Citrus Sinensis ID: 012755

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------
MVFRDSLEEPRIGGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
ccccccccccccccccccccHHHHccccccHHHHHHHHcHHHHHHHHHHHHEEHHccccccccccccHHHHHHHHHHHcccccccccccccEEcccccccccccccccccccccHHHHHHccccccccccccccccccccccEEccccEEEEcccccccccEEEEEEEcccEEEEccccccEEEcccccccccccccccEEEEEccEEEEccccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEcccccccccccEEEEEEcccccEEEcccccccccccccccccccccEEEEEccEEEEccccccEEEEEEccccEEEEcccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEEEcccccccccccEEEcccccccEEEEEEEEEcc
cccccccccccEccccccccHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHccccccccHccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHEEEccEEEEEccccccEEEEEEEEccccEEEEEccccccEEEcccccccccccccccEEEEEccEEEEEEccccccEEEEEccccccccEccccccccccEEEEEEccEEEEEEccccccccEEEEEEEccccccEEEcccccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEEccccccccccccccccccccEEEEEccEEEEEcccccEEEEEccccccEEEEcccccccccccccEEEEEEEccEEEEEEccccccccEEEEEEEcccccccccccEEEEccccccccEEEEEEEEcc
mvfrdsleepriggvgdcessvmFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLdraglknkcpvvitkngdkhncqasddsflpglhddatldilawssrsdyptlsclNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILmpweafdplrqrwmrlprmqcdecftsadkeSLAVGTQLLVFGRELSGFAIWMYSLIANcwskcpqmnlprclfgssslgEVAIVaggtdkngciLKSAELYnselgtwetlpdmnlprklcsgffmdgkfyiiggmssptdpltcgeeynleTRTWKRienmypsnvgtqsnpamsspplvAVVNNQLYSADQATNVVKKYNktnnswtvvkrlpvransfngwGLAFKACGNSLLVIGGHRELQGEIIVlhswdptdgnsgeaQWNELAVRERAGAFVYNCAVMGC
mvfrdsleepriggvgdcESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKkynktnnswtvvkrLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
MVFRDSLEEPRIGGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQAtnvvkkynktnnSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
************GGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMY****************LVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVM**
********EPRIGGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHI********************************************************GLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
********EPRIGGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
*****SLEEPRIGGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKN*******************DSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFRDSLEEPRIGGVGDCESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query457 2.2.26 [Sep-21-2011]
Q9FKJ0393 F-box/kelch-repeat protei yes no 0.789 0.918 0.576 1e-120
Q8L736467 F-box/kelch-repeat protei no no 0.759 0.743 0.557 1e-107
Q84M94421 F-box/kelch-repeat protei no no 0.846 0.919 0.474 1e-101
Q9CA63451 F-box/kelch-repeat protei no no 0.748 0.758 0.502 4e-97
Q9LI89422 F-box/kelch-repeat protei no no 0.748 0.810 0.378 1e-57
Q9CAG8376 F-box/kelch-repeat protei no no 0.684 0.832 0.244 2e-20
Q0WW40383 F-box/kelch-repeat protei no no 0.652 0.778 0.246 2e-17
Q93W93434 F-box/kelch-repeat protei no no 0.564 0.594 0.259 1e-15
Q9LM55475 F-box/kelch-repeat protei no no 0.612 0.589 0.238 2e-13
Q6DFU2638 Influenza virus NS1A-bind N/A no 0.424 0.304 0.276 3e-13
>sp|Q9FKJ0|FK132_ARATH F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1 Back     alignment and function desciption
 Score =  432 bits (1111), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 212/368 (57%), Positives = 262/368 (71%), Gaps = 7/368 (1%)

Query: 92  VITKNGDKHNCQ-ASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLY 150
           V  ++ D H  +  S DS LPGL DD  L+ LAW  RSDYP+LSC+N+K+  LI SG+L+
Sbjct: 31  VGEEDNDGHRLRLGSSDSVLPGLIDDVALNCLAWVPRSDYPSLSCVNKKYNKLINSGHLF 90

Query: 151 KLRRQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLV 210
            LR++LG+VE+ V++ C    W  F P++++WM LP+M CDECF  ADKESLAV  +LLV
Sbjct: 91  ALRKELGIVEYLVFMVCDPRGWLMFSPMKKKWMVLPKMPCDECFNHADKESLAVDDELLV 150

Query: 211 FGRELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAEL 270
           FGREL  FAIW YSL + CW KC  M+ PRCLF S SLG +AIVAGGTD NG IL SAEL
Sbjct: 151 FGRELFQFAIWKYSLRSRCWVKCEGMHRPRCLFASGSLGGIAIVAGGTDMNGNILASAEL 210

Query: 271 YNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIE 330
           Y+S  G WE LP+M+ PR+LCSGFFMDGKFY+IGGMSSP   +T GEE++LETR W++IE
Sbjct: 211 YDSSSGRWEMLPNMHSPRRLCSGFFMDGKFYVIGGMSSPNVSVTFGEEFDLETRKWRKIE 270

Query: 331 NMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQATNVVKKYNKTNNSWTVVKRLPVRANS 390
            MYP+      N A  +PPLV VVNN+L++ + +TN+VKKY+K  N W V+ RLP   +S
Sbjct: 271 GMYPN-----VNRAAQAPPLVVVVNNELFTLEYSTNMVKKYDKVKNKWEVMGRLPPMVDS 325

Query: 391 FNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDG-NSGEAQWNELAVRERAGAFV 449
            NGWGLAFK CG+ LLV  G R   GE IV++SW P  G   G   W  L V+E  G FV
Sbjct: 326 SNGWGLAFKPCGDQLLVFCGQRGPHGEGIVVNSWCPKSGAKDGNLDWKVLGVKENVGVFV 385

Query: 450 YNCAVMGC 457
           YNCAVMGC
Sbjct: 386 YNCAVMGC 393

Arabidopsis thaliana (taxid: 3702)
>sp|Q8L736|SKI11_ARATH F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2 Back     alignment and function description
>sp|Q84M94|FBK15_ARATH F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA63|FBK29_ARATH F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1 Back     alignment and function description
>sp|Q9LI89|FBK70_ARATH F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query457
225454690461 PREDICTED: F-box/kelch-repeat protein At 1.0 0.991 0.731 0.0
224144877446 f-box family protein [Populus trichocarp 0.971 0.995 0.688 0.0
224126207362 f-box family protein [Populus trichocarp 0.787 0.994 0.779 1e-170
147819347 594 hypothetical protein VITISV_023856 [Viti 0.929 0.715 0.669 1e-168
90399335517 H0313F03.20 [Oryza sativa Indica Group] 0.864 0.764 0.690 1e-158
297603366455 Os04g0619300 [Oryza sativa Japonica Grou 0.864 0.868 0.685 1e-158
242074350450 hypothetical protein SORBIDRAFT_06g02882 0.949 0.964 0.603 1e-154
226509066472 hypothetical protein [Zea mays] gi|19468 0.951 0.921 0.596 1e-153
194689482450 unknown [Zea mays] gi|194706944|gb|ACF87 0.951 0.966 0.596 1e-153
357166006470 PREDICTED: F-box/kelch-repeat protein At 0.951 0.925 0.603 1e-148
>gi|225454690|ref|XP_002270236.1| PREDICTED: F-box/kelch-repeat protein At5g60570 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/461 (73%), Positives = 382/461 (82%), Gaps = 4/461 (0%)

Query: 1   MVFRDSLEEPRIGGVGDC-ESSVMFDFQNHVITDVSKHFGQDLKFVKEKLQMLVHILSTR 59
           MVFR SLEE ++   G   ES  M   +   I  +   F  DL F+ +   +L +IL  R
Sbjct: 1   MVFRYSLEELKMKIEGTVYESPTMVGVRGCSIFQLPGSFDGDLGFMLKNCYLLAYILLAR 60

Query: 60  RNS--LKDGIEDLISKEMLISNLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDA 117
           +N+  +KD  + L++KEM I +LD  GLK K P++    G+ H  QASDDSFLPGL+DD 
Sbjct: 61  QNNNKVKDVGKGLLNKEMYIPSLDCIGLKKKKPMIRAWAGENHGGQASDDSFLPGLNDDT 120

Query: 118 TLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLRRQLGMVEHWVYLACILMPWEAFDP 177
            LDI AWSSRSDY  L+CLN+KFKSLI SGYLYKLRR+LG++EHWVYLACILMPWEAFDP
Sbjct: 121 ALDIFAWSSRSDYSKLACLNKKFKSLIGSGYLYKLRRRLGVIEHWVYLACILMPWEAFDP 180

Query: 178 LRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANCWSKCPQMN 237
            RQRWMRLPRM CDECFT ADKESLAVGT+LLVFGRELSGFAIWMYSL+   WS+CP MN
Sbjct: 181 ERQRWMRLPRMPCDECFTYADKESLAVGTELLVFGRELSGFAIWMYSLLTRDWSRCPLMN 240

Query: 238 LPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMD 297
           LPRCLFGSSSLGE+AIVAGG+DKNG +LKSAELYNSELGTW+TLPDMNLPRKLCSGFFMD
Sbjct: 241 LPRCLFGSSSLGEIAIVAGGSDKNGHVLKSAELYNSELGTWQTLPDMNLPRKLCSGFFMD 300

Query: 298 GKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYP-SNVGTQSNPAMSSPPLVAVVNN 356
           GKFY+IGGMSS TD LTCGEEYN+ETR W+RIENMYP SN+GTQ  PAM SPPLVAVVNN
Sbjct: 301 GKFYVIGGMSSHTDCLTCGEEYNIETRIWRRIENMYPGSNIGTQFPPAMRSPPLVAVVNN 360

Query: 357 QLYSADQATNVVKKYNKTNNSWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQG 416
           QLYSADQATN VKKY+K+NNSW+VVKRLPVRA+S NGWGLAFKACG+SLLVIGGHR  +G
Sbjct: 361 QLYSADQATNEVKKYDKSNNSWSVVKRLPVRADSSNGWGLAFKACGDSLLVIGGHRGPEG 420

Query: 417 EIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVMGC 457
           E+IVLHSW+P DGN+G   WN L+VRERAGAFVYNCAVMGC
Sbjct: 421 EVIVLHSWEPEDGNAGGPDWNVLSVRERAGAFVYNCAVMGC 461

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224144877|ref|XP_002325447.1| f-box family protein [Populus trichocarpa] gi|222862322|gb|EEE99828.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126207|ref|XP_002319782.1| f-box family protein [Populus trichocarpa] gi|222858158|gb|EEE95705.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147819347|emb|CAN68954.1| hypothetical protein VITISV_023856 [Vitis vinifera] Back     alignment and taxonomy information
>gi|90399335|emb|CAJ86133.1| H0313F03.20 [Oryza sativa Indica Group] gi|157887813|emb|CAJ86391.1| H0114G12.4 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297603366|ref|NP_001053897.2| Os04g0619300 [Oryza sativa Japonica Group] gi|5679844|emb|CAB51837.1| l1332.8 [Oryza sativa Indica Group] gi|38344328|emb|CAD41744.2| OSJNBa0058K23.10 [Oryza sativa Japonica Group] gi|215694388|dbj|BAG89381.1| unnamed protein product [Oryza sativa Japonica Group] gi|218195595|gb|EEC78022.1| hypothetical protein OsI_17442 [Oryza sativa Indica Group] gi|222629573|gb|EEE61705.1| hypothetical protein OsJ_16191 [Oryza sativa Japonica Group] gi|255675784|dbj|BAF15811.2| Os04g0619300 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242074350|ref|XP_002447111.1| hypothetical protein SORBIDRAFT_06g028820 [Sorghum bicolor] gi|241938294|gb|EES11439.1| hypothetical protein SORBIDRAFT_06g028820 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|226509066|ref|NP_001142058.1| hypothetical protein [Zea mays] gi|194689452|gb|ACF78810.1| unknown [Zea mays] gi|414585413|tpg|DAA35984.1| TPA: hypothetical protein ZEAMMB73_466670 [Zea mays] Back     alignment and taxonomy information
>gi|194689482|gb|ACF78825.1| unknown [Zea mays] gi|194706944|gb|ACF87556.1| unknown [Zea mays] gi|223948837|gb|ACN28502.1| unknown [Zea mays] gi|224030111|gb|ACN34131.1| unknown [Zea mays] gi|414585409|tpg|DAA35980.1| TPA: hypothetical protein ZEAMMB73_466670 [Zea mays] gi|414585410|tpg|DAA35981.1| TPA: hypothetical protein ZEAMMB73_466670 [Zea mays] gi|414585411|tpg|DAA35982.1| TPA: hypothetical protein ZEAMMB73_466670 [Zea mays] Back     alignment and taxonomy information
>gi|357166006|ref|XP_003580566.1| PREDICTED: F-box/kelch-repeat protein At5g60570-like isoform 3 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query457
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.783 0.910 0.561 3e-108
TAIR|locus:2056705467 AT2G02870 "AT2G02870" [Arabido 0.768 0.751 0.541 2e-97
TAIR|locus:2202765421 AT1G26930 "AT1G26930" [Arabido 0.838 0.909 0.487 4.3e-93
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.778 0.807 0.519 1.1e-92
TAIR|locus:2019215451 AT1G74510 "AT1G74510" [Arabido 0.873 0.884 0.445 9.6e-89
TAIR|locus:2095138422 AT3G27150 "AT3G27150" [Arabido 0.748 0.810 0.370 7e-54
TAIR|locus:2168738415 AT5G40680 "AT5G40680" [Arabido 0.743 0.819 0.347 1.8e-46
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.673 0.819 0.247 2.7e-18
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.518 0.546 0.283 2.8e-15
TAIR|locus:2077299352 AT3G63220 "AT3G63220" [Arabido 0.448 0.582 0.258 8.4e-13
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1070 (381.7 bits), Expect = 3.0e-108, P = 3.0e-108
 Identities = 205/365 (56%), Positives = 252/365 (69%)

Query:    95 KNGDKHNCQ-ASDDSFLPGLHDDATLDILAWSSRSDYPTLSCLNRKFKSLIASGYLYKLR 153
             ++ D H  +  S DS LPGL DD  L+ LAW  RSDYP+LSC+N+K+  LI SG+L+ LR
Sbjct:    34 EDNDGHRLRLGSSDSVLPGLIDDVALNCLAWVPRSDYPSLSCVNKKYNKLINSGHLFALR 93

Query:   154 RQLGMVEHWVYLACILMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGR 213
             ++LG+VE+ V++ C    W  F P++++WM LP+M CDECF  ADKESLAV  +LLVFGR
Sbjct:    94 KELGIVEYLVFMVCDPRGWLMFSPMKKKWMVLPKMPCDECFNHADKESLAVDDELLVFGR 153

Query:   214 ELSGFAIWMYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNS 273
             EL  FAIW YSL + CW KC  M+ PRCLF S SLG +AIVAGGTD NG IL SAELY+S
Sbjct:   154 ELFQFAIWKYSLRSRCWVKCEGMHRPRCLFASGSLGGIAIVAGGTDMNGNILASAELYDS 213

Query:   274 ELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMY 333
               G WE LP+M+ PR+LCSGFFMDGKFY+IGGMSSP   +T GEE++LETR W++IE MY
Sbjct:   214 SSGRWEMLPNMHSPRRLCSGFFMDGKFYVIGGMSSPNVSVTFGEEFDLETRKWRKIEGMY 273

Query:   334 PSNVGTQSNPAMSSPPLVAVVNNQLYSADQAXXXXXXXXXXXXSWTVVKRLPVRANSFNG 393
             P NV    N A  +PPLV VVNN+L++ + +             W V+ RLP   +S NG
Sbjct:   274 P-NV----NRAAQAPPLVVVVNNELFTLEYSTNMVKKYDKVKNKWEVMGRLPPMVDSSNG 328

Query:   394 WGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDG-NSGEAQWNELAVRERAGAFVYNC 452
             WGLAFK CG+ LLV  G R   GE IV++SW P  G   G   W  L V+E  G FVYNC
Sbjct:   329 WGLAFKPCGDQLLVFCGQRGPHGEGIVVNSWCPKSGAKDGNLDWKVLGVKENVGVFVYNC 388

Query:   453 AVMGC 457
             AVMGC
Sbjct:   389 AVMGC 393
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2056705 AT2G02870 "AT2G02870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202765 AT1G26930 "AT1G26930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019215 AT1G74510 "AT1G74510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095138 AT3G27150 "AT3G27150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168738 AT5G40680 "AT5G40680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077299 AT3G63220 "AT3G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKJ0FK132_ARATHNo assigned EC number0.57600.78990.9185yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query457
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-12
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-09
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-09
pfam0134446 pfam01344, Kelch_1, Kelch motif 8e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 9e-06
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 3e-05
smart0061247 smart00612, Kelch, Kelch domain 5e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 8e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 5e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 7e-04
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 69.4 bits (170), Expect = 1e-12
 Identities = 37/166 (22%), Positives = 67/166 (40%), Gaps = 17/166 (10%)

Query: 227 ANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNL 286
            + W + P +  PR      ++  +  V GG  KN  +LK+ E ++     W     + +
Sbjct: 367 ESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKNDELLKTVECFSLNTNKWSKGSPLPI 426

Query: 287 PRKLCSGFFMDGKFYIIGGMSSPTDP--LTCGEEYNLETRTWKRIENMYPSNVGTQSNPA 344
                   + DGK Y+IGG+S   +       E YN  T  W    +    N   + N +
Sbjct: 427 SHYGGCAIYHDGKIYVIGGISYIDNIKVYNIVESYNPVTNKW-TELSSL--NF-PRINAS 482

Query: 345 MSSPPLVAVVNNQLY-----SADQATNVVKKYNKTNNSWTVVKRLP 385
                 + + NN++Y       +   N ++ Y+   N+WT+  + P
Sbjct: 483 ------LCIFNNKIYVVGGDKYEYYINEIEVYDDKTNTWTLFCKFP 522

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 457
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.93
KOG1230521 consensus Protein containing repeated kelch motifs 99.93
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.92
KOG1230 521 consensus Protein containing repeated kelch motifs 99.91
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.89
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.82
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.77
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.59
PF1396450 Kelch_6: Kelch motif 99.25
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 99.06
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.04
PF1396450 Kelch_6: Kelch motif 99.03
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.03
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.95
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.91
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.85
PF1341549 Kelch_3: Galactose oxidase, central domain 98.84
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.83
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.76
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.69
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.69
smart0061247 Kelch Kelch domain. 98.67
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.65
PF1341549 Kelch_3: Galactose oxidase, central domain 98.54
PLN02772 398 guanylate kinase 98.45
smart0061247 Kelch Kelch domain. 98.4
PF1385442 Kelch_5: Kelch motif 98.28
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.27
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.27
PLN02772 398 guanylate kinase 98.23
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.19
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.16
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.16
PF1385442 Kelch_5: Kelch motif 98.08
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.03
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.99
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.89
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.73
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.69
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.65
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.65
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.54
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.34
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.22
PF12768281 Rax2: Cortical protein marker for cell polarity 96.79
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.57
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.52
PRK04792448 tolB translocation protein TolB; Provisional 96.49
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.4
PRK00178430 tolB translocation protein TolB; Provisional 96.25
PF03089337 RAG2: Recombination activating protein 2; InterPro 96.17
PF12768281 Rax2: Cortical protein marker for cell polarity 96.02
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.97
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.58
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.54
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.5
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.43
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.29
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 95.24
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 95.24
PRK04922433 tolB translocation protein TolB; Provisional 95.22
KOG2055514 consensus WD40 repeat protein [General function pr 95.08
PRK05137435 tolB translocation protein TolB; Provisional 95.01
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.79
PF03089337 RAG2: Recombination activating protein 2; InterPro 94.56
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.35
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.2
PF09910339 DUF2139: Uncharacterized protein conserved in arch 94.1
KOG0315311 consensus G-protein beta subunit-like protein (con 93.93
COG1520370 FOG: WD40-like repeat [Function unknown] 93.91
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.68
KOG0310 487 consensus Conserved WD40 repeat-containing protein 93.66
PRK00178430 tolB translocation protein TolB; Provisional 93.49
KOG2997366 consensus F-box protein FBX9 [General function pre 93.44
KOG2055 514 consensus WD40 repeat protein [General function pr 93.29
smart00284255 OLF Olfactomedin-like domains. 93.2
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.01
PRK11028330 6-phosphogluconolactonase; Provisional 92.83
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 92.62
KOG0310 487 consensus Conserved WD40 repeat-containing protein 92.59
PRK13684334 Ycf48-like protein; Provisional 92.43
PRK11028330 6-phosphogluconolactonase; Provisional 92.32
PRK03629429 tolB translocation protein TolB; Provisional 92.1
PRK04922433 tolB translocation protein TolB; Provisional 91.9
PRK04043419 tolB translocation protein TolB; Provisional 91.46
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.41
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 91.37
PRK05137435 tolB translocation protein TolB; Provisional 90.91
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 90.9
KOG2048 691 consensus WD40 repeat protein [General function pr 90.84
PLN00181793 protein SPA1-RELATED; Provisional 90.8
PRK02889427 tolB translocation protein TolB; Provisional 90.73
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 90.66
PRK04792448 tolB translocation protein TolB; Provisional 90.63
PF12217367 End_beta_propel: Catalytic beta propeller domain o 90.43
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 90.19
KOG0316307 consensus Conserved WD40 repeat-containing protein 90.05
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 89.99
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.81
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.29
smart00284255 OLF Olfactomedin-like domains. 89.28
COG4946 668 Uncharacterized protein related to the periplasmic 89.25
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.82
PLN00181793 protein SPA1-RELATED; Provisional 88.55
COG1520370 FOG: WD40-like repeat [Function unknown] 88.17
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 87.75
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 87.21
PRK13684334 Ycf48-like protein; Provisional 86.83
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 86.54
KOG0315311 consensus G-protein beta subunit-like protein (con 85.96
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 85.57
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 84.85
COG3823262 Glutamine cyclotransferase [Posttranslational modi 84.68
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 84.43
PRK01742429 tolB translocation protein TolB; Provisional 84.21
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 83.81
PRK02889427 tolB translocation protein TolB; Provisional 83.59
PRK04043419 tolB translocation protein TolB; Provisional 83.46
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 81.78
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 81.29
PRK03629429 tolB translocation protein TolB; Provisional 81.05
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-46  Score=389.29  Aligned_cols=396  Identities=23%  Similarity=0.304  Sum_probs=294.2

Q ss_pred             CceEeeecCcEEEeccc---------------------ccccchHHHHHhhHhhhhhhhhccCCccccceeeeccccccc
Q 012755           20 SSVMFDFQNHVITDVSK---------------------HFGQDLKFVKEKLQMLVHILSTRRNSLKDGIEDLISKEMLIS   78 (457)
Q Consensus        20 ~~~~~~~~~~~~~~~~~---------------------~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~   78 (457)
                      +...+++.||+=++.+.                     .+.+..-|++-...++..+|+.-..+ .+.|+.+++..+...
T Consensus       130 L~~~l~~~Nclgi~~~a~~~~~~~L~~~a~~~i~~~F~~v~~~eefl~L~~~~l~~ll~~d~l~-v~~E~~vf~a~~~Wv  208 (571)
T KOG4441|consen  130 LESQLDPSNCLGIRRFAELHSCTELLEVADEYILQHFAEVSKTEEFLLLSLEELIGLLSSDDLN-VDSEEEVFEAAMRWV  208 (571)
T ss_pred             HHhcCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHhccHHhhCCCHHHHHhhccccCCC-cCCHHHHHHHHHHHH
Confidence            34567888998655443                     33333344444444444444444333 344455555555444


Q ss_pred             cccccccccccceeeccCCCCCCCCCCCCCCCCCCcHHHHhhhceecccccc-Ccccc-cC--hhhhhhhccC-cchhhh
Q 012755           79 NLDRAGLKNKCPVVITKNGDKHNCQASDDSFLPGLHDDATLDILAWSSRSDY-PTLSC-LN--RKFKSLIASG-YLYKLR  153 (457)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPddl~~~iLarlp~~~~-~~l~~-v~--k~w~~li~s~-~~~~~r  153 (457)
                      ..+....++.-+            ......-+|-||...+.++....+...- ..++. +.  +.+..+-... .....|
T Consensus       209 ~~d~~~R~~~~~------------~ll~~vr~~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~  276 (571)
T KOG4441|consen  209 KHDFEEREEHLP------------ALLEAVRLPLLPPQFLVEIVESEPLIKRDSACRDLLDEAKKYHLLPQRRPVMQSPR  276 (571)
T ss_pred             hcCHhhHHHHHH------------HHHHhcCccCCCHHHHHHHHhhhhhhccCHHHHHHHHHHHHHhhCcccCccccCCC
Confidence            433211111111            1222333578888888887776652110 11111 00  1111111111 122233


Q ss_pred             hccc-ccccEEEEEecC-------ccEEEEeCCCCcEEeCCCCCCCccccCCCeeeEEeCCEEEEEceecC----CcEEE
Q 012755          154 RQLG-MVEHWVYLACIL-------MPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGRELS----GFAIW  221 (457)
Q Consensus       154 ~~~~-~~~~~l~~~~~~-------~~~~~ydp~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~lyv~GG~~~----~~~v~  221 (457)
                      .... .....||++||.       +.+.+|||.++.|..+++||.+|..+.    ++++++.||++||.+.    .+.++
T Consensus       277 t~~r~~~~~~l~~vGG~~~~~~~~~~ve~yd~~~~~w~~~a~m~~~r~~~~----~~~~~~~lYv~GG~~~~~~~l~~ve  352 (571)
T KOG4441|consen  277 TRPRRSVSGKLVAVGGYNRQGQSLRSVECYDPKTNEWSSLAPMPSPRCRVG----VAVLNGKLYVVGGYDSGSDRLSSVE  352 (571)
T ss_pred             cccCcCCCCeEEEECCCCCCCcccceeEEecCCcCcEeecCCCCccccccc----EEEECCEEEEEccccCCCcccceEE
Confidence            3333 456788988873       568899999999999999999888554    5889999999999872    37899


Q ss_pred             EEECCCCcEEeCCCCCCCccceeEEeeCCEEEEEeeecCCCCccceEEEEeCCCCcEEECCCCCCCCcceeEEEECCEEE
Q 012755          222 MYSLIANCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFY  301 (457)
Q Consensus       222 ~yd~~t~~W~~l~~lp~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~iy  301 (457)
                      +|||.+++|+.+|+|+.+|..+++++++|.||++||+++. ..++++|+|||.+++|+.+++|+.+|..+++++++|+||
T Consensus       353 ~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~-~~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iY  431 (571)
T KOG4441|consen  353 RYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGE-KSLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLY  431 (571)
T ss_pred             EecCCCCceeccCCccCccccceeEEECCEEEEEeccccc-cccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEE
Confidence            9999999999999999999999999999999999999965 678999999999999999999999999999999999999


Q ss_pred             EEeccCCCCCCCceEEEEECCCCceEEcCCCCCCCCCCCCCCCCCCCCEEEEECCEEEEEecC-----CCeEEEEECCCC
Q 012755          302 IIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQA-----TNVVKKYNKTNN  376 (457)
Q Consensus       302 v~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~r~~~~~~~~~g~ly~~gg~-----~~~v~~Yd~~~~  376 (457)
                      ++||.++....++++++|||.+++|+.+++|+.          .|.++++++++++||++||.     ..+|+.|||+++
T Consensus       432 i~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~----------~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~  501 (571)
T KOG4441|consen  432 IIGGGDGSSNCLNSVECYDPETNTWTLIAPMNT----------RRSGFGVAVLNGKIYVVGGFDGTSALSSVERYDPETN  501 (571)
T ss_pred             EEcCcCCCccccceEEEEcCCCCceeecCCccc----------ccccceEEEECCEEEEECCccCCCccceEEEEcCCCC
Confidence            999998876678999999999999999999998          89999999999999999984     346999999999


Q ss_pred             cEEEeccCCCccCCCCcceEEEEEeCCEEEEEcCcCCCCCceEEEEEeeCCCCCCCCCCeeEeccccccCceEEeeeee
Q 012755          377 SWTVVKRLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYNCAVM  455 (457)
Q Consensus       377 ~W~~v~~~p~~~~~~~~~~~~~~~~~g~lyv~GG~~~~~~~~~~v~~y~~~~~~w~~~~W~~l~~~~~~~~~~~~~~~~  455 (457)
                      +|+.+++|+.++.     ++++++.+++||++||.++.. ..+.++.|||++|     +|+.++. +.......+|+++
T Consensus       502 ~W~~v~~m~~~rs-----~~g~~~~~~~ly~vGG~~~~~-~l~~ve~ydp~~d-----~W~~~~~-~~~~~~~~~~~~~  568 (571)
T KOG4441|consen  502 QWTMVAPMTSPRS-----AVGVVVLGGKLYAVGGFDGNN-NLNTVECYDPETD-----TWTEVTE-PESGRGGAGVAVI  568 (571)
T ss_pred             ceeEcccCccccc-----cccEEEECCEEEEEecccCcc-ccceeEEcCCCCC-----ceeeCCC-ccccccCcceEEe
Confidence            9999998988764     245678999999999987654 6789999999999     8999988 5566666666554

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query457
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-07
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 2e-06
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 2e-06
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 4e-06
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 4e-06
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 4e-06
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 6e-05
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-04
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-04
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 6e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 79/193 (40%), Gaps = 22/193 (11%)
Query: 173 EAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFG-----RELSGFAIWMYSLIA 227
           E +DP  Q W  LP +     + +    S+++  ++ V G       LS      Y+   
Sbjct: 34  EKYDPKTQEWSFLPSITRKRRYVA----SVSLHDRIYVIGGYDGRSRLSSVECLDYTADE 89
Query: 228 N-CWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNL 286
           +  W     MN+ R L G+++LG++  V+GG D +     S E Y+  +  W  L DM  
Sbjct: 90  DGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGS-RRHTSMERYDPNIDQWSMLGDMQT 148
Query: 287 PRKLCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMS 346
            R+        G  Y +GG     + L   E+Y+  T  W  +  M     G        
Sbjct: 149 AREGAGLVVASGVIYCLGGYDG-LNILNSVEKYDPHTGHWTNVTPMATKRSGAG------ 201
Query: 347 SPPLVAVVNNQLY 359
               VA++N+ +Y
Sbjct: 202 ----VALLNDHIY 210
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query457
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-36
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-28
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-14
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-25
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-14
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-33
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 6e-31
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-33
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-23
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 5e-22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-31
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-29
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-21
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 8e-09
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-31
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 9e-24
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-22
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-10
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 1e-07
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-17
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-11
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-10
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 5e-12
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-09
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-07
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 8e-04
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
 Score =  133 bits (337), Expect = 7e-36
 Identities = 56/248 (22%), Positives = 87/248 (35%), Gaps = 27/248 (10%)

Query: 173 EAFDPLRQRWMRLPRMQ---CDECFTSADKESLAVGTQLLVFGRELSGFAIWMYSLIANC 229
           EA++P    W+RL  +Q                AVG +           A+  Y+ + N 
Sbjct: 42  EAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQ 101

Query: 230 WSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRK 289
           WS C  M++PR   G   +       GG+        S E Y  E   W  +  M   R 
Sbjct: 102 WSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIH-HNSVERYEPERDEWHLVAPMLTRRI 160

Query: 290 LCSGFFMDGKFYIIGGMSSPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPP 349
                 ++   Y +GG    T+ L   E Y  E   W+ I  M     G           
Sbjct: 161 GVGVAVLNRLLYAVGGFDG-TNRLNSAECYYPERNEWRMITAMNTIRSGAG--------- 210

Query: 350 LVAVVNNQLY-----SADQATNVVKKYNKTNNSWTVVKRLPV-RANSFNGWGLAFKACGN 403
            V V++N +Y           N V++Y+    +WT V  +   R+      G+       
Sbjct: 211 -VCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSAL----GIT--VHQG 263

Query: 404 SLLVIGGH 411
            + V+GG+
Sbjct: 264 RIYVLGGY 271
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query457
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.98
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.85
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.81
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.39
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.34
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.26
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.25
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.24
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.19
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.0
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.92
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.83
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.67
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.62
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.58
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.51
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.49
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.48
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.44
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.42
3jrp_A379 Fusion protein of protein transport protein SEC13 97.37
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.35
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.26
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.23
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.22
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.21
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.19
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.18
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.13
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.09
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.08
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.07
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.07
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.05
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.0
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.0
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.97
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.94
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.91
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.9
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.9
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.89
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.89
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.86
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.86
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.83
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.8
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.76
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.75
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.72
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.72
3jro_A 753 Fusion protein of protein transport protein SEC13 96.69
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.67
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.64
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.6
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.59
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.58
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.55
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.53
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.53
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.5
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.48
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 96.46
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.46
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.45
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.44
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.43
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.43
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.42
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.42
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.41
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.37
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.33
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.27
3jro_A 753 Fusion protein of protein transport protein SEC13 96.25
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.23
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.22
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.21
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.2
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.2
2pm7_B297 Protein transport protein SEC13, protein transport 96.18
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.17
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.17
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.16
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.15
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.14
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.13
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.11
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.11
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.09
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.07
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.03
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.01
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.0
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.95
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.92
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.91
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 95.88
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.88
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.88
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.86
2pm7_B297 Protein transport protein SEC13, protein transport 95.83
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.82
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.81
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.76
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.76
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 95.71
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.71
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.69
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.65
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.65
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.57
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.55
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.55
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.47
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 95.47
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.39
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.35
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.33
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.3
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.3
3ott_A758 Two-component system sensor histidine kinase; beta 95.3
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.26
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.23
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.23
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.23
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.19
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.18
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.16
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.12
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.1
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.02
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.97
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.93
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.92
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.83
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.78
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.75
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.72
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.65
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.51
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.5
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.47
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.45
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.45
3v65_B386 Low-density lipoprotein receptor-related protein; 94.44
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.39
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.34
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.27
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.18
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.15
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 94.1
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.09
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 94.09
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.08
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.07
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.06
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 94.02
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.96
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 93.82
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.8
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.68
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.63
3p5b_L400 Low density lipoprotein receptor variant; B-propel 93.61
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.59
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.55
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 93.54
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.5
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.41
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 93.4
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.27
3v65_B386 Low-density lipoprotein receptor-related protein; 93.26
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 93.19
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 93.09
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 92.98
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 92.93
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.87
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 92.8
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.3
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.25
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.25
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 92.2
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 92.17
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 92.14
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 92.12
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.09
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 91.98
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 91.98
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.89
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 91.77
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 91.71
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 91.67
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 91.65
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 91.62
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.58
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 91.06
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 91.02
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.0
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 90.94
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 90.6
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 90.41
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 90.25
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 90.17
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 90.15
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 90.04
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 89.84
1itv_A195 MMP9; adaptive molecular recognition, beta propell 89.53
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 89.35
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 89.23
3ott_A 758 Two-component system sensor histidine kinase; beta 88.99
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 88.92
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 88.72
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 88.61
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 88.29
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 87.92
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 87.78
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 87.35
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 87.16
2xyi_A430 Probable histone-binding protein CAF1; transcripti 87.01
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 87.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 86.97
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 86.76
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 86.41
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.33
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 86.28
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 86.28
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 86.04
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 86.03
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 85.93
2ece_A 462 462AA long hypothetical selenium-binding protein; 85.93
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 85.84
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 85.29
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 85.28
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 85.2
1k32_A 1045 Tricorn protease; protein degradation, substrate g 85.02
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 85.0
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 84.91
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 84.88
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 84.5
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 84.29
2ymu_A577 WD-40 repeat protein; unknown function, two domain 83.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 83.79
1k32_A 1045 Tricorn protease; protein degradation, substrate g 83.76
2xyi_A430 Probable histone-binding protein CAF1; transcripti 83.63
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 83.48
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 83.03
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 82.75
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 81.69
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 81.19
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 80.55
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.1e-42  Score=333.54  Aligned_cols=267  Identities=15%  Similarity=0.245  Sum_probs=232.6

Q ss_pred             ccEEEEEec---CccEEEEeCCCCcEEeCCCCCCCccccCCCeeeEEeCCEEEEEceec--CCcEEEEEECCCCcEEeCC
Q 012755          160 EHWVYLACI---LMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGREL--SGFAIWMYSLIANCWSKCP  234 (457)
Q Consensus       160 ~~~l~~~~~---~~~~~~ydp~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~lyv~GG~~--~~~~v~~yd~~t~~W~~l~  234 (457)
                      .+.||++||   .+++++||+.+++|..++++|.+|..+.    ++++++.||++||..  ..+++++||+.+++|+.++
T Consensus        11 ~~~l~~~GG~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~----~~~~~~~lyv~GG~~~~~~~~~~~~d~~~~~W~~~~   86 (306)
T 3ii7_A           11 HDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAA----CVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKL   86 (306)
T ss_dssp             CCEEEEEECCSSTTSEEEEETTTTEEEECCCCSCCCBSCE----EEEETTEEEEECCBSSSBCCEEEEEETTTTEEEEEE
T ss_pred             cceEEEEeCCCCCceEEEecCCCCCEecCCCCCcccceeE----EEEECCEEEEEeCCCCCCcceEEEEeCCCCeEEECC
Confidence            467899887   6789999999999999999999887665    478899999999975  3478999999999999999


Q ss_pred             CCCCCccceeEEeeCCEEEEEeeecCCCCccceEEEEeCCCCcEEECCCCCCCCcceeEEEECCEEEEEeccCCCCCC--
Q 012755          235 QMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMSSPTDP--  312 (457)
Q Consensus       235 ~lp~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~iyv~GG~~~~~~~--  312 (457)
                      ++|.+|..|++++++++||++||.+......+++++||+.+++|+.++++|.+|..|++++++++||++||.......  
T Consensus        87 ~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~  166 (306)
T 3ii7_A           87 GPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGR  166 (306)
T ss_dssp             CCSSCCBSCEEEEETTEEEEECCBBTTBSCCCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCEESCTTTCE
T ss_pred             CCCccccceeEEEECCEEEEECCCCCCCcEeeeEEEEeCCCCceEeCCCCcCCcceeEEEEECCEEEEECCCCCCCCccc
Confidence            999999999999999999999999755567899999999999999999999999999999999999999998765432  


Q ss_pred             -CceEEEEECCCCceEEcCCCCCCCCCCCCCCCCCCCCEEEEECCEEEEEecC-----CCeEEEEECCCCcEEEeccCCC
Q 012755          313 -LTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQA-----TNVVKKYNKTNNSWTVVKRLPV  386 (457)
Q Consensus       313 -~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~r~~~~~~~~~g~ly~~gg~-----~~~v~~Yd~~~~~W~~v~~~p~  386 (457)
                       .+++++||+++++|+.+++++.          +|..+++++++++||++||.     .+++++||+++++|+.++.+|.
T Consensus       167 ~~~~~~~yd~~~~~W~~~~~~p~----------~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~  236 (306)
T 3ii7_A          167 VLNSCEVYDPATETWTELCPMIE----------ARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPW  236 (306)
T ss_dssp             ECCCEEEEETTTTEEEEECCCSS----------CCBSCEEEEETTEEEEECCEETTEEBCCEEEEETTTTEEEECCCCSC
T ss_pred             ccceEEEeCCCCCeEEECCCccc----------hhhcceEEEECCEEEEEeCCCCCCCCceEEEeeCCCCcEEECCCCCC
Confidence             7889999999999999998877          88999999999999999984     5689999999999999999987


Q ss_pred             ccCCCCcceEEEEEeCCEEEEEcCcCCCCCceEEEEEeeCCCCCCCCCCeeEeccccccCceEEe
Q 012755          387 RANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFVYN  451 (457)
Q Consensus       387 ~~~~~~~~~~~~~~~~g~lyv~GG~~~~~~~~~~v~~y~~~~~~w~~~~W~~l~~~~~~~~~~~~  451 (457)
                      ++.     +++++.++++|||+||.++.. ...++++||++++     +|+.++.++..+..+.+
T Consensus       237 ~r~-----~~~~~~~~~~i~v~GG~~~~~-~~~~~~~yd~~~~-----~W~~~~~~~~~r~~~~~  290 (306)
T 3ii7_A          237 KGV-----TVKCAAVGSIVYVLAGFQGVG-RLGHILEYNTETD-----KWVANSKVRAFPVTSCL  290 (306)
T ss_dssp             CBS-----CCEEEEETTEEEEEECBCSSS-BCCEEEEEETTTT-----EEEEEEEEECCSCTTCE
T ss_pred             Ccc-----ceeEEEECCEEEEEeCcCCCe-eeeeEEEEcCCCC-----eEEeCCCcccccceeEE
Confidence            764     234667899999999987543 5578999999998     89999876644443333
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 457
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 9e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 0.003
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 8e-06
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-04
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 0.001
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.8 bits (127), Expect = 1e-08
 Identities = 23/87 (26%), Positives = 35/87 (40%), Gaps = 2/87 (2%)

Query: 248 LGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMS 307
           +G +   AGG  +    L   E YN   GTW  L D+ +PR   +G  + G  Y +GG +
Sbjct: 3   VGRLIYTAGGYFRQS--LSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRN 60

Query: 308 SPTDPLTCGEEYNLETRTWKRIENMYP 334
           +  D  T     +       +     P
Sbjct: 61  NSPDGNTDSSALDCYNPMTNQWSPCAP 87
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query457
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.94
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.83
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.51
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.18
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.83
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.72
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.71
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.56
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.11
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.09
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.07
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.98
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.9
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.87
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.85
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.82
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.71
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.69
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.62
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.59
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.47
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.4
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.34
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.22
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.12
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 94.96
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.83
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.77
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.56
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.14
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.04
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.62
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.24
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 93.24
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.18
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 92.73
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 92.71
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 92.63
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.56
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.17
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.01
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.99
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.82
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.22
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.12
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.56
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 90.24
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.19
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.55
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 89.5
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 89.21
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 87.4
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 87.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 86.78
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 86.06
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 85.64
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 85.18
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 83.12
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 82.98
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 82.32
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.03
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-36  Score=288.72  Aligned_cols=263  Identities=25%  Similarity=0.412  Sum_probs=227.9

Q ss_pred             ccEEEEEec-----CccEEEEeCCCCcEEeCCCCCCCccccCCCeeeEEeCCEEEEEceec-------CCcEEEEEECCC
Q 012755          160 EHWVYLACI-----LMPWEAFDPLRQRWMRLPRMQCDECFTSADKESLAVGTQLLVFGREL-------SGFAIWMYSLIA  227 (457)
Q Consensus       160 ~~~l~~~~~-----~~~~~~ydp~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~lyv~GG~~-------~~~~v~~yd~~t  227 (457)
                      ...||++||     .+.+++||+.+++|.+++++|.+|..+.    +++++++||++||..       ..+++++||+.+
T Consensus         4 g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~R~~~~----~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~   79 (288)
T d1zgka1           4 GRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVPRSGLA----GCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMT   79 (288)
T ss_dssp             CCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSCCBSCE----EEEETTEEEEECCEEEETTEEEECCCEEEEETTT
T ss_pred             CCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCCccceeE----EEEECCEEEEEeCcccCCCCccccchhhhccccc
Confidence            456888877     5789999999999999999999887664    478899999999953       236899999999


Q ss_pred             CcEEeCCCCCCCccceeEEeeCCEEEEEeeecCCCCccceEEEEeCCCCcEEECCCCCCCCcceeEEEECCEEEEEeccC
Q 012755          228 NCWSKCPQMNLPRCLFGSSSLGEVAIVAGGTDKNGCILKSAELYNSELGTWETLPDMNLPRKLCSGFFMDGKFYIIGGMS  307 (457)
Q Consensus       228 ~~W~~l~~lp~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~iyv~GG~~  307 (457)
                      ++|+.+++||.+|..|+++++++++|++||..+. .....++.||+.++.|...+.++.+|..+++++.++++|++||..
T Consensus        80 ~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~  158 (288)
T d1zgka1          80 NQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFD  158 (288)
T ss_dssp             TEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBC
T ss_pred             ccccccccccceecceeccccceeeEEecceecc-cccceeeeeccccCccccccccccccccceeeeeeecceEecCcc
Confidence            9999999999999999999999999999998755 567889999999999999999999999999999999999999986


Q ss_pred             CCCCCCceEEEEECCCCceEEcCCCCCCCCCCCCCCCCCCCCEEEEECCEEEEEecC-----CCeEEEEECCCCcEEEec
Q 012755          308 SPTDPLTCGEEYNLETRTWKRIENMYPSNVGTQSNPAMSSPPLVAVVNNQLYSADQA-----TNVVKKYNKTNNSWTVVK  382 (457)
Q Consensus       308 ~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~r~~~~~~~~~g~ly~~gg~-----~~~v~~Yd~~~~~W~~v~  382 (457)
                      ... ....++.||+.+++|...+..+.          .+..+++++.+++||++||.     .++.+.||..+++|+.++
T Consensus       159 ~~~-~~~~~~~~d~~~~~~~~~~~~~~----------~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~  227 (288)
T d1zgka1         159 GTN-RLNSAECYYPERNEWRMITAMNT----------IRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA  227 (288)
T ss_dssp             SSC-BCCCEEEEETTTTEEEECCCCSS----------CCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECC
T ss_pred             ccc-ccceEEEeecccccccccccccc----------ccccccccceeeeEEEecCccccccccceeeeeecceeeeccc
Confidence            544 56789999999999999987766          67788999999999999873     568999999999999999


Q ss_pred             cCCCccCCCCcceEEEEEeCCEEEEEcCcCCCCCceEEEEEeeCCCCCCCCCCeeEeccccccCceE
Q 012755          383 RLPVRANSFNGWGLAFKACGNSLLVIGGHRELQGEIIVLHSWDPTDGNSGEAQWNELAVRERAGAFV  449 (457)
Q Consensus       383 ~~p~~~~~~~~~~~~~~~~~g~lyv~GG~~~~~~~~~~v~~y~~~~~~w~~~~W~~l~~~~~~~~~~  449 (457)
                      ++|.++.     +++++.++++|||+||.+.. ....++++||++++     +|++|+.+|..+..+
T Consensus       228 ~~p~~r~-----~~~~~~~~~~l~v~GG~~~~-~~~~~v~~yd~~~~-----~W~~~~~~p~~R~~~  283 (288)
T d1zgka1         228 PMKHRRS-----ALGITVHQGRIYVLGGYDGH-TFLDSVECYDPDTD-----TWSEVTRMTSGRSGV  283 (288)
T ss_dssp             CCSSCCB-----SCEEEEETTEEEEECCBCSS-CBCCEEEEEETTTT-----EEEEEEECSSCCBSC
T ss_pred             CccCccc-----ceEEEEECCEEEEEecCCCC-eecceEEEEECCCC-----EEEECCCCCCCcEeE
Confidence            8887764     23466789999999998654 35678999999998     899999887665444
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure