Citrus Sinensis ID: 012683


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLKENNAPKDKAPMKELPEVRPEIKKKAAEAKARGDEAFKQKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVEAGRKFHGTDKK
ccccccccHHHccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcHHHcccccc
ccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccEEcccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccc
MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELkldvdtqdedgetpllHAARQGHTETAKYLfehganptipsnlgatalhhsaGIGNIELLTYLLSkgaevdsesdagtpliwaaGHGQQEAVKVLLEhhanpnaetedniTPLLSAVAAGSLTCLDLLIQAGANanivaggatplhiaadIGSTEIIKCLLkagadpnvtdedgqkPIQVAAARGNREAVEILFpltsedpsipkwtVDGILEYmqsesgkqlEETRnlkennapkdkapmkelpevrPEIKKKAAEAKARGDEAFKQKDYLMAVDAYTqaidfdpsdatllsnRSLCWIRLGQAEHALADAKACRalrpdwpkacYREGAALRLLEKFDEAANAFYegvtldpenKELVFAFREAVEAGRKFHGTDKK
MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGAlhfaaregktDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGadpnvtdedgQKPIQVAAARGNREAVEIlfpltsedpsipKWTVDGILEYMQSESGKQleetrnlkennapkdkapmkelpevrpEIKKKAAeakargdeafkqKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVeagrkfhgtdkk
MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQagananivaggaTPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLKENNAPKDKAPMKELPEVRPEIkkkaaeakaRGDEAFKQKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVEAGRKFHGTDKK
*********AVRERVQQFLNAACTGNLDLLKKIAKQLD********TVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVD******************TETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEV*****AGTPLIWAAGHGQQEAVKVLLEHHA******EDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGA********************NREAVEILFPLTSEDPSIPKWTVDGILEY******************************************************KDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVE***********
****ASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLKENNAPKDKAPMKELPEVRPEIKKKAAEAKARGDEAFKQKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVEAG*********
MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLKENNAPKDKAPMKELPEVRPEIK**********DEAFKQKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVEAG*********
*****SHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLKENNAPKDKAPMKELPEVRPEIKKKAAEAKARGDEAFKQKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVEAGRKFH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLKENNAPKDKAPMKELPEVRPEIKKKAAEAKARGDEAFKQKDYLMAVDAYTQAIDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDEAANAFYEGVTLDPENKELVFAFREAVEAGRKFHGTDKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query458 2.2.26 [Sep-21-2011]
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.530 0.129 0.368 8e-31
Q02357 1862 Ankyrin-1 OS=Mus musculus yes no 0.530 0.130 0.360 2e-29
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.510 0.237 0.330 6e-26
Q4UMH6 1179 Putative ankyrin repeat p yes no 0.524 0.203 0.314 8e-26
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.515 0.120 0.340 1e-24
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.515 0.053 0.336 4e-24
Q7T163 1672 Kinase D-interacting subs no no 0.489 0.133 0.337 6e-24
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.486 0.056 0.340 1e-23
Q08DV6525 Ankyrin repeat and SOCS b no no 0.528 0.460 0.348 2e-23
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.486 0.057 0.340 3e-23
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function desciption
 Score =  135 bits (339), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 138/255 (54%), Gaps = 12/255 (4%)

Query: 21  AACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELK 80
           A+  G+L ++K + +      +G S  V+++K       LH AAR G T+V KYLL+  K
Sbjct: 411 ASFMGHLPIVKNLLQ------RGASPNVSNVK---VETPLHMAARAGHTEVAKYLLQN-K 460

Query: 81  LDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLT 140
             V+ + +D +TPL  AAR GHT   K L E+ ANP + +  G T LH +A  G++E + 
Sbjct: 461 AKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVL 520

Query: 141 YLLSKGAEVDSESDAG-TPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAG 199
            LL K A     +  G TPL  AA +G+    ++LLE  A+PNA  ++ +TPL  AV   
Sbjct: 521 ALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHN 580

Query: 200 SLTCLDLLIQAGANANIVA-GGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQ 258
           +L  + LL+  G + +  A  G TPLHIAA     E+ + LL+ G   N     G  P+ 
Sbjct: 581 NLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLH 640

Query: 259 VAAARGNREAVEILF 273
           +AA  G+ E V +L 
Sbjct: 641 LAAQEGHAEMVALLL 655




Isoform Mu17 together with obscurin in skeletal muscle may provide a molecular link between the sarcoplasmic reticulum and myofibrils.
Homo sapiens (taxid: 9606)
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query458
225453006458 PREDICTED: ankyrin-1 [Vitis vinifera] gi 0.995 0.995 0.812 0.0
255580917463 ankyrin repeat-containing protein, putat 0.995 0.984 0.783 0.0
449483017458 PREDICTED: ankyrin-1-like [Cucumis sativ 0.995 0.995 0.781 0.0
356504107 678 PREDICTED: uncharacterized protein LOC10 0.991 0.669 0.763 0.0
363807266460 uncharacterized protein LOC100793914 [Gl 0.991 0.986 0.771 0.0
224125660451 predicted protein [Populus trichocarpa] 0.958 0.973 0.742 0.0
449442947454 PREDICTED: LOW QUALITY PROTEIN: ankyrin- 0.986 0.995 0.772 0.0
224130626474 predicted protein [Populus trichocarpa] 0.993 0.959 0.720 0.0
147788021433 hypothetical protein VITISV_032631 [Viti 0.941 0.995 0.753 0.0
334185083 680 ankyrin repeat family protein [Arabidops 0.978 0.658 0.715 0.0
>gi|225453006|ref|XP_002263664.1| PREDICTED: ankyrin-1 [Vitis vinifera] gi|296087918|emb|CBI35201.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/458 (81%), Positives = 409/458 (89%), Gaps = 2/458 (0%)

Query: 1   MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGAL 60
           MAPDA  ALA R +VQQFLNAACTGNLDL KK+A QLDD GKGL+ TVAD+KDANKRGAL
Sbjct: 1   MAPDAYAALATRNKVQQFLNAACTGNLDLFKKLAAQLDD-GKGLAGTVADVKDANKRGAL 59

Query: 61  HFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPS 120
           HFAAREG+T+VCKYLLEELKLDVD +DEDGETPLLHAARQGHT TAKYL +H A+P IPS
Sbjct: 60  HFAAREGRTEVCKYLLEELKLDVDAKDEDGETPLLHAARQGHTVTAKYLLDHSADPAIPS 119

Query: 121 NLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHAN 180
           +LGATALHHSAGIG+IELL +LLSKG ++DS+SDAGTPLIWAAGHGQ +AVKVLLEHHAN
Sbjct: 120 DLGATALHHSAGIGDIELLRFLLSKGVDIDSQSDAGTPLIWAAGHGQHDAVKVLLEHHAN 179

Query: 181 PNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAGGATPLHIAADIGSTEIIKCLL 240
           PNAET+DNITPLLSAVAAGSL CL+LLIQAGA  NI+AGGATPLHIAADIGS EII CLL
Sbjct: 180 PNAETDDNITPLLSAVAAGSLACLELLIQAGARVNIIAGGATPLHIAADIGSPEIINCLL 239

Query: 241 KAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGK 300
           KAGADPNVTDEDGQK IQVAAARGNR  VEILFPLTS   S+P+WT+DGI+E+MQSE GK
Sbjct: 240 KAGADPNVTDEDGQKAIQVAAARGNRGVVEILFPLTSPIQSVPEWTIDGIIEHMQSEMGK 299

Query: 301 QLEETRNLKENNAPKDKAPMKELPEVRPEIKKKAAEAKARGDEAFKQKDYLMAVDAYTQA 360
           Q +ETRN+KE N  +     +++P+V PE KKKAAEAK+RGD+AFK KDY MAVDAYTQA
Sbjct: 300 QQDETRNVKEANV-ETTLSKQDIPQVSPEAKKKAAEAKSRGDDAFKAKDYYMAVDAYTQA 358

Query: 361 IDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDE 420
           ID DP+DATLLSNRSLCWIRLGQAEHAL DAKACRALRPDW KACYREGAALRLL KFDE
Sbjct: 359 IDVDPTDATLLSNRSLCWIRLGQAEHALDDAKACRALRPDWSKACYREGAALRLLLKFDE 418

Query: 421 AANAFYEGVTLDPENKELVFAFREAVEAGRKFHGTDKK 458
           AAN+FYEGV LDPENKELV AFREAVEAGRKFH  D++
Sbjct: 419 AANSFYEGVKLDPENKELVNAFREAVEAGRKFHARDQE 456




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255580917|ref|XP_002531277.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223529110|gb|EEF31090.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449483017|ref|XP_004156471.1| PREDICTED: ankyrin-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356504107|ref|XP_003520840.1| PREDICTED: uncharacterized protein LOC100798118 [Glycine max] Back     alignment and taxonomy information
>gi|363807266|ref|NP_001242105.1| uncharacterized protein LOC100793914 [Glycine max] gi|255635001|gb|ACU17859.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224125660|ref|XP_002319644.1| predicted protein [Populus trichocarpa] gi|222858020|gb|EEE95567.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449442947|ref|XP_004139242.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224130626|ref|XP_002328336.1| predicted protein [Populus trichocarpa] gi|222838051|gb|EEE76416.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147788021|emb|CAN69337.1| hypothetical protein VITISV_032631 [Vitis vinifera] Back     alignment and taxonomy information
>gi|334185083|ref|NP_001189808.1| ankyrin repeat family protein [Arabidopsis thaliana] gi|332640603|gb|AEE74124.1| ankyrin repeat family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query458
TAIR|locus:2084868456 TPR10 "AT3G04710" [Arabidopsis 0.978 0.982 0.680 3.4e-164
UNIPROTKB|F1SE30 1885 ANK1 "Uncharacterized protein" 0.528 0.128 0.362 2.8e-31
UNIPROTKB|P16157 1881 ANK1 "Ankyrin-1" [Homo sapiens 0.528 0.128 0.358 4.5e-31
MGI|MGI:88024 1862 Ank1 "ankyrin 1, erythroid" [M 0.528 0.129 0.354 4.9e-30
UNIPROTKB|F1PRD8 1857 ANK1 "Uncharacterized protein" 0.528 0.130 0.354 2.1e-29
UNIPROTKB|F1PRC8 1916 ANK1 "Uncharacterized protein" 0.528 0.126 0.354 2.3e-29
UNIPROTKB|F1MY81 1136 ANK1 "Uncharacterized protein" 0.528 0.213 0.358 3.7e-29
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.528 0.125 0.338 3.3e-26
ASPGD|ASPL00000628241030 AN1130 [Emericella nidulans (t 0.486 0.216 0.336 7.8e-26
ZFIN|ZDB-GENE-010501-6 1173 ehmt2 "euchromatic histone-lys 0.447 0.174 0.344 9.8e-25
TAIR|locus:2084868 TPR10 "AT3G04710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1598 (567.6 bits), Expect = 3.4e-164, P = 3.4e-164
 Identities = 309/454 (68%), Positives = 363/454 (79%)

Query:     1 MAPDASHALAVRERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGAL 60
             MAPDAS ALA RE+VQQ LNAACTGNL+ LK +AKQLD+ GK L+KTV  IKDANKRGAL
Sbjct:     1 MAPDASTALAAREKVQQILNAACTGNLEFLKNVAKQLDE-GKDLTKTVESIKDANKRGAL 59

Query:    61 HFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPS 120
             HFAAREG+T++C+YLLEELKL+ D +DE G+TPL+HAARQG  ET KYL E GA+P I S
Sbjct:    60 HFAAREGQTEICRYLLEELKLNADAKDETGDTPLVHAARQGQIETVKYLLEQGADPNIAS 119

Query:   121 NLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAGTPLIWAAGHGQQEAVKVLLEHHAN 180
              LGATALHH+AG G IELL  LLS+G  VDSES++GTPLIWAAGH Q+ AV+VLLEH+AN
Sbjct:   120 ELGATALHHAAGTGEIELLKELLSRGVPVDSESESGTPLIWAAGHDQKNAVEVLLEHNAN 179

Query:   181 PNAETEDNITPLLSAVAAGSLTCLDLLIQXXXXXXXXXXXXTPLHIAADIGSTEIIKCLL 240
             PNAETEDNITPLLSAVAAGSL+CL+LL++            TPLHIAADIG+ E+I CLL
Sbjct:   180 PNAETEDNITPLLSAVAAGSLSCLELLVKAGAKANVFAGGATPLHIAADIGNLELINCLL 239

Query:   241 KAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGK 300
             KAGADPN  DE+G +P++VAAAR NR+ VEILFPLT++  ++  WTVDGIL +M  ES K
Sbjct:   240 KAGADPNQKDEEGNRPLEVAAARDNRKVVEILFPLTTKPETVSDWTVDGILAHM--ESNK 297

Query:   301 QLEETRNLKENNAPKDKAPMKELPEVRPEIXXXXXXXXXRGDEAFKQKDYLMAVDAYTQA 360
             + EE  N  ++     K   K+LP V PE          RG +AF +KD+ MA+DAYTQA
Sbjct:   298 EQEENSNKAKSQETGIK---KDLPVVSPEAKAKAAEAKARGQDAFHRKDFQMAIDAYTQA 354

Query:   361 IDFDPSDATLLSNRSLCWIRLGQAEHALADAKACRALRPDWPKACYREGAALRLLEKFDE 420
             IDFDP+D TL SNRSLCW+RLGQAEHAL+DAKACR L PDWPK C+REGAALRLL++FDE
Sbjct:   355 IDFDPTDHTLFSNRSLCWLRLGQAEHALSDAKACRELNPDWPKGCFREGAALRLLQRFDE 414

Query:   421 AANAFYEGVTLDPENKELVFAFREAVEAGRKFHG 454
             AANAFYEGV L PE+KEL+ AFREAV+AGRKFHG
Sbjct:   415 AANAFYEGVLLSPESKELIDAFREAVDAGRKFHG 448




GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0000741 "karyogamy" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
UNIPROTKB|F1SE30 ANK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P16157 ANK1 "Ankyrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:88024 Ank1 "ankyrin 1, erythroid" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRD8 ANK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRC8 ANK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY81 ANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062824 AN1130 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010501-6 ehmt2 "euchromatic histone-lysine N-methyltransferase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-29
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-20
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-17
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-16
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-16
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-16
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-16
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 6e-15
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-13
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-13
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-13
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-12
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 3e-11
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-11
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-11
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-10
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-09
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-09
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-08
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 3e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 6e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 9e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-05
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 2e-05
smart0024830 smart00248, ANK, ankyrin repeats 2e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-05
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 3e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 6e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 7e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 3e-04
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 5e-04
PHA02791284 PHA02791, PHA02791, ankyrin-like protein; Provisio 5e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.003
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 0.003
cd00851103 cd00851, MTH1175, This uncharacterized conserved p 0.003
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.004
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  119 bits (299), Expect = 3e-32
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 1/117 (0%)

Query: 157 TPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANI 216
           TPL  AA +G  E VK+LLE+ A+ NA+  D  TPL  A   G L  + LL++ GA+ N 
Sbjct: 9   TPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNA 68

Query: 217 V-AGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEIL 272
               G TPLH+AA  G+ +++K LLK GAD N  D+DG+ P+ +AA  G+ E V++L
Sbjct: 69  RDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238431 cd00851, MTH1175, This uncharacterized conserved protein belongs to a family of iron-molybdenum cluster-binding proteins that includes NifX, NifB, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 458
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.98
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02795437 ankyrin-like protein; Provisional 99.97
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02792631 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.95
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.95
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
KOG0514452 consensus Ankyrin repeat protein [General function 99.9
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.9
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.88
KOG0553304 consensus TPR repeat-containing protein [General f 99.87
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02741169 hypothetical protein; Provisional 99.85
PHA02884300 ankyrin repeat protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.79
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.78
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
PRK15359144 type III secretion system chaperone protein SscB; 99.72
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.71
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.7
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
KOG4234271 consensus TPR repeat-containing protein [General f 99.67
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.67
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.65
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.65
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.64
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.63
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.59
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.59
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.57
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.55
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.54
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.52
PRK11189 296 lipoprotein NlpI; Provisional 99.52
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.51
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
PRK15359144 type III secretion system chaperone protein SscB; 99.47
PRK10370198 formate-dependent nitrite reductase complex subuni 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.45
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.44
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.44
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.43
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.42
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
PRK10370198 formate-dependent nitrite reductase complex subuni 99.41
KOG1126638 consensus DNA-binding cell division cycle control 99.41
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.38
PRK12370553 invasion protein regulator; Provisional 99.38
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.38
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.38
PRK15331165 chaperone protein SicA; Provisional 99.37
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.37
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 99.37
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.36
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.36
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.36
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.35
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.34
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.33
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.33
PRK12370 553 invasion protein regulator; Provisional 99.32
KOG1126638 consensus DNA-binding cell division cycle control 99.31
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.31
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.3
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.3
KOG1125579 consensus TPR repeat-containing protein [General f 99.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.29
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.29
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.28
KOG4555175 consensus TPR repeat-containing protein [Function 99.27
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.27
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.26
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
PRK11189 296 lipoprotein NlpI; Provisional 99.25
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.24
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.23
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.23
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.22
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.21
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.19
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.17
KOG2076 895 consensus RNA polymerase III transcription factor 99.16
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.15
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 99.14
PRK10803263 tol-pal system protein YbgF; Provisional 99.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.14
PLN02789 320 farnesyltranstransferase 99.14
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.13
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.11
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.08
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.07
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.06
KOG1125579 consensus TPR repeat-containing protein [General f 99.06
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.04
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.03
PLN02789 320 farnesyltranstransferase 99.03
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.02
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.02
PRK11788389 tetratricopeptide repeat protein; Provisional 99.01
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.01
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.99
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.99
KOG2003 840 consensus TPR repeat-containing protein [General f 98.99
PF1337173 TPR_9: Tetratricopeptide repeat 98.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.97
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.96
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.93
PF1337173 TPR_9: Tetratricopeptide repeat 98.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.92
PF13512142 TPR_18: Tetratricopeptide repeat 98.92
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.9
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.89
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.89
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.88
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.86
PF12688120 TPR_5: Tetratrico peptide repeat 98.86
PRK14574 822 hmsH outer membrane protein; Provisional 98.86
KOG0553 304 consensus TPR repeat-containing protein [General f 98.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.85
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.83
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.8
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.8
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.8
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.8
PF1360630 Ank_3: Ankyrin repeat 98.8
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.8
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.8
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.79
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.78
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.77
KOG1129478 consensus TPR repeat-containing protein [General f 98.76
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.76
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.76
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.75
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.75
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.74
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.74
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.73
PF1360630 Ank_3: Ankyrin repeat 98.73
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.73
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.73
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.71
PRK14574 822 hmsH outer membrane protein; Provisional 98.7
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.7
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.7
PLN03077 857 Protein ECB2; Provisional 98.68
PRK11906458 transcriptional regulator; Provisional 98.66
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.64
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.64
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.63
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.63
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.62
PRK15331165 chaperone protein SicA; Provisional 98.62
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.61
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.6
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.6
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.59
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.59
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.59
PF12688120 TPR_5: Tetratrico peptide repeat 98.58
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.56
KOG2076 895 consensus RNA polymerase III transcription factor 98.55
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.54
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.53
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.52
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.52
KOG2003 840 consensus TPR repeat-containing protein [General f 98.5
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.5
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.49
PRK11906458 transcriptional regulator; Provisional 98.48
KOG0522 560 consensus Ankyrin repeat protein [General function 98.48
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.48
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.47
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.46
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.46
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.45
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.45
KOG0511516 consensus Ankyrin repeat protein [General function 98.42
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.42
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.4
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.4
KOG1310 758 consensus WD40 repeat protein [General function pr 98.39
KOG1129478 consensus TPR repeat-containing protein [General f 98.39
COG4700251 Uncharacterized protein conserved in bacteria cont 98.38
KOG0522 560 consensus Ankyrin repeat protein [General function 98.38
PLN03218 1060 maturation of RBCL 1; Provisional 98.36
PRK10803263 tol-pal system protein YbgF; Provisional 98.36
KOG4234271 consensus TPR repeat-containing protein [General f 98.35
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.33
PF1342844 TPR_14: Tetratricopeptide repeat 98.33
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.32
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.31
PF1343134 TPR_17: Tetratricopeptide repeat 98.3
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.29
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.26
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.24
PF1342844 TPR_14: Tetratricopeptide repeat 98.24
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.24
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.23
PF1343134 TPR_17: Tetratricopeptide repeat 98.21
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.2
PLN03077857 Protein ECB2; Provisional 98.18
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.16
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.16
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.16
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.11
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.1
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.1
PLN03218 1060 maturation of RBCL 1; Provisional 98.1
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.09
KOG2384223 consensus Major histocompatibility complex protein 98.08
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.07
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.05
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.01
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.0
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.98
KOG4555175 consensus TPR repeat-containing protein [Function 97.97
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 97.97
KOG2384223 consensus Major histocompatibility complex protein 97.93
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.91
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.9
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.89
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.86
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.85
KOG0520975 consensus Uncharacterized conserved protein, conta 97.85
KOG0511 516 consensus Ankyrin repeat protein [General function 97.85
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.83
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.8
PF13512142 TPR_18: Tetratricopeptide repeat 97.79
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.78
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.77
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.72
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.71
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.7
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.66
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.65
KOG0520975 consensus Uncharacterized conserved protein, conta 97.63
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.61
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.58
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.56
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.54
KOG3364149 consensus Membrane protein involved in organellar 97.53
COG4700251 Uncharacterized protein conserved in bacteria cont 97.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.51
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.48
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.47
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.41
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.41
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.39
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.37
PRK10941269 hypothetical protein; Provisional 97.37
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.36
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.34
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.3
KOG2505591 consensus Ankyrin repeat protein [General function 97.23
KOG2471 696 consensus TPR repeat-containing protein [General f 97.22
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.2
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.2
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 97.2
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.17
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.14
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.14
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.1
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.09
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.06
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.06
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.04
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.02
COG4105 254 ComL DNA uptake lipoprotein [General function pred 97.02
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.01
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.0
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.0
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.99
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.98
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.98
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.98
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.93
PRK10941269 hypothetical protein; Provisional 96.93
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.9
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.89
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.88
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.84
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.84
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.8
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.79
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.76
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.74
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.74
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.7
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.69
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 96.56
PRK04841 903 transcriptional regulator MalT; Provisional 96.54
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.54
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.52
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.44
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.4
PRK04841 903 transcriptional regulator MalT; Provisional 96.39
KOG1586288 consensus Protein required for fusion of vesicles 96.32
KOG2505591 consensus Ankyrin repeat protein [General function 96.05
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.99
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.89
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.85
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.83
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.82
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.73
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.68
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.67
COG2912269 Uncharacterized conserved protein [Function unknow 95.58
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.57
KOG3364149 consensus Membrane protein involved in organellar 95.51
KOG2471 696 consensus TPR repeat-containing protein [General f 95.5
COG5191 435 Uncharacterized conserved protein, contains HAT (H 95.38
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.29
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.29
KOG1586288 consensus Protein required for fusion of vesicles 95.18
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.18
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.17
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.15
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.08
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.07
KOG1585 308 consensus Protein required for fusion of vesicles 95.0
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.0
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.96
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 94.96
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.81
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.68
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 94.63
KOG1585308 consensus Protein required for fusion of vesicles 94.5
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 94.36
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.26
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.24
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.1
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.09
COG2912269 Uncharacterized conserved protein [Function unknow 94.01
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.98
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 93.94
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.86
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.84
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.71
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.63
KOG0529 421 consensus Protein geranylgeranyltransferase type I 93.27
KOG1310 758 consensus WD40 repeat protein [General function pr 93.26
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.18
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.13
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.98
KOG1550 552 consensus Extracellular protein SEL-1 and related 92.91
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 92.82
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.68
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.66
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 92.34
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 92.21
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.17
COG3629280 DnrI DNA-binding transcriptional activator of the 92.13
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 92.09
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.93
KOG4814 872 consensus Uncharacterized conserved protein [Funct 91.75
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.65
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.57
COG3629280 DnrI DNA-binding transcriptional activator of the 91.47
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.11
KOG1258 577 consensus mRNA processing protein [RNA processing 90.99
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 90.46
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 90.42
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 90.0
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 89.92
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.82
KOG2047 835 consensus mRNA splicing factor [RNA processing and 89.77
KOG1550552 consensus Extracellular protein SEL-1 and related 89.74
COG3898 531 Uncharacterized membrane-bound protein [Function u 89.7
COG4649221 Uncharacterized protein conserved in bacteria [Fun 89.38
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 89.36
COG0790 292 FOG: TPR repeat, SEL1 subfamily [General function 89.32
PHA02537230 M terminase endonuclease subunit; Provisional 88.61
KOG2300 629 consensus Uncharacterized conserved protein [Funct 88.56
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 88.56
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.56
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 88.45
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 88.31
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 88.15
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 88.13
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 88.1
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 88.0
KOG0529 421 consensus Protein geranylgeranyltransferase type I 87.53
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 87.23
COG3898 531 Uncharacterized membrane-bound protein [Function u 87.08
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 86.95
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 86.72
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 86.17
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 86.05
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.88
COG4455 273 ImpE Protein of avirulence locus involved in tempe 85.82
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.8
COG4941415 Predicted RNA polymerase sigma factor containing a 85.56
KOG4563 400 consensus Cell cycle-regulated histone H1-binding 85.42
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 85.31
COG3947361 Response regulator containing CheY-like receiver a 85.23
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 85.16
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 85.14
COG3947361 Response regulator containing CheY-like receiver a 84.82
COG5191 435 Uncharacterized conserved protein, contains HAT (H 84.23
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 83.99
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 83.69
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 83.16
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 83.09
PF0421269 MIT: MIT (microtubule interacting and transport) d 82.98
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 82.73
KOG2047 835 consensus mRNA splicing factor [RNA processing and 82.68
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 82.06
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 81.89
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 81.82
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 81.18
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 81.08
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 81.04
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 80.19
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-39  Score=315.35  Aligned_cols=286  Identities=24%  Similarity=0.345  Sum_probs=246.1

Q ss_pred             HHHHHHHHcCChHHHHHHHHHhhhcCCCchhhhhhhcccCCCcHHHHHHHcCCHHHHHHHHHhCCCCCCCCCCCCCcHHH
Q 012683           16 QQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLL   95 (458)
Q Consensus        16 ~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~g~t~L~   95 (458)
                      ..|..|+..||++.|++|++.        .+...+..+..|.||||.|+..|+.++|++|++. |++++..+..|.||||
T Consensus         3 ~~l~~ai~~gd~~~v~~ll~~--------~~~~~n~~~~~~~tpL~~A~~~g~~~iv~~Ll~~-Ga~~n~~~~~~~t~L~   73 (434)
T PHA02874          3 QDLRMCIYSGDIEAIEKIIKN--------KGNCINISVDETTTPLIDAIRSGDAKIVELFIKH-GADINHINTKIPHPLL   73 (434)
T ss_pred             HHHHHHHhcCCHHHHHHHHHc--------CCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHC-CCCCCCCCCCCCCHHH
Confidence            368899999999999999976        2223456677899999999999999999999997 9999999999999999


Q ss_pred             HHHHcCCHHHHHHHHHcCCC-----------------------CCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCC
Q 012683           96 HAARQGHTETAKYLFEHGAN-----------------------PTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSE  152 (458)
Q Consensus        96 ~A~~~g~~~~v~~Ll~~~~~-----------------------~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~  152 (458)
                      .|+..|+.+++++|+++|++                       ++..+..|.||||+|+..|+.+++++|++.|++++..
T Consensus        74 ~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~~~i~~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~gad~n~~  153 (434)
T PHA02874         74 TAIKIGAHDIIKLLIDNGVDTSILPIPCIEKDMIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADVNIE  153 (434)
T ss_pred             HHHHcCCHHHHHHHHHCCCCCCcchhccCCHHHHHHHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCCCCCCc
Confidence            99999999999999987654                       5567889999999999999999999999999999877


Q ss_pred             CCCC-cHHHHHHhCCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCcccc-CCCCcHHHHHHhc
Q 012683          153 SDAG-TPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIV-AGGATPLHIAADI  230 (458)
Q Consensus       153 ~~~~-t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~-~~g~t~L~~A~~~  230 (458)
                      +..+ ||||+|+..++.+++++|+++|++++..+..|.||||+|+..|+.+++++|++.|++++.. ..|.||||.|+..
T Consensus       154 d~~g~tpLh~A~~~~~~~iv~~Ll~~g~~~n~~~~~g~tpL~~A~~~g~~~iv~~Ll~~g~~i~~~~~~g~TpL~~A~~~  233 (434)
T PHA02874        154 DDNGCYPIHIAIKHNFFDIIKLLLEKGAYANVKDNNGESPLHNAAEYGDYACIKLLIDHGNHIMNKCKNGFTPLHNAIIH  233 (434)
T ss_pred             CCCCCCHHHHHHHCCcHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHC
Confidence            6655 9999999999999999999999999999999999999999999999999999999999877 7799999999998


Q ss_pred             CcHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcC-CHHHHHhhcCCCCCCCCCCCcchhhHHHHHHhhccchhHHhhhhh
Q 012683          231 GSTEIIKCLLKAGADPNVTDEDGQKPIQVAAARG-NREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEETRNLK  309 (458)
Q Consensus       231 ~~~~iv~~Ll~~g~~~~~~~~~g~t~l~~A~~~~-~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  309 (458)
                      +. +++.+|+ .|++++.+|..|+||||+|+..+ +.+++++|+.++.+. +..+..+.+++.++.... .....+..++
T Consensus       234 ~~-~~i~~Ll-~~~~in~~d~~G~TpLh~A~~~~~~~~iv~~Ll~~gad~-n~~d~~g~TpL~~A~~~~-~~~~~ik~ll  309 (434)
T PHA02874        234 NR-SAIELLI-NNASINDQDIDGSTPLHHAINPPCDIDIIDILLYHKADI-SIKDNKGENPIDTAFKYI-NKDPVIKDII  309 (434)
T ss_pred             Ch-HHHHHHH-cCCCCCCcCCCCCCHHHHHHhcCCcHHHHHHHHHCcCCC-CCCCCCCCCHHHHHHHhC-CccHHHHHHH
Confidence            65 5677776 58999999999999999999876 899999999987654 445555666666554322 2344556666


Q ss_pred             cCCCC
Q 012683          310 ENNAP  314 (458)
Q Consensus       310 ~~~~~  314 (458)
                      .....
T Consensus       310 ~~~~~  314 (434)
T PHA02874        310 ANAVL  314 (434)
T ss_pred             HhcCc
Confidence            65543



>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-29
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-22
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-23
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-17
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-22
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-04
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-21
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-14
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-20
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-18
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-18
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-15
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-17
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-17
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-17
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-17
2xee_A157 Structural Determinants For Improved Thermal Stabil 9e-16
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-17
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-17
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-16
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-16
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-16
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-16
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-16
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-16
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-16
1uoh_A226 Human Gankyrin Length = 226 7e-16
1uoh_A226 Human Gankyrin Length = 226 7e-09
1uoh_A226 Human Gankyrin Length = 226 2e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 7e-16
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 7e-09
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-05
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-15
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-13
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-15
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-15
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 5e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-05
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-15
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-15
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-14
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-15
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-14
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-14
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 6e-14
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 7e-14
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 7e-14
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-13
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 3e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 6e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 9e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 9e-12
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-11
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-09
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-11
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-11
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 8e-11
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-10
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-10
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 4e-04
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-04
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 2e-10
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-10
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-10
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-10
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-10
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 1e-07
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 3e-10
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-07
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 3e-10
3so8_A162 Crystal Structure Of Ankra Length = 162 3e-10
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-10
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-10
3uxg_A172 Crystal Structure Of Rfxank Length = 172 1e-07
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 8e-10
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-07
1wao_1 477 Pp5 Structure Length = 477 1e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-07
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 2e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-09
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 3e-09
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 2e-06
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-09
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-09
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 4e-09
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 7e-09
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 7e-09
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 7e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 7e-09
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 8e-09
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 4e-07
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-08
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-08
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 3e-08
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 3e-08
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 4e-08
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 2e-07
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-05
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 8e-07
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 9e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-06
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-06
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-06
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-06
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 3e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 4e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 9e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 5e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 9e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 5e-06
1ycs_B239 P53-53bp2 Complex Length = 239 5e-06
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 6e-06
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 6e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 8e-06
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 8e-06
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 9e-06
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-06
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-04
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 3e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-04
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 4e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 5e-05
1d9s_A136 Tumor Suppressor P15(Ink4b) Structure By Comparativ 9e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-04
1bi7_B156 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 4e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-04
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 5e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-04
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-04
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 8e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 126 bits (316), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 91/255 (35%), Positives = 134/255 (52%), Gaps = 12/255 (4%) Query: 21 AACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELK 80 A+ G+L ++K + + +G S V+++K LH AAR G T+V KYLL+ K Sbjct: 21 ASFMGHLPIVKNLLQ------RGASPNVSNVK---VETPLHMAARAGHTEVAKYLLQN-K 70 Query: 81 LDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLT 140 V+ + +D +TPL AAR GHT K L E+ ANP + + G T LH +A G++E + Sbjct: 71 AKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVL 130 Query: 141 YLLSKGAEVDSESDAG-TPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAG 199 LL K A + G TPL AA +G+ ++LLE A+PNA ++ +TPL AV Sbjct: 131 ALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHN 190 Query: 200 SLTCLDLLI-QXXXXXXXXXXXXTPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKPIQ 258 +L + LL+ + TPLHIAA E+ + LL+ G N G P+ Sbjct: 191 NLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLH 250 Query: 259 VAAARGNREAVEILF 273 +AA G+ E V +L Sbjct: 251 LAAQEGHAEMVALLL 265
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-72
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-70
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-70
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-68
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-62
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-51
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-44
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-68
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-55
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-54
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-68
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-64
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-53
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-52
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-42
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-67
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-59
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-56
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-49
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-66
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-59
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-56
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-64
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-54
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-47
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-62
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-59
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-53
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-61
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-54
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-42
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-61
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-52
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-51
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-48
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-60
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-54
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-44
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-42
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-60
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-58
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-45
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-29
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-59
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-55
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-55
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-46
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-58
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-51
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-50
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-44
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-34
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-57
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-54
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-57
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-52
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-51
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-47
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-28
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-39
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-38
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-53
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-51
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-52
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-51
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-40
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-35
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-50
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-42
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-13
2rfa_A232 Transient receptor potential cation channel subfa 7e-50
2rfa_A232 Transient receptor potential cation channel subfa 5e-33
2rfa_A232 Transient receptor potential cation channel subfa 5e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-49
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-43
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-49
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-44
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-47
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-37
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-31
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-47
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-41
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-30
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-37
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-42
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-39
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-39
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-34
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-45
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-43
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-36
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-44
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-39
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-33
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-43
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-38
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-32
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-34
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-29
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-43
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-43
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 4e-42
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-42
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-34
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-30
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-38
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-40
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-39
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-39
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-37
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-39
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-29
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-38
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-37
2etb_A256 Transient receptor potential cation channel subfam 6e-37
2etb_A256 Transient receptor potential cation channel subfam 4e-28
2etb_A256 Transient receptor potential cation channel subfam 3e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-37
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-36
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-32
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-27
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-36
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-36
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-34
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-34
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-24
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-05
2pnn_A273 Transient receptor potential cation channel subfa 1e-33
2pnn_A273 Transient receptor potential cation channel subfa 4e-30
2pnn_A273 Transient receptor potential cation channel subfa 8e-17
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-32
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-31
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-31
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-12
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-31
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-31
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-31
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-27
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-10
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-30
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 6e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-25
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-16
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-24
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 4e-24
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 3e-20
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-19
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 8e-14
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-19
2gw1_A 514 Mitochondrial precursor proteins import receptor; 4e-19
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-19
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-18
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-18
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-18
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-17
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-17
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-11
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-17
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-16
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-14
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-13
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-13
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
3u4t_A 272 TPR repeat-containing protein; structural genomics 3e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-10
3u4t_A 272 TPR repeat-containing protein; structural genomics 2e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-11
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-10
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-08
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-07
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-09
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-08
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 5e-05
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-08
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 8e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-06
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 5e-07
4g1t_A 472 Interferon-induced protein with tetratricopeptide 1e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 5e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  233 bits (597), Expect = 3e-72
 Identities = 84/266 (31%), Positives = 121/266 (45%), Gaps = 16/266 (6%)

Query: 21  AACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRG--ALHFAAREGKTDVCKYLLEE 78
           AA  G +     +A+ L ++        A    A K G   LH A      D+ K LL  
Sbjct: 153 AAKYGKVR----VAELLLERD-------AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 201

Query: 79  LKLDVDTQDEDGETPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIEL 138
                 +   +G TPL  AA+Q   E A+ L ++G +    S  G T LH +A  G+ E+
Sbjct: 202 -GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEM 260

Query: 139 LTYLLSKGAEVDSESDAG-TPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVA 197
           +  LLSK A  +  + +G TPL   A  G      VL++H    +A T    TPL  A  
Sbjct: 261 VALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASH 320

Query: 198 AGSLTCLDLLIQAGANANIV-AGGATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQKP 256
            G++  +  L+Q  A+ N     G +PLH AA  G T+I+  LLK GA PN    DG  P
Sbjct: 321 YGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 380

Query: 257 IQVAAARGNREAVEILFPLTSEDPSI 282
           + +A   G     ++L  +T E   +
Sbjct: 381 LAIAKRLGYISVTDVLKVVTDETSFV 406


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query458
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.79
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.78
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.77
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.75
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.72
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.72
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.72
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.7
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.7
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.69
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.69
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.68
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.67
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.66
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.65
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.65
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.64
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.63
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.62
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.61
3k9i_A117 BH0479 protein; putative protein binding protein, 99.59
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.59
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.59
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.55
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.54
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.53
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.51
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.5
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.5
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.5
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.49
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.49
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.48
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.47
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.47
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.47
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.47
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.46
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.45
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.45
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.45
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.44
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.44
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.44
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.43
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.43
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.43
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.42
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.42
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.41
3u4t_A272 TPR repeat-containing protein; structural genomics 99.41
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.4
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.4
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.4
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.39
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.38
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.38
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.35
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.35
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.34
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.33
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.33
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.33
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.32
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.32
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.32
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.31
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.31
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.3
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.3
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.28
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.27
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.24
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.24
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.23
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.22
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.21
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.19
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.19
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.18
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 99.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.17
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.17
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.17
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.16
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.15
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.13
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.13
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.12
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.11
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.11
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.1
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.1
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.09
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.09
3k9i_A117 BH0479 protein; putative protein binding protein, 99.08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.08
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.07
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.07
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.05
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.05
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.05
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.02
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.02
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.0
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.0
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.98
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.97
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.96
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.96
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.95
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.95
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.9
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.9
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.89
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.89
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.86
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.83
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.81
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.79
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.77
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.76
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.75
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.74
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.72
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.7
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.62
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.6
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.59
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.55
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.54
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.5
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.49
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.47
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.33
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.33
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.33
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.32
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.3
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.25
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.19
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.17
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.85
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.83
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.8
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.69
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.63
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.61
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.58
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.46
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.18
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.16
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.1
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.07
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.74
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 96.68
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.11
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.65
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.32
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.05
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.03
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.9
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.82
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.66
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.51
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.26
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 93.8
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 93.4
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.99
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.76
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.83
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 87.01
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 86.64
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 84.98
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 84.82
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 84.71
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 83.47
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 82.8
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 82.12
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 81.93
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 81.84
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 81.62
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.28
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.92
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 80.08
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=3.6e-44  Score=329.84  Aligned_cols=260  Identities=25%  Similarity=0.349  Sum_probs=241.5

Q ss_pred             HHHHHHHHHHHHcCChHHHHHHHHHhhhcCCCchhhhhhhcccCCCcHHHHHHHcCCHHHHHHHHHhCCCCCCCCCCCCC
Q 012683           12 RERVQQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGE   91 (458)
Q Consensus        12 ~~~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~g~   91 (458)
                      ..+.++|+.|+..|++++|++|++..    ..+    ....+..|.||||+|+..|+.+++++|++. |.+++..+..|.
T Consensus         3 ~~g~~~L~~A~~~g~~~~v~~Ll~~g----~~~----~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~~~~g~   73 (285)
T 1wdy_A            3 VEDNHLLIKAVQNEDVDLVQQLLEGG----ANV----NFQEEEGGWTPLHNAVQMSREDIVELLLRH-GADPVLRKKNGA   73 (285)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHTT----CCT----TCCCTTTCCCHHHHHHHTTCHHHHHHHHHT-TCCTTCCCTTCC
T ss_pred             cccchHHHHHHHcCCHHHHHHHHHcC----CCc----ccccCCCCCcHHHHHHHcCCHHHHHHHHHc-CCCCcccCCCCC
Confidence            46788999999999999999999872    222    222367899999999999999999999998 999999999999


Q ss_pred             cHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCC----------C-CCCcHHH
Q 012683           92 TPLLHAARQGHTETAKYLFEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSE----------S-DAGTPLI  160 (458)
Q Consensus        92 t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~----------~-~~~t~l~  160 (458)
                      ||||+|+..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|++.|++++..          + .+.||||
T Consensus        74 t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~g~t~L~  153 (285)
T 1wdy_A           74 TPFLLAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALM  153 (285)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCTTCBCTTCCBHHHHHHHTTCHHHHHHHHHTTCCTTCCCCCCHHHHHTTCCCCCHHH
T ss_pred             CHHHHHHHcCCHHHHHHHHHcCCCCCccCcccCCHHHHHHHhCCHHHHHHHHHhCCCcccccccHHHHHhhccCCCcHHH
Confidence            9999999999999999999999999999999999999999999999999999999998765          3 3449999


Q ss_pred             HHHhCCCHHHHHHHHhc-CCCCCCCCCCCCcHHHHHHHcCC----HHHHHHHHHcCCCcccc-CCCCcHHHHHHhcCcHH
Q 012683          161 WAAGHGQQEAVKVLLEH-HANPNAETEDNITPLLSAVAAGS----LTCLDLLIQAGANANIV-AGGATPLHIAADIGSTE  234 (458)
Q Consensus       161 ~A~~~~~~~~~~~Ll~~-~~~~~~~~~~~~t~l~~a~~~~~----~~~~~~Ll~~g~~~~~~-~~g~t~L~~A~~~~~~~  234 (458)
                      +|+..|+.+++++|++. |.+++..+..|.||||.|+..++    .+++++|+++|++++.. ..|.||||+|+..|+.+
T Consensus       154 ~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~i~~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~  233 (285)
T 1wdy_A          154 DAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLG  233 (285)
T ss_dssp             HHHHHTCHHHHHHHHHTSCCCTTCCCTTSCCHHHHHHHCSCTTTHHHHHHHHHHTTCCSSCCCTTSCCHHHHHHHTTCHH
T ss_pred             HHHHcCCHHHHHHHHHhcCCCCCccCCCCCCHHHHHHHccccchHHHHHHHHHHcCCCCCCcCCCCCcHHHHHHHcCCHH
Confidence            99999999999999997 99999999999999999999999    99999999999999987 77999999999999999


Q ss_pred             HHHHHHH-cCCCCCCCCCCCCcHHHHHHHcCCHHHHHhhcCCCCCCC
Q 012683          235 IIKCLLK-AGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDP  280 (458)
Q Consensus       235 iv~~Ll~-~g~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll~~~~~~~  280 (458)
                      ++++|++ .|++++.+|..|+||||+|+..|+.+++++|+++|....
T Consensus       234 ~v~~Ll~~~g~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~Ga~~~  280 (285)
T 1wdy_A          234 LVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD  280 (285)
T ss_dssp             HHHHHHHSSSCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHSSCSC
T ss_pred             HHHHHHhccCCCccccCCCCCcHHHHHHHcCcHHHHHHHHHcCCCCC
Confidence            9999999 899999999999999999999999999999999987644



>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 458
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-42
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-40
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-37
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-36
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-30
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-35
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-24
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-34
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-28
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-27
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-28
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-26
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-25
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-15
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-24
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-16
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-23
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-18
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-23
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-18
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-18
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-16
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-12
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-12
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-12
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 4e-10
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 5e-10
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-10
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-08
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-09
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.001
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-08
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-06
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-04
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 3e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 4e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 8e-04
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  153 bits (387), Expect = 1e-42
 Identities = 77/268 (28%), Positives = 107/268 (39%), Gaps = 36/268 (13%)

Query: 50  DIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLLHAARQGHTETAKYL 109
                     LH AA+ GK  V + LLE      +   ++G TPL  A    + +  K L
Sbjct: 126 ACMTKKGFTPLHVAAKYGKVRVAELLLER-DAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 184

Query: 110 FEHGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSESDAG-TPLIWAAGHGQQ 168
              G +P  P+  G T LH +A    +E+   LL  G   ++ES  G TPL  AA  G  
Sbjct: 185 LPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHA 244

Query: 169 EAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIVAG--------- 219
           E V +LL   AN N   +  +TPL      G +   D+LI+ G   +             
Sbjct: 245 EMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVA 304

Query: 220 -------------------------GATPLHIAADIGSTEIIKCLLKAGADPNVTDEDGQ 254
                                    G +PLH AA  G T+I+  LLK GA PN    DG 
Sbjct: 305 SHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGT 364

Query: 255 KPIQVAAARGNREAVEILFPLTSEDPSI 282
            P+ +A   G     ++L  +T E   +
Sbjct: 365 TPLAIAKRLGYISVTDVLKVVTDETSFV 392


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query458
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.98
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.84
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.83
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.81
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.8
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.77
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.69
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.68
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.65
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.6
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.55
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.55
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.55
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.51
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.47
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.45
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.43
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.39
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.36
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.29
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.26
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.21
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.19
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.15
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.08
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.01
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.95
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.91
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.83
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.67
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.63
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.53
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.44
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.42
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.42
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.39
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.33
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.98
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.78
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.77
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.32
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 85.38
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 84.41
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 84.06
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.2e-38  Score=303.16  Aligned_cols=277  Identities=31%  Similarity=0.480  Sum_probs=217.5

Q ss_pred             HHHHHHHHcCChHHHHHHHHHhhhcCCCchhhhhhhcccCCCcHHHHHHHcCCHHHHHHHHHhCCCCCCCCCCCCCcHHH
Q 012683           16 QQFLNAACTGNLDLLKKIAKQLDDQGKGLSKTVADIKDANKRGALHFAAREGKTDVCKYLLEELKLDVDTQDEDGETPLL   95 (458)
Q Consensus        16 ~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~g~t~L~   95 (458)
                      ++||.||..|++++|++|++.    |+++     +..|..|.||||+|+..|+.+++++|+++ |++++.++..|+||||
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~----g~~i-----n~~d~~g~TpL~~A~~~g~~~iv~~Ll~~-gadi~~~~~~g~t~L~   71 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQR----GASP-----NVSNVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAKAKDDQTPLH   71 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHT----TCCS-----CCSSSCCCCHHHHHHHHTCHHHHHHHHHH-TCCSSCCCTTSCCHHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHC----CCCC-----CCCCCCCCCHHHHHHHcCCHHHHHHHHHC-cCCCCCCCCCCCCHHH
Confidence            689999999999999999986    4433     56788999999999999999999999998 9999999999999999


Q ss_pred             HHHHcCCHHHHHHHHH----------------------------------------------------------------
Q 012683           96 HAARQGHTETAKYLFE----------------------------------------------------------------  111 (458)
Q Consensus        96 ~A~~~g~~~~v~~Ll~----------------------------------------------------------------  111 (458)
                      +|+..|+.+++++|+.                                                                
T Consensus        72 ~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~l  151 (408)
T d1n11a_          72 CAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL  151 (408)
T ss_dssp             HHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHH
T ss_pred             HHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHH
Confidence            9998888777666554                                                                


Q ss_pred             --cCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCC----------------------------------CC
Q 012683          112 --HGANPTIPSNLGATALHHSAGIGNIELLTYLLSKGAEVDSES----------------------------------DA  155 (458)
Q Consensus       112 --~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~~----------------------------------~~  155 (458)
                        +|++++..+..|.+|||.|+..|+.+++++|+.+|++++..+                                  .+
T Consensus       152 l~~~~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  231 (408)
T d1n11a_         152 LERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQG  231 (408)
T ss_dssp             HHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTC
T ss_pred             HHcCCCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCC
Confidence              344444445556666666666666666666666555443211                                  11


Q ss_pred             CcHHHHHHhCCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCcccc-CCCCcHHHHHHhcCcHH
Q 012683          156 GTPLIWAAGHGQQEAVKVLLEHHANPNAETEDNITPLLSAVAAGSLTCLDLLIQAGANANIV-AGGATPLHIAADIGSTE  234 (458)
Q Consensus       156 ~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~-~~g~t~L~~A~~~~~~~  234 (458)
                      .||+++|+..+..++++++...+...+..+..|.||++.++..++.+++++|+++|++++.. ..+.||||.++..++.+
T Consensus       232 ~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~~~~~  311 (408)
T d1n11a_         232 VTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIK  311 (408)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSH
T ss_pred             CCHHHHHHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhcccCcce
Confidence            14555555555555555555555566666777888999999999999999999999999877 67899999999999999


Q ss_pred             HHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCHHHHHhhcCCCCCCCCCCCcchhhHHHHHHhhccchhHHh
Q 012683          235 IIKCLLKAGADPNVTDEDGQKPIQVAAARGNREAVEILFPLTSEDPSIPKWTVDGILEYMQSESGKQLEET  305 (458)
Q Consensus       235 iv~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  305 (458)
                      +++++++.|++++.+|..|+||||+|+.+|+.++|++|+++|+. ++..+.++.+++.++...  +.++.+
T Consensus       312 ~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd-~n~~d~~G~t~L~~A~~~--~~~~iv  379 (408)
T d1n11a_         312 LVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS-PNEVSSDGTTPLAIAKRL--GYISVT  379 (408)
T ss_dssp             HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-SCCCCSSSCCHHHHHHHT--TCHHHH
T ss_pred             eeeeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCC-CCCCCCCCCCHHHHHHHc--CCHHHH
Confidence            99999999999999999999999999999999999999999865 556666677777666544  444444



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure