAALTNE---SATSKSVYFAHCTSEMVFITHLLAEEPEKLAGP-LLADTYVTLL--KGRNAWYGQELAK  355 (461)
Q Consensus       282 ~~galKNv~Ai~~Gi~~g---~~n~~a~l~~~~~~Em~~l~~a~G~~~~t~~g~-glgDl~~T~~--~sRN~~~G~~l~~  355 (461)
                      ++|++||||||++|+++|   ++|+++++++++++||.+|+.++|++++||+++ |+|||++||+  +||||+||..|++
T Consensus       184 igGAlKNViAIA~Gi~dGlg~G~NakaalitrGL~Em~rlg~~lG~~~~T~~gLsGlGDLilTCts~~SRN~r~G~~lg~  263 (329)
T COG0240         184 IGGALKNVIAIAAGIADGLGLGDNAKAALITRGLAEMTRLGVALGAKPETFMGLSGLGDLILTCTSPLSRNRRFGLLLGQ  263 (329)
T ss_pred             HHHHHHHHHHHHHHHHHHhhcChhHHHHHHHhHHHHHHHHHHHhCCCcchhcccccccceeEecCCCccccHHHHHHHhC
Confidence            999999999999999997   799999999999999999999999999999998 9999999996  6999999999999


Q ss_pred             CCChhhHhhhhcCCCccchHHHHHHHHHHHHHcCCCCCCCCCCCCCCcccCCcHHHHHHHHHhcCCCHHHHHHHHHhccc
Q 012547          356 GRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDET  435 (461)
Q Consensus       356 g~~~~~~~~~~~~~~~vEG~~~~~~v~~l~~~~~l~~~~~~~~~~~~~v~~~Pi~~~ly~il~~~~~~~~~~~~~l~~~~  435 (461)
                      |++.++++..+  ++++||+.|++.++++++++|+              + +||+++||+||+++++|.+++..+|.|+.
T Consensus       264 g~~~~e~l~~~--g~vvEGv~t~k~v~~la~~~~i--------------~-mPI~~~Vy~vl~~~~~~~~~~~~L~~r~~  326 (329)
T COG0240         264 GLSLDEALEEI--GQVVEGVRTAKAVYELAKKLGI--------------E-MPITEAVYRVLYEGLDPKEAIEELMGRDL  326 (329)
T ss_pred             CCCHHHHHHhc--CCeeecHHHHHHHHHHHHHcCC--------------C-CCHHHHHHHHHhCCCCHHHHHHHHhcccc
Confidence            99887665433  5689999999999999999995              7 89999999999999999999999999999


Q ss_pred             CCC
Q 012547          436 MND  438 (461)
Q Consensus       436 ~~~  438 (461)
                      |.|
T Consensus       327 k~E  329 (329)
T COG0240         327 KPE  329 (329)
T ss_pred             CCC
Confidence            876

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF07479 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; InterPro: IPR006109 NAD-dependent glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF08484 Methyltransf_14: C-methyltransferase C-terminal domain; InterPro: IPR013691 This domain is found in bacterial C-methyltransferase proteins, often together with other methyltransferase domains such as IPR013216 from INTERPRO or IPR013217 from INTERPRO Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
1wpq_A349 Ternary Complex Of Glycerol 3-Phosphate Dehydrogena 7e-11
1x0x_A354 Co-Structure Of Homo Sapiens Glycerol-3-Phosphate D 2e-10
2pla_A349 Crystal Structure Of Human Glycerol-3-Phosphate Deh 9e-10
1x0v_A354 Crystal Structure Of Homo Sapien Glycerol-3-Phospha 2e-09
1txg_A335 Structure Of Glycerol-3-Phosphate Dehydrogenase Fro 2e-05
4fgw_A391 Structure Of Glycerol-3-phosphate Dehydrogenase, Gp 2e-05
1z82_A335 Crystal Structure Of Glycerol-3-Phosphate Dehydroge 3e-04
1evy_A366 Crystal Structure Of Leishmania Mexicana Glycerol-3 3e-04
3k96_A356 2.1 Angstrom Resolution Crystal Structure Of Glycer 3e-04
>pdb|1WPQ|A Chain A, Ternary Complex Of Glycerol 3-Phosphate Dehydrogenase 1 With Nad And Dihydroxyactone Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 123/292 (42%), Gaps = 32/292 (10%)
Query: 151 VTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRI 210
           V ++ +A  DADI+I  +P     ++ +++  + K     P  ISL KGV+     +  I
Sbjct: 76  VPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKAN---PTGISLIKGVDEGPNGLKLI 132
Query: 211 ITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI-CGAEKWRKPLAKFLRRPHF 269
              +++I    G+P+  ++   G NIASE+ ++++    I C      + L + ++ P+F
Sbjct: 133 ---SEVIGERLGIPMSVLM---GANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNF 186
Query: 270 TVWDNGDLVTHEVMGGLKNVYAIGAALTNE---SATSKSVYFAHCTSEMVFITHLLAEEP 326
            +    ++ T E+ G LKNV A+GA   +       +K+        EM+    L    P
Sbjct: 187 RITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGP 246
Query: 327 EKLAGPL----LADTYVTLLKGRNAWYGQELAK-GRLTLDLGDSIKGKGMIQGISAVKAF 381
              A  L    +AD   T   GRN    +  A+ G+    L   +     +QG    +  
Sbjct: 247 VSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETAREL 306
Query: 382 YELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRD 433
           Y +L    L             V+  P+   +YK+      P+   +  L++
Sbjct: 307 YSILQHKGL-------------VDKFPLFMAVYKVC-YEGQPVGEFIHCLQN 344
>pdb|1X0X|A Chain A, Co-Structure Of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1 Complex With Nad Length = 354 Back     alignment and structure
>pdb|2PLA|A Chain A, Crystal Structure Of Human Glycerol-3-Phosphate Dehydrogenase 1-Like Protein Length = 349 Back     alignment and structure
>pdb|1X0V|A Chain A, Crystal Structure Of Homo Sapien Glycerol-3-Phosphate Dehydrogenase 1 Length = 354 Back     alignment and structure
>pdb|1TXG|A Chain A, Structure Of Glycerol-3-Phosphate Dehydrogenase From Archaeoglobus Fulgidus Length = 335 Back     alignment and structure
>pdb|4FGW|A Chain A, Structure Of Glycerol-3-phosphate Dehydrogenase, Gpd1, From Sacharomyces Cerevisiae Length = 391 Back     alignment and structure
>pdb|1Z82|A Chain A, Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase (Tm0378) From Thermotoga Maritima At 2.00 A Resolution Length = 335 Back     alignment and structure
>pdb|1EVY|A Chain A, Crystal Structure Of Leishmania Mexicana Glycerol-3-phosphate Dehydrogenase Length = 366 Back     alignment and structure
>pdb|3K96|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase (Gpsa) From Coxiella Burnetii Length = 356 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 4e-30
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 6e-28
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 2e-23
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 3e-16
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 6e-15
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 3e-06
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 5e-06
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 3e-04
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Length = 375 Back     alignment and structure
 Score =  119 bits (300), Expect = 4e-30
 Identities = 80/422 (18%), Positives = 143/422 (33%), Gaps = 93/422 (22%)

Query: 33  RRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQD---SYGYLRDKVLIRIW-RRPGRSVDRA 88
           R L  K +  PL+I  +G+G W S  + ++     +     ++V  R+W R         
Sbjct: 11  RNLFDKLKDGPLKISILGSGNWASAISKVVGTNAKNNYLFENEV--RMWIRDE-----FV 63

Query: 89  TAEHLFEVINS-REDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCP 147
             E + ++IN+  E+            KY    L    L  +                  
Sbjct: 64  NGERMVDIINNKHENT-----------KY----LKGVPLPHN------------------ 90

Query: 148 LKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERIT-VPVIISLAKGVEAELEA 206
           +   ++L   + DAD++I  +P    + V   I      +I      ISL KG   +   
Sbjct: 91  IVAHSDLASVINDADLLIFIVPCQYLESVLASIKESESIKIASHAKAISLTKGFIVKKNQ 150

Query: 207 VPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI-CGAEKWRKPLAKFLR 265
           +      +  I+    +P      L G NIA ++  + ++ A I    +       +   
Sbjct: 151 MKLC---SNYISDFLNIP---CSALSGANIAMDVAMENFSEATIGGNDKDSLVIWQRVFD 204

Query: 266 RPHFTVWDNGDLVTHEVMGGLKNVYAIGAALT-------NESATSKSVYFAHCT---SEM 315
            P+F +    + +  E+ G LKN+  +            N  +       A      +EM
Sbjct: 205 LPYFKINCVNETIEVEICGALKNIITLACGFCDGLNLPTNSKS-------AIIRNGINEM 257

Query: 316 V-FITHLLAEEPEK----LAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIK--G 368
           + F      +  E       G   AD   + L GRNA    E  K        +      
Sbjct: 258 ILFGKVFFQKFNENILLESCG--FADIITSFLAGRNAKCSAEFIKSTPKKTWEELENEIL 315

Query: 369 KGM-IQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAI 427
           KG  +QG   +K  Y ++ + +++                P+  +L+KI    E P   +
Sbjct: 316 KGQKLQGTVTLKYVYHMIKEKNMT-------------NEFPLFTVLHKISFENEDPSSLL 362

Query: 428 LE 429
             
Sbjct: 363 KT 364
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Length = 354 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Length = 335 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Length = 356 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Length = 366 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Length = 335 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Length = 359 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Length = 404 Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Length = 358 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 100.0
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 100.0
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 100.0
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 100.0
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 100.0
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 100.0
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 100.0
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.97
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.97
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.97
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.96
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.95
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.95
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.92
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.92
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.91
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.9
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.9
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.89
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.87
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.84
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.81
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.81
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.79
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.79
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.79
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.78
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.78
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.78
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.78
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.78
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.77
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.76
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.76
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.76
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.76
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.75
4ezb_A317 Uncharacterized conserved protein; structural geno 99.75
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.75
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.74
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.74
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.73
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.73
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.73
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.72
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 99.71
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.71
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.7
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.69
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.69
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.69
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.68
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.67
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.67
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.67
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.66
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.65
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.65
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.65
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.63
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.63
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.6
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.6
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.58
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.58
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.53
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.52
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.52
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.46
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.45
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.43
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.42
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.42
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.41
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.39
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.39
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.02
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.33
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.29
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.27
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.24
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.22
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.21
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.2
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.19
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.19
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.11
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.1
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.95
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.95
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.93
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.88
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.85
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.79
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.78
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.72
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 98.69
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.67
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.67
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.58
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 98.51
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.48
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.47
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.44
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.43
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.39
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.38
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.38
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.37
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.36
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 98.36
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.36
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 98.35
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.35
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.33
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.3
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.29
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.26
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.26
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.24
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.23
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.23
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.21
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.21
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.21
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.19
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.17
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.17
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.16
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.15
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.13
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.12
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.08
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.07
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.07
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.06
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.05
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.05
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.03
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.02
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.01
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.99
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.98
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.97
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.97
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.95
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.95
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.95
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.94
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.94
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.92
2duw_A145 Putative COA-binding protein; ligand binding prote 97.92
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.92
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.92
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.92
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.9
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.9
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.89
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.89
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.87
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.86
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.85
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.85
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.84
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.82
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.82
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.81
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.81
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.8
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.79
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.78
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.78
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.78
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.77
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.77
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.75
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.75
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.74
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.74
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.74
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.7
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.7
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.7
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.7
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.68
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.68
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.67
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.66
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.66
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.66
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.64
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.64
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.64
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.63
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.63
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.62
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.61
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.6
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.6
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.6
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.59
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 97.57
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.56
1ydw_A362 AX110P-like protein; structural genomics, protein 97.56
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.54
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.54
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.53
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.53
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.51
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.48
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.47
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.44
4had_A350 Probable oxidoreductase protein; structural genomi 97.43
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.41
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.36
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.34
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.33
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.32
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.31
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.3
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 97.3
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.29
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.29
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.27
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 97.27
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.26
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.22
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.22
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.21
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.21
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.2
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.18
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.18
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.17
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.14
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 97.14
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.1
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.1
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.09
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.08
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.07
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 97.06
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.04
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.97
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.97
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.97
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.96
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.95
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.95
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.95
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.93
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.89
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.89
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.86
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.86
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.85
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 96.85
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.82
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 96.82
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 96.79
3btv_A438 Galactose/lactose metabolism regulatory protein GA 96.75
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.68
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 96.67
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.67
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.66
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.66
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.65
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.64
3oqb_A383 Oxidoreductase; structural genomics, protein struc 96.64
4h3v_A390 Oxidoreductase domain protein; structural genomics 96.63
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.63
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.62
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.6
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.6
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.58
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.57
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.54
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.52
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.51
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 96.39
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.39
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 96.37
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.36
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.32
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 96.32
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.3
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.28
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.23
3h2z_A382 Mannitol-1-phosphate 5-dehydrogenase; PSI- protein 96.22
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.21
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.18
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.13
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 96.05
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.04
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.03
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 95.99
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.97
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.97
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.88
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.81
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 95.8
4hb9_A412 Similarities with probable monooxygenase; flavin, 95.77
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.76
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 95.75
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.74
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.73
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.71
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 95.67
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.61
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.54
1lnq_A336 MTHK channels, potassium channel related protein; 95.52
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.52
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.47
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 95.46
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 95.43
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.42
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 95.38
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 95.36
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 95.26
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.25
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.11
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.07
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.91
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 94.9
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 94.75
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 94.65
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 94.64
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 94.6
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 94.58
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.58
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.58
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.58
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 94.57
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.5
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.39
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.38
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 94.34
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 94.34
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 94.3
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.29
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.24
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 94.21
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.18
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 94.18
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.12
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 94.1
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 94.05
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 94.04
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 94.04
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.01
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 93.96
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 93.95
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.86
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 93.84
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.78
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 93.74
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 93.64
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.62
2ywl_A180 Thioredoxin reductase related protein; uncharacter 93.61
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 93.46
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 93.46
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 93.46
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 93.42
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 93.39
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 93.37
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.33
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.29
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.29
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 93.24
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 93.22
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 93.18
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 93.11
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 93.1
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 93.09
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 93.01
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 92.99
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 92.96
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 92.86
3p2o_A285 Bifunctional protein fold; structural genomics, ce 92.83
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 92.82
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 92.81
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 92.79
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.72
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 92.68
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 92.65
3l07_A285 Bifunctional protein fold; structural genomics, ID 92.59
2csu_A457 457AA long hypothetical protein; structural genomi 92.58
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 92.58
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 92.56
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 92.54
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 92.47
3dme_A369 Conserved exported protein; structural genomics, P 92.46
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 92.43
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 92.4
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 92.31
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.29
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 92.28
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 92.23
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 92.22
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 92.12
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 92.03
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 92.03
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 91.97
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 91.92
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 91.91
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 91.9
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 91.86
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 91.86
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 91.83
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 91.82
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 91.74
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 91.72
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 91.72
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 91.67
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 91.64
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 91.62
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 91.61
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 91.59
2wm3_A299 NMRA-like family domain containing protein 1; unkn 91.51
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 91.5
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 91.46
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 91.35
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 91.33
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 91.31
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 91.3
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 91.28
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 91.28
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 91.18
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 91.11
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 91.09
3r9u_A315 Thioredoxin reductase; structural genomics, center 91.07
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 91.06
2bry_A497 NEDD9 interacting protein with calponin homology a 91.05
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 91.04
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 91.01
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 90.94
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 90.82
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 90.79
3rih_A293 Short chain dehydrogenase or reductase; structural 90.74
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 90.66
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 90.63
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 90.4
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 90.36
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 90.33
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 90.3
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 90.3
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 90.29
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 90.28
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 90.26
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 90.18
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 90.14
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 90.09
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 90.07
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 90.05
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 90.01
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 89.89
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 89.78
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 89.78
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 89.74
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 89.66
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 89.64
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 89.45
4gx0_A565 TRKA domain protein; membrane protein, ION channel 89.45
4eso_A255 Putative oxidoreductase; NADP, structural genomics 89.4
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 89.39
1xq6_A253 Unknown protein; structural genomics, protein stru 89.39
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 89.36
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 89.33
1xhl_A297 Short-chain dehydrogenase/reductase family member 89.31
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 89.21
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 89.21
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 89.19
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 89.17
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 89.16
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 89.12
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 88.94
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 88.91
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 88.91
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 88.84
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 88.69
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 88.61
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 88.49
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 88.49
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 88.39
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 88.37
2cul_A232 Glucose-inhibited division protein A-related PROT 88.28
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 88.27
3tjr_A301 Short chain dehydrogenase; structural genomics, se 88.22
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 88.15
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 88.11
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 88.09
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 88.08
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 87.89
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 87.85
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 87.82
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 87.8
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 87.78
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 87.71
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 87.66
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.9e-65  Score=525.89  Aligned_cols=334  Identities=20%  Similarity=0.300  Sum_probs=281.2

Q ss_pred             CCCCceEEEECccHHHHHHHHHHHHhcCC---CCCCeeEEEEecCchhhhhhhhhhHHHHHhhhhhhHHhhhhcccccch
Q 012547           40 EGDPLRIVGVGAGAWGSVFTAMLQDSYGY---LRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKY  116 (461)
Q Consensus        40 ~~~~mkI~IIGaGamG~alA~~La~~~G~---~~~~~~V~l~~r~~~~~~~~~~~~l~~~i~~~~~~~~~~~~n~~~l~~  116 (461)
                      ..++.||+|||+|+||+|+|..|+++ |.   ....++|++|.|+++...    +.+.+.|+..+       +|++|||+
T Consensus        31 ~~~p~KI~ViGaGsWGTALA~~la~n-g~~~~~~~~~~V~lw~r~~e~~~----~~~~e~in~~~-------~N~~YLpg   98 (391)
T 4fgw_A           31 AEKPFKVTVIGSGNWGTTIAKVVAEN-CKGYPEVFAPIVQMWVFEEEING----EKLTEIINTRH-------QNVKYLPG   98 (391)
T ss_dssp             --CCEEEEEECCSHHHHHHHHHHHHH-HHHCTTTEEEEEEEECCCCBSSS----CBHHHHHTTTC-------CBTTTBTT
T ss_pred             cCCCCeEEEECcCHHHHHHHHHHHHc-CCCccccCCceEEEEEcchHhhh----HHHHHHHHhcC-------cCcccCCC
Confidence            33567999999999999999999998 60   000025999999986432    23445566655       59999987


Q ss_pred             hhhhccCCccchhhhhhhcccccCCCCCCCCeEEecCHHHHhcCCCEEEEcCCchhHHHHHHHHHHHhhccCCCCEEEEE
Q 012547          117 VEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISL  196 (461)
Q Consensus       117 ~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~i~~t~dl~~av~~aDiIIiaVps~~~~~vl~~i~~~l~~~~~~~iIIs~  196 (461)
                      ++       ||                  .++.+++|+++++++||+||++||+++++++++++.+++++   ++++|++
T Consensus        99 v~-------Lp------------------~~i~~t~dl~~al~~ad~ii~avPs~~~r~~l~~l~~~~~~---~~~iv~~  150 (391)
T 4fgw_A           99 IT-------LP------------------DNLVANPDLIDSVKDVDIIVFNIPHQFLPRICSQLKGHVDS---HVRAISC  150 (391)
T ss_dssp             CC-------CC------------------SSEEEESCHHHHHTTCSEEEECSCGGGHHHHHHHHTTTSCT---TCEEEEC
T ss_pred             Cc-------CC------------------CCcEEeCCHHHHHhcCCEEEEECChhhhHHHHHHhccccCC---CceeEEe
Confidence            62       32                  26899999999999999999999999999999999999887   7899999


Q ss_pred             eecCccccccccccCCHHHHHHhHhCCCCCcEEEEeCcchhHhhhccCceEEEEe-CCh---------hHHHHHHHHhcC
Q 012547          197 AKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARIC-GAE---------KWRKPLAKFLRR  266 (461)
Q Consensus       197 tkGi~~~~~~~~~~~~~se~i~~~lg~~~~~v~vlsGPn~a~ev~~g~~~~~~~~-~~~---------~~~~~l~~ll~~  266 (461)
                      +||++..+   +..+++++++.+.++   .++++++|||||.|++.+.|+.++++ .+.         ...+.++++|++
T Consensus       151 ~KGie~~~---~~~~~~se~i~e~~~---~~~~vLsGPs~A~EVa~~~pta~~iA~~~~~~~~~~~~~~~a~~~~~lf~~  224 (391)
T 4fgw_A          151 LKGFEVGA---KGVQLLSSYITEELG---IQCGALSGANIATEVAQEHWSETTVAYHIPKDFRGEGKDVDHKVLKALFHR  224 (391)
T ss_dssp             CCSCEEET---TEEECHHHHHHHHHC---CEEEEEECSCCHHHHHTTCCEEEEEECCCCTTCCCSSSSCCHHHHHHHHCB
T ss_pred             cccccccc---ccchhHHHHHHHHhC---ccceeccCCchHHHhhcCCCceEEEEecChhhhhhhhHHHHHHHHHHHhCC
Confidence            99998753   134789999999887   35789999999999999999987753 322         236889999999


Q ss_pred             CCceEEecCChHHHHHHHHHHHHHHHHHhhccC---ccchHHHHHHHHHHHHHHHHHHh---CCCchhhccC-hhhhhhh
Q 012547          267 PHFTVWDNGDLVTHEVMGGLKNVYAIGAALTNE---SATSKSVYFAHCTSEMVFITHLL---AEEPEKLAGP-LLADTYV  339 (461)
Q Consensus       267 ~g~~v~~s~Di~gve~~galKNv~Ai~~Gi~~g---~~n~~a~l~~~~~~Em~~l~~a~---G~~~~t~~g~-glgDl~~  339 (461)
                      ++|++|.++|++|+|+||++||||||++|+++|   |+|++|++++++++||.+|+.++   |.++.||.++ |+|||++
T Consensus       225 ~~frvy~s~DviGvElgGAlKNViAIAaGi~dGlg~G~NakAALitrGl~Em~rlg~al~~~g~~~tt~~glaGlGDLi~  304 (391)
T 4fgw_A          225 PYFHVSVIEDVAGISICGALKNVVALGCGFVEGLGWGNNASAAIQRVGLGEIIRFGQMFFPESREETYYQESAGVADLIT  304 (391)
T ss_dssp             TTEEEEEESCHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHSTTCCHHHHHHSTTTHHHHHH
T ss_pred             CCEEEEEeCCccceehHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHHhcccCCceeecCCCcccceeE
Confidence            999999999999999999999999999999997   69999999999999999999999   4455567787 9999999


Q ss_pred             hccccchhHHHHHHhc-CCChhhHhhhhcCCCccchHHHHHHHHHHHHHcCCCCCCCCCCCCCCcccCCcHHHHHHHHHh
Q 012547          340 TLLKGRNAWYGQELAK-GRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILI  418 (461)
Q Consensus       340 T~~~sRN~~~G~~l~~-g~~~~~~~~~~~~~~~vEG~~~~~~v~~l~~~~~l~~~~~~~~~~~~~v~~~Pi~~~ly~il~  418 (461)
                      ||+.||||+||..|++ |++.+++++.+.+++++||+.|+++++++++++|+.            .+ |||+++||+||+
T Consensus       305 Tc~sSRNr~~G~~lg~~G~~~~~~~~~~~~g~v~EGv~ta~~v~~l~~~~~v~------------~e-mPI~~~vy~IL~  371 (391)
T 4fgw_A          305 TCAGGRNVKVARLMATSGKDAWECEKELLNGQSAQGLITCKEVHEWLETCGSV------------ED-FPLFEAVYQIVY  371 (391)
T ss_dssp             HHHSSHHHHHHHHHHHTCCCHHHHHHHHHTTCCCTHHHHHHHHHHHHHHHTCS------------TT-CHHHHHHHHHHH
T ss_pred             EecCCccHHHHHHHHhcCCCHHHHHHHHhCCCEEehHHHHHHHHHHHHHcCCC------------CC-CCHHHHHHHHHh
Confidence            9988999999999996 899888887776667899999999999999999962            25 899999999999


Q ss_pred             cCCCHHHHHHHHHhc
Q 012547          419 MRESPIQAILEALRD  433 (461)
Q Consensus       419 ~~~~~~~~~~~~l~~  433 (461)
                      ++.+|.+ +.++|++
T Consensus       372 ~~~~~~~-~~~~l~~  385 (391)
T 4fgw_A          372 NNYPMKN-LPDMIEE  385 (391)
T ss_dssp             SCCCSTT-HHHHHCC
T ss_pred             CCCCHHH-HHHHHHh
Confidence            9997655 4455543
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI- protein structure initiative, structural genomics, midwest for structural genomics (MCSG); 1.90A {Shigella flexneri 2a str} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d1txga1155 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydro 4e-12
d1n1ea1160 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydro 6e-10
d1n1ea2189 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogen 3e-06
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 2e-04
d1txga2180 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogen 0.003
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 155 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Glycerol-3-phosphate dehydrogenase
domain: Glycerol-3-phosphate dehydrogenase
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 61.6 bits (149), Expect = 4e-12
 Identities = 36/165 (21%), Positives = 63/165 (38%), Gaps = 26/165 (15%)

Query: 276 DLVTHEVMGGLKNVYAIGAAL--------TNESATSKSVYFAHCTSEMVFITHLLAEEPE 327
           D++  E+   LKNVY+I  A           E + +K V      +EM  +  +L  + E
Sbjct: 1   DIIGTEITSALKNVYSIAIAWIRGYESRKNVEMSNAKGVIATRAINEMAELIEILGGDRE 60

Query: 328 KLAGPL-LADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIK--GKGMIQGISAVKAFYEL 384
              G     D   T   GRN   G+ L KG    +  + ++  G G+++G    +  Y L
Sbjct: 61  TAFGLSGFGDLIATFRGGRNGMLGELLGKGLSIDEAMEELERRGVGVVEGYKTAEKAYRL 120

Query: 385 LSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILE 429
            S+ +                   +L  +Y++L       + + E
Sbjct: 121 SSKINADT---------------KLLDSIYRVLYEGLKVEEVLFE 150
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 160 Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 189 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d1n1ea1160 Glycerol-3-phosphate dehydrogenase {Trypanosome (L 100.0
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 100.0
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.97
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.95
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.72
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.7
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.64
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.64
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.54
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 99.46
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.44
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.39
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.36
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.29
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.29
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.19
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.16
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.16
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.15
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.14
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.09
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.98
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.69
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.61
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.61
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.57
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.56
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.54
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 98.47
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.46
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.43
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.38
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.37
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.34
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.33
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.27
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.21
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.21
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 98.07
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.05
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.04
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.02
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.0
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.94
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.93
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.9
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.89
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.87
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.79
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.74
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.72
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 97.68
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.65
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.62
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.59
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.57
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.54
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.48
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.46
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.4
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.36
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.35
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.34
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.32
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.3
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.28
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.22
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.21
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.15
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.14
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.13
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.1
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.01
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.86
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.77
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.69
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.67
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.62
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.6
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.58
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.55
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.51
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.45
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.41
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.41
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 96.28
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 96.25
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.23
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.14
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.07
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.04
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.0
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.97
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.96
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.85
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.84
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.81
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.8
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.74
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 95.73
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.71
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.69
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.6
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.51
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.43
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.43
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.38
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.36
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.35
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.35
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.33
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.3
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.27
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.17
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.11
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 95.1
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.09
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.08
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.04
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.98
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.94
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.91
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.86
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.82
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.74
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.74
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.67
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.67
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.51
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.49
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.49
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.31
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.28
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 94.15
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.02
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.81
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.74
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.66
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.51
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.46
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.38
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.38
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 93.27
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.23
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.22
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.14
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.76
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 92.74
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 92.54
d1yova1529 Amyloid beta precursor protein-binding protein 1, 92.36
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.33
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.3
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 92.2
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.12
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.87
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.59
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.58
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 91.53
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 91.5
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 91.44
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 91.27
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 91.18
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.02
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.82
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.78
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.76
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 90.68
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 90.38
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.23
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.14
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 89.72
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.63
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 89.6
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 89.53
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.49
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.39
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.37
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 88.63
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.51
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 88.34
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 88.29
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.12
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 88.02
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.74
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 87.71
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.41
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 87.14
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 87.12
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.91
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 86.89
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 86.85
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 86.82
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 86.78
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 86.74
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.5
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 86.15
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.13
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 85.56
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 85.46
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 85.34
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 85.27
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.21
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 85.2
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 84.91
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 84.84
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 84.83
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.74
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.74
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 84.62
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.55
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 84.45
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 84.33
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 84.31
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 84.3
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 84.3
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 84.19
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 84.17
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 83.9
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 83.87
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 83.72
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.55
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 83.49
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 83.33
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.28
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.27
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 83.2
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.95
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 82.76
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 82.72
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 82.7
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 82.31
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 82.16
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 82.16
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 82.11
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 82.1
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 81.96
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 81.91
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 81.81
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 81.79
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 81.78
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.74
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 81.73
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 81.66
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 81.6
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 81.59
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 81.54
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 81.52
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 81.1
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 80.96
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 80.73
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 80.62
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 80.33
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 80.28
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.25
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 80.12
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 80.09
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 80.06
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Glycerol-3-phosphate dehydrogenase
domain: Glycerol-3-phosphate dehydrogenase
species: Trypanosome (Leishmania mexicana) [TaxId: 5665]

Probab=100.00  E-value=4.2e-34  Score=259.09  Aligned_cols=149  Identities=23%  Similarity=0.323  Sum_probs=138.8

Q ss_pred             CChHHHHHHHHHHHHHHHHHhhccC---ccchHHHHHHHHHHHHHHHHHHhCCCchhhccC-hhhhhhhhcc--ccchhH
Q 012547          275 GDLVTHEVMGGLKNVYAIGAALTNE---SATSKSVYFAHCTSEMVFITHLLAEEPEKLAGP-LLADTYVTLL--KGRNAW  348 (461)
Q Consensus       275 ~Di~gve~~galKNv~Ai~~Gi~~g---~~n~~a~l~~~~~~Em~~l~~a~G~~~~t~~g~-glgDl~~T~~--~sRN~~  348 (461)
                      +|++|+|+||++||+|||++|++++   ++|+++++++++++||.+|++++|++++|++++ |+||+++||+  .||||+
T Consensus         1 tD~~GvE~~galKNi~Aia~Gi~~gl~~g~N~~aali~~g~~Em~~~~~~~g~~~~t~~~laGlGDli~Tc~s~~sRN~~   80 (160)
T d1n1ea1           1 TDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFT   80 (160)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTTCCSTTTTSTTTHHHHHHHTTCTTSHHHH
T ss_pred             CCchhHHHHHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHHHHHHHHHhCCCccceeccccchhheeeeecchhHHHH
Confidence            5999999999999999999999986   699999999999999999999999999999997 9999999995  799999


Q ss_pred             HHHHHhcCCChhhHhhhhcCCCccchHHHHHHHHHHHHHcCCCCCCCCCCCCCCcccCCcHHHHHHHHHhcCCCHHHHHH
Q 012547          349 YGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAIL  428 (461)
Q Consensus       349 ~G~~l~~g~~~~~~~~~~~~~~~vEG~~~~~~v~~l~~~~~l~~~~~~~~~~~~~v~~~Pi~~~ly~il~~~~~~~~~~~  428 (461)
                      +|+.+++|.+.+++++.  .++++||+.|++.++++++++++              + +||+++||+||+++.+|.+++.
T Consensus        81 ~G~~l~~g~~~~e~~~~--~~~~vEG~~t~~~v~~l~~~~~i--------------~-~Pi~~~vy~Il~~~~~p~~~i~  143 (160)
T d1n1ea1          81 VGKKLGKGLPIEEIQRT--SKAVAEGVATADPLMRLAKQLKV--------------K-MPLCHQIYEIVYKKKNPRDALA  143 (160)
T ss_dssp             HHHHHHHTCCHHHHHHS--CCSCCHHHHHHHHHHHHHHHHTC--------------C-CHHHHHHHHHHHSCCCHHHHHH
T ss_pred             HHHHHhccccHHHHHHh--ccchHHHHHHHHHHHHHHHHcCC--------------C-CcHHHHHHHHHhCcCCHHHHHH
Confidence            99999999998887653  35689999999999999999995              6 8999999999999999999999


Q ss_pred             HHHhcccCCCcc
Q 012547          429 EALRDETMNDPR  440 (461)
Q Consensus       429 ~~l~~~~~~~~~  440 (461)
                      .||.|+.+.|--
T Consensus       144 ~Lm~r~~k~E~~  155 (160)
T d1n1ea1         144 DLLSCGLQDEGL  155 (160)
T ss_dssp             HHTTSCSCBCCC
T ss_pred             HHHCCCCCCCCC
Confidence            999999988753
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure