Citrus Sinensis ID: 012836


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----
MTSYSTRMDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGTTSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRKRHTEHTMEP
cccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHccccHHHccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MTSYSTRMDRRLIAAALTGDVQTLQQLfvenplilhtpafasagnplhvasayghvDFVKEIIRLKPdfakevnqdgfspmhmasaNGQIDVVRGLMKFDQKlchlqgperktplhfaAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMkdkqgntalHLATWKRECQVVELLLShganasgglevnatnhsglTALDVLLsfpseagdrEIEEIFWSAGAMrmrdltlspirspephgqtsvdncisteanlrqpndLMEYfkfkkgrdspgetLSALLVVAVLVATTtfqfgvnppggvwqeyykpdrkngttsgkaysagqsilgstdpvgfGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRkrhtehtmep
mtsystrmDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLqgperktplhfAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLhlavknnqfevVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTtfqfgvnppggvwQEYYKPDRKNGTTSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRKrhtehtmep
MTSYSTRMDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGEtlsallvvavlvatttFQFGVNPPGGVWQEYYKPDRKNGTTSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRKRHTEHTMEP
**********RLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMR*********************************LMEYFKFK*******ETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYK***************GQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLR*************
**S***RMDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVD*****************YF***KG*DS*GETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGTT**KAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRKR*T******
********DRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGTTSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQH***********
*****TRMDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKP******TSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRKRH*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSYSTRMDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGTTSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLRQHRKRHTEHTMEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query455 2.2.26 [Sep-21-2011]
Q9ZU96532 Ankyrin repeat-containing no no 0.826 0.706 0.259 6e-27
Q9C7A2590 Ankyrin repeat-containing no no 0.687 0.530 0.280 6e-22
Q8VHK1 1201 Caskin-2 OS=Mus musculus yes no 0.430 0.163 0.321 2e-15
Q8WXE0 1202 Caskin-2 OS=Homo sapiens yes no 0.430 0.163 0.316 2e-15
Q6AWW5524 Ankyrin repeat-containing no no 0.670 0.582 0.243 4e-15
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.428 0.103 0.303 2e-14
A5PMU4 1280 Ankyrin repeat and steril yes no 0.382 0.135 0.323 4e-14
Q6DD51 1205 Caskin-2 OS=Xenopus laevi N/A no 0.432 0.163 0.295 4e-14
Q9ERK0786 Receptor-interacting seri no no 0.351 0.203 0.312 8e-14
Q02357 1862 Ankyrin-1 OS=Mus musculus no no 0.389 0.095 0.317 8e-14
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function desciption
 Score =  122 bits (306), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 110/424 (25%), Positives = 186/424 (43%), Gaps = 48/424 (11%)

Query: 45  NPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLC 104
           N  HVA+  GH+  VKE++RL P+  +  +    SP++ A+    +++V  ++  D    
Sbjct: 96  NAFHVAAKRGHLGIVKELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCA 155

Query: 105 HLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRAL 164
            +     KT LH A   G + +V  ++            + +T LH+AVK    EVV  +
Sbjct: 156 MIVRKNGKTSLHTAGRYGLLRIVKALIEKDAAIVGVKDKKGQTALHMAVKGRSLEVVEEI 215

Query: 165 VDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGL 224
           +          ILN +D++GNTALH+AT K   Q+  LLL+  A     +EVNA N+   
Sbjct: 216 LQ-----ADYTILNERDRKGNTALHIATRKARPQITSLLLTFTA-----IEVNAINNQKE 265

Query: 225 TALDVLLSFPSEAGDREIEEIFWSAGAMRMR-----DLTLSPIRSPEPHGQTSVDNCIST 279
           TA+D+           EI E    AGA   R     D   +  R+            +  
Sbjct: 266 TAMDLADKLQYSESALEINEALVEAGAKHGRFIGREDEARALKRAVSDIKHEVQSQLLQN 325

Query: 280 EANLRQPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPD 339
           E   R+ + + +  + K  R++   T +++ VVAVL A+  F    N PG  + E     
Sbjct: 326 EKTNRRVSGIAKELR-KLHREAVQNTTNSITVVAVLFASIAFLAIFNLPGQYFTE----- 379

Query: 340 RKNGTTSGKAYSAGQSILGSTDPVGFGIFIFFN--SVGFSLSIEMIRILTTNFPLQLELQ 397
              G+  G+A  AG++        GF +F   N  S+  SL++ +++I    +  + + +
Sbjct: 380 ---GSHVGQANIAGRT--------GFRVFCLLNATSLFISLAVVVVQITLVAWDTRAQKK 428

Query: 398 L-------------CFFAMYVTYTNAVITIAPDGMSLFVTLTVA-IMPAVIALAAYLLRQ 443
           +             C F  ++    AV+      M++ +TL  A I+   +A   Y + +
Sbjct: 429 VVSVVNKLMWAACACTFGAFLAIAFAVVGKGNSWMAITITLLGAPILVGTLASMCYFVFR 488

Query: 444 HRKR 447
            R R
Sbjct: 489 QRFR 492





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 Back     alignment and function description
>sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query455
359490025450 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.967 0.977 0.555 1e-143
224114660448 predicted protein [Populus trichocarpa] 0.945 0.959 0.560 1e-140
147791225394 hypothetical protein VITISV_030400 [Viti 0.841 0.972 0.502 1e-117
297737379392 unnamed protein product [Vitis vinifera] 0.720 0.836 0.510 2e-94
387169570435 hypothetical protein 34G24.15 [Capsella 0.841 0.880 0.437 3e-91
255539939320 ankyrin repeat-containing protein, putat 0.668 0.95 0.544 3e-89
387169523411 hypothetical protein 11M19.23, partial [ 0.780 0.863 0.443 3e-89
15241393442 ankyrin repeat-containing protein [Arabi 0.802 0.825 0.440 2e-87
224136414459 predicted protein [Populus trichocarpa] 0.890 0.882 0.407 2e-80
359495749460 PREDICTED: uncharacterized protein LOC10 0.887 0.878 0.393 1e-73
>gi|359490025|ref|XP_003634016.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 246/443 (55%), Positives = 325/443 (73%), Gaps = 3/443 (0%)

Query: 8   MDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKP 67
           MDRRL+ AA  G+V+ L QL  ENPLILHT A ASA NPLH++S  GHVDFVKE+IRLKP
Sbjct: 1   MDRRLLDAAQAGNVEDLHQLLRENPLILHTTALASAENPLHISSISGHVDFVKELIRLKP 60

Query: 68  DFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVV 127
           DF KE+NQDGFSP+HMA+ANG  +VV  L+KFD K CHL+G + KTPLH AA+KG+V+VV
Sbjct: 61  DFIKELNQDGFSPIHMAAANGHQEVVMELLKFDWKXCHLEGRDEKTPLHCAAMKGKVNVV 120

Query: 128 SEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTA 187
             +LSA  EC EDV+VQ+E  LHLAVKN+Q+E VR LV+ +R++++E++LNMKD+ GNT 
Sbjct: 121 RVILSACKECIEDVTVQKEIALHLAVKNSQYEAVRVLVEKVREMRREDVLNMKDEHGNTI 180

Query: 188 LHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFW 247
           LHLATW+++ Q   LL       SG  EVN  N+SGLTALDVLL FPSEAGDREI+EI  
Sbjct: 181 LHLATWRKQRQAKFLLGDATIPGSGVTEVNLMNNSGLTALDVLLIFPSEAGDREIKEILH 240

Query: 248 SAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRDSPGETLS 307
           SAGA R +D+   P  +        +++  + E    QPN+L+ YF+F +GRDSPGE  S
Sbjct: 241 SAGAKRAQDIAFPPFGT---QNHARLNSTTTVETCPMQPNNLVNYFRFHRGRDSPGEARS 297

Query: 308 ALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGTTSGKAYSAGQSILGSTDPVGFGI 367
           ALLV+AVLVAT T+Q G++PPGGVWQ+    ++ N T + KA+ AGQSI  S   + FGI
Sbjct: 298 ALLVIAVLVATATYQVGLSPPGGVWQDNSGTNQSNSTATNKAHFAGQSIFSSLGIISFGI 357

Query: 368 FIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIAPDGMSLFVTLTV 427
           F+ FNS+GFS+S+ MI ILT+ FP++ ELQ+C  AM+ TY  A+ITI+PD + +F+ +  
Sbjct: 358 FVLFNSIGFSVSLYMISILTSKFPMRFELQICLLAMFFTYNTAIITISPDNLKIFLIVLT 417

Query: 428 AIMPAVIALAAYLLRQHRKRHTE 450
           +I+P  + L A  +R++ K+ T+
Sbjct: 418 SILPLTVCLVAKWVREYVKKITK 440




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224114660|ref|XP_002332335.1| predicted protein [Populus trichocarpa] gi|222832582|gb|EEE71059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147791225|emb|CAN70132.1| hypothetical protein VITISV_030400 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737379|emb|CBI26580.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|387169570|gb|AFJ66229.1| hypothetical protein 34G24.15 [Capsella rubella] Back     alignment and taxonomy information
>gi|255539939|ref|XP_002511034.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223550149|gb|EEF51636.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|387169523|gb|AFJ66184.1| hypothetical protein 11M19.23, partial [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|15241393|ref|NP_199929.1| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|8843852|dbj|BAA97378.1| unnamed protein product [Arabidopsis thaliana] gi|45825143|gb|AAS77479.1| At5g51160 [Arabidopsis thaliana] gi|51968476|dbj|BAD42930.1| putative protein [Arabidopsis thaliana] gi|62319991|dbj|BAD94109.1| putative protein [Arabidopsis thaliana] gi|332008662|gb|AED96045.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224136414|ref|XP_002326854.1| predicted protein [Populus trichocarpa] gi|222835169|gb|EEE73604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495749|ref|XP_003635081.1| PREDICTED: uncharacterized protein LOC100852638 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query455
TAIR|locus:2176252442 AT5G51160 "AT5G51160" [Arabido 0.802 0.825 0.411 2.4e-76
TAIR|locus:2132711445 AT4G10720 "AT4G10720" [Arabido 0.556 0.568 0.361 2e-41
TAIR|locus:2180882457 AT5G15500 [Arabidopsis thalian 0.520 0.518 0.347 1.1e-38
TAIR|locus:2012532441 AT1G14480 "AT1G14480" [Arabido 0.670 0.691 0.324 4.3e-38
TAIR|locus:2012557436 AT1G14500 "AT1G14500" [Arabido 0.538 0.561 0.359 7.3e-38
TAIR|locus:2172089426 ANK "ankyrin" [Arabidopsis tha 0.520 0.556 0.365 1.7e-36
TAIR|locus:2172099431 AT5G54620 [Arabidopsis thalian 0.479 0.505 0.363 6.3e-35
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.567 0.411 0.294 6.6e-20
TAIR|locus:2065434532 AT2G01680 "AT2G01680" [Arabido 0.441 0.377 0.317 9.3e-20
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.916 0.629 0.252 9.7e-20
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 769 (275.8 bits), Expect = 2.4e-76, P = 2.4e-76
 Identities = 155/377 (41%), Positives = 237/377 (62%)

Query:    61 EIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAI 120
             +I+R +  F  +++++GFSP+H A+A GQ++ VR  +  ++KLC L+  + KTPLH A +
Sbjct:    33 KILRQRSVF--DLDKNGFSPLHAAAAAGQVETVRATLGVEKKLCRLKDRDGKTPLHVATM 90

Query:   121 KGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMK 180
             +G++DV+ E++++  +C ED +VQ +T LHLAV + + E V A+V+ I +  + ++LN K
Sbjct:    91 RGKIDVIREIVASCVDCLEDETVQGQTALHLAVLHLEIEAVIAIVELITETNRFDVLNKK 150

Query:   181 DKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDR 240
             D+QGNTALHLATW++  QV+E+L+      S   EVNA N  GL+A+D+L+ FPSEAGDR
Sbjct:   151 DEQGNTALHLATWRKNRQVIEVLVQAIPEESRSFEVNAMNKMGLSAMDLLVMFPSEAGDR 210

Query:   241 EIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQPNDLMEYFKFKKGRD 300
             EI E    AGA R RD+  + +        TS   C       +   +L++YF FKK RD
Sbjct:   211 EIYEKLIEAGAQRGRDIGTTNVERT-----TSTSTCQERTMKSQSHKELVKYFTFKKHRD 265

Query:   301 SPGEXXXXXXXXXXXXXXXXFQFGVNPPGGVWQEYYKP----DRKN-GTTSGKAYSAGQS 355
             SP E                FQ  + PPGG WQ+   P    +  N  TT+ +A++AGQS
Sbjct:   266 SPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVSQNTTNVNTTNQQAHTAGQS 325

Query:   356 ILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMYVTYTNAVITIA 415
             I+G+ + V F +F+FFN++GFS+S+ M+ ILT  FPL+ +LQ+C  AMY ++   + +IA
Sbjct:   326 IMGTFNGVAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMIAMYFSHNTTMASIA 385

Query:   416 PDGMSLFVTLTVAIMPA 432
             PD + L+  L  +I+ A
Sbjct:   386 PDHVKLYCILITSILAA 402


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006826 "iron ion transport" evidence=RCA
GO:0010043 "response to zinc ion" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180882 AT5G15500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012532 AT1G14480 "AT1G14480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012557 AT1G14500 "AT1G14500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065434 AT2G01680 "AT2G01680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.02320016
hypothetical protein (448 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-18
pfam13962114 pfam13962, PGG, Domain of unknown function 9e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-12
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-10
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 98.6 bits (246), Expect = 8e-25
 Identities = 45/133 (33%), Positives = 74/133 (55%), Gaps = 8/133 (6%)

Query: 72  EVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEML 131
             ++DG +P+H+A++NG ++VV+ L++    + + +  + +TPLH AA  G +++V ++L
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADV-NAKDNDGRTPLHLAAKNGHLEIV-KLL 59

Query: 132 SAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLA 191
              G           T LHLA +N   +VV+ L+    DV      N +DK G T LHLA
Sbjct: 60  LEKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADV------NARDKDGRTPLHLA 113

Query: 192 TWKRECQVVELLL 204
                 +VV+LLL
Sbjct: 114 AKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 455
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 99.98
PHA02876682 ankyrin repeat protein; Provisional 99.98
PHA02878477 ankyrin repeat protein; Provisional 99.98
PHA02989494 ankyrin repeat protein; Provisional 99.98
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02989494 ankyrin repeat protein; Provisional 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.94
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PHA02730672 ankyrin-like protein; Provisional 99.93
PHA02792631 ankyrin-like protein; Provisional 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PHA02730 672 ankyrin-like protein; Provisional 99.93
PF13962113 PGG: Domain of unknown function 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
PHA02792631 ankyrin-like protein; Provisional 99.9
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.82
KOG0514452 consensus Ankyrin repeat protein [General function 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.79
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.77
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.77
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.72
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.71
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.54
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.41
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.39
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.37
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.35
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.33
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.31
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.29
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.92
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.85
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.8
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.65
PF1360630 Ank_3: Ankyrin repeat 98.57
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.56
KOG0522560 consensus Ankyrin repeat protein [General function 98.56
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.56
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.55
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.5
KOG0522 560 consensus Ankyrin repeat protein [General function 98.49
PF1360630 Ank_3: Ankyrin repeat 98.43
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.41
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.37
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.29
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.22
KOG0520975 consensus Uncharacterized conserved protein, conta 98.11
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.11
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.09
KOG0520975 consensus Uncharacterized conserved protein, conta 98.01
KOG0511516 consensus Ankyrin repeat protein [General function 97.91
KOG0511 516 consensus Ankyrin repeat protein [General function 97.88
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.76
KOG2384223 consensus Major histocompatibility complex protein 97.63
KOG2384223 consensus Major histocompatibility complex protein 97.59
KOG2505591 consensus Ankyrin repeat protein [General function 96.8
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.25
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.17
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.52
KOG2505591 consensus Ankyrin repeat protein [General function 94.46
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.0
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.42
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.34
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.32
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.17
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.3e-38  Score=260.37  Aligned_cols=209  Identities=26%  Similarity=0.363  Sum_probs=192.6

Q ss_pred             cCHHHHHHHHcCCHHHHHHHHhcCCcccCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCcchhhhcCCCCcHHHHHHHc
Q 012836            8 MDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASAN   87 (455)
Q Consensus         8 ~~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~Aa~~   87 (455)
                      +.++.+.+++......++.++++.+..+....+.+|+||||+||..|+.+++++|++.....++..|+.||||||.||..
T Consensus         3 ~~~~~~~~~~~~~~~kveel~~s~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~   82 (226)
T KOG4412|consen    3 YASLGKAICENCEEFKVEELIQSDPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASN   82 (226)
T ss_pred             ccchHHHHHhhchHHHHHHHHhcChhhhhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhc
Confidence            34678889999999999999999997777776667999999999999999999999755444677799999999999999


Q ss_pred             CCHHHHHHHHhc-CccccccCCCCCCCHHHHHHHhCCHHHHHHHHHhcCccccccccCCCcHHHHHHHcCCHHHHHHHHH
Q 012836           88 GQIDVVRGLMKF-DQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVD  166 (455)
Q Consensus        88 g~~~iv~~Ll~~-~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~  166 (455)
                      |+.++|+.|+.+ ++++ +..++.|.||||+|+..|+.+++++|+++ |+.++.+|..|.||||-|+.-|..+++++|+.
T Consensus        83 g~~evVk~Ll~r~~adv-na~tn~G~T~LHyAagK~r~eIaqlLle~-ga~i~~kD~~~qtplHRAAavGklkvie~Li~  160 (226)
T KOG4412|consen   83 GNDEVVKELLNRSGADV-NATTNGGQTCLHYAAGKGRLEIAQLLLEK-GALIRIKDKQGQTPLHRAAAVGKLKVIEYLIS  160 (226)
T ss_pred             CcHHHHHHHhcCCCCCc-ceecCCCcceehhhhcCChhhHHHHHHhc-CCCCcccccccCchhHHHHhccchhhHHHHHh
Confidence            999999999999 7777 88999999999999999999999999998 89999999999999999999999999999999


Q ss_pred             HhhhhcccccccccCCCCCcHHHHHHhcCChHHHHHHHhcCCCCCCCccccccCCCCCCHHHHHh
Q 012836          167 WIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLL  231 (455)
Q Consensus       167 ~g~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~ga~~~~~v~~~~~n~~g~t~l~~a~  231 (455)
                      .|+..      |..|..|+||||.|...|+.++..+|+++|+      +++..|++| ||+.++.
T Consensus       161 ~~a~~------n~qDk~G~TpL~~al~e~~~d~a~lLV~~gA------d~~~edke~-t~~~~a~  212 (226)
T KOG4412|consen  161 QGAPL------NTQDKYGFTPLHHALAEGHPDVAVLLVRAGA------DTDREDKEG-TALRIAC  212 (226)
T ss_pred             cCCCC------CcccccCccHHHHHHhccCchHHHHHHHhcc------ceeeccccC-chHHHHH
Confidence            88776      9999999999999988899999999999999      899999998 9998873



>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-16
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-14
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-11
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-10
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-10
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-10
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-10
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-10
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
1uoh_A226 Human Gankyrin Length = 226 1e-09
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 7e-09
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-09
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 8e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 9e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 9e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-07
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-06
3uxg_A172 Crystal Structure Of Rfxank Length = 172 6e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 9e-07
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-06
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-06
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 5e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 5e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 8e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-04
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-04
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 4e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 4e-04
2b0o_E301 Crystal Structure Of Uplc1 Gap Domain Length = 301 4e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 5e-04
3lvq_E497 The Crystal Structure Of Asap3 In Complex With Arf6 9e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 82.4 bits (202), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 65/214 (30%), Positives = 105/214 (49%), Gaps = 19/214 (8%) Query: 39 AFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMK 98 A + PLH+A+ GHV+ V ++ + A + + GF+P+H+A+ G++ V L++ Sbjct: 109 ATTAGHTPLHIAAREGHVETVLALLEKEASQAC-MTKKGFTPLHVAAKYGKVRVAELLLE 167 Query: 99 FDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQF 158 D + G TPLH A +D+V ++L G + T LH+A K NQ Sbjct: 168 RDAH-PNAAGKNGLTPLHVAVHHNNLDIV-KLLLPRGGSPHSPAWNGYTPLHIAAKQNQV 225 Query: 159 EVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNA 218 EV R+L+ + E++ QG T LHLA + ++V LLLS AN + G Sbjct: 226 EVARSLLQYGGSANAESV------QGVTPLHLAAQEGHAEMVALLLSKQANGNLG----- 274 Query: 219 TNHSGLTALDVLLSFPSEAGDREIEEIFWSAGAM 252 N SGLT L ++ ++ G + ++ G M Sbjct: 275 -NKSGLTPLHLV----AQEGHVPVADVLIKHGVM 303
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-37
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-28
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-36
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-29
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-36
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-36
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-35
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-31
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-26
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-36
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-36
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-31
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-29
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-34
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-35
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-35
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-31
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-29
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-35
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-32
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-34
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-33
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-34
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-32
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-30
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-33
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-32
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-33
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-31
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-33
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-23
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-33
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-25
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-25
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-32
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-32
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-32
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-27
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-25
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-32
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-30
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-30
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-25
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-31
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-31
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-29
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-27
2rfa_A232 Transient receptor potential cation channel subfa 4e-31
2rfa_A232 Transient receptor potential cation channel subfa 8e-31
2rfa_A232 Transient receptor potential cation channel subfa 4e-23
2rfa_A232 Transient receptor potential cation channel subfa 4e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-30
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-30
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-25
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-30
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-23
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-27
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-25
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-30
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-30
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-26
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-05
2etb_A256 Transient receptor potential cation channel subfam 2e-29
2etb_A256 Transient receptor potential cation channel subfam 9e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-29
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-29
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-25
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-25
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-24
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-24
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-25
2pnn_A273 Transient receptor potential cation channel subfa 3e-25
2pnn_A273 Transient receptor potential cation channel subfa 5e-18
2pnn_A273 Transient receptor potential cation channel subfa 3e-16
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-24
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-24
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-17
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-24
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-21
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-18
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-04
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
 Score =  132 bits (335), Expect = 6e-37
 Identities = 42/190 (22%), Positives = 79/190 (41%), Gaps = 34/190 (17%)

Query: 46  PLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCH 105
            +H  +A G +D +KE +R   +   + ++ GF+P+  ASA G+I+ VR L++       
Sbjct: 5   SIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLE------- 57

Query: 106 LQG--PERK-----TPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRE---TVLHLAVKN 155
             G  P        + L  A+  G  D+V  +L        D+++      T L  AV+ 
Sbjct: 58  -WGADPHILAKERESALSLASTGGYTDIV-GLLLERD--V-DINIYDWNGGTPLLYAVRG 112

Query: 156 NQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLE 215
           N  + V AL+      +  ++   +   G T + LA      +V +++ +H         
Sbjct: 113 NHVKCVEALLA-----RGADL-TTEADSGYTPMDLAVALGYRKVQQVIENHILK------ 160

Query: 216 VNATNHSGLT 225
           +  +N     
Sbjct: 161 LFQSNLVPAD 170


>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query455
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.98
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.7
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
Probab=100.00  E-value=1.6e-39  Score=302.41  Aligned_cols=230  Identities=18%  Similarity=0.223  Sum_probs=180.4

Q ss_pred             cccCcccCHHHHHHHHcC-------------CHHHHHHHHhcCCcccCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCc
Q 012836            2 TSYSTRMDRRLIAAALTG-------------DVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPD   68 (455)
Q Consensus         2 t~~~~~~~t~L~~A~~~g-------------~~~~v~~Ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~   68 (455)
                      +..|..|.||||.|+..|             +.++++.|++.++......+ ..|.||||+|+..|+.+++++|++.+.+
T Consensus         4 n~~d~~g~tpL~~A~~~g~~~~~~~~~~~~~~~~~v~~Ll~~g~~~~~~~d-~~g~t~L~~A~~~g~~~~v~~Ll~~g~~   82 (253)
T 1yyh_A            4 NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTD-RTGETALHLAARYSRSDAAKRLLEASAD   82 (253)
T ss_dssp             ------------------------------------------------CCC-TTSCCHHHHHHHTTCHHHHHHHHHTTCC
T ss_pred             CCCCCCCCcHHHHHHhccccccccchhhcCCChHHHHHHHHccCCcccccC-CCCCcHHHHHHHcCCHHHHHHHHHcCCC
Confidence            457889999999999987             99999999999887655433 3599999999999999999999999988


Q ss_pred             chhhhcCCCCcHHHHHHHcCCHHHHHHHHhcCccccccCCCCCCCHHHHHHHhCCHHHHHHHHHhcCccccccccCCCcH
Q 012836           69 FAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETV  148 (455)
Q Consensus        69 ~~~~~~~~g~tpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~  148 (455)
                       .+..|..|+||||+|+..|+.+++++|++.++...+.++.+|.||||+|+..|+.+++++|++. +.+++..|..|+||
T Consensus        83 -~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~-g~~~~~~d~~g~t~  160 (253)
T 1yyh_A           83 -ANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINS-HADVNAVDDLGKSA  160 (253)
T ss_dssp             -TTCCCTTSCCHHHHHHHHTCHHHHHHHHHSTTSCTTCCCTTCCCHHHHHHHHTCSSHHHHHHHT-TCCTTCBCTTSCBH
T ss_pred             -CCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCCcHHHHHHHcChHHHHHHHHHc-CCCCCCcCCCCCCH
Confidence             5777999999999999999999999999999855588999999999999999999999999997 88999999999999


Q ss_pred             HHHHHHcCCHHHHHHHHHHhhhhcccccccccCCCCCcHHHHHHhcCChHHHHHHHhcCCCCCCCccccccCCCCCCHHH
Q 012836          149 LHLAVKNNQFEVVRALVDWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALD  228 (455)
Q Consensus       149 Lh~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~ga~~~~~v~~~~~n~~g~t~l~  228 (455)
                      ||+|+..|+.+++++|+++|+++      +.+|..|+||||+|+..|+.+++++|+++|+      +++.+|..|+||+|
T Consensus       161 L~~A~~~~~~~~v~~Ll~~ga~~------~~~~~~g~tpL~~A~~~~~~~~v~~Ll~~ga------~~~~~d~~g~tpl~  228 (253)
T 1yyh_A          161 LHWAAAVNNVDAAVVLLKNGANK------DMQNNREETPLFLAAREGSYETAKVLLDHFA------NRDITDHMDRLPRD  228 (253)
T ss_dssp             HHHHHHHTCHHHHHHHHHTTCCT------TCCCTTSCCHHHHHHHHTCHHHHHHHHHTTC------CTTCCCTTCCCHHH
T ss_pred             HHHHHHcCCHHHHHHHHHcCCCC------CCcCCCCCCHHHHHHHCCCHHHHHHHHHcCC------CccccccCCCCHHH
Confidence            99999999999999999999887      8999999999999999999999999999999      89999999999999


Q ss_pred             HHhhCCCCcCchhHHHHHHHhc
Q 012836          229 VLLSFPSEAGDREIEEIFWSAG  250 (455)
Q Consensus       229 ~a~~~~~~~~~~~i~~~L~~~g  250 (455)
                      +|..    .++.+|+++|.+..
T Consensus       229 ~A~~----~g~~~i~~~l~~~~  246 (253)
T 1yyh_A          229 IAQE----RMHHDIVRLLDLEH  246 (253)
T ss_dssp             HHHH----TTCHHHHHHHHC--
T ss_pred             HHHH----cCCHHHHHHHHHHh
Confidence            9974    58999999998643



>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 455
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-22
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-18
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-16
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-16
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-15
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-12
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-05
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  100 bits (249), Expect = 1e-23
 Identities = 60/260 (23%), Positives = 104/260 (40%), Gaps = 29/260 (11%)

Query: 46  PLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASANGQIDVVRGLMKFDQKLCH 105
           PLHVAS  GH+  VK +++         N    +P+HMA+  G  +V + L++   K+ +
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV-N 60

Query: 106 LQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALV 165
            +  + +TPLH AA  G  ++V  +L          +     +   A + +         
Sbjct: 61  AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVE------- 113

Query: 166 DWIRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLT 225
             +  ++KE       K+G T LH+A    + +V ELLL   A+       NA   +GLT
Sbjct: 114 TVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH------PNAAGKNGLT 167

Query: 226 ALDVLLSFPSEAGDREIEEIFWSAGAMRMRDLTLSPIRSPEPHGQTSVDNCISTEANLRQ 285
            L V         + +I ++    G             SP  +G T + +  + +  +  
Sbjct: 168 PLHVA----VHHNNLDIVKLLLPRGGS---------PHSPAWNGYTPL-HIAAKQNQVEV 213

Query: 286 PNDLMEYFKFKKGRDSPGET 305
              L++Y          G T
Sbjct: 214 ARSLLQYGGSANAESVQGVT 233


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query455
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-36  Score=274.70  Aligned_cols=220  Identities=24%  Similarity=0.397  Sum_probs=201.9

Q ss_pred             cCHHHHHHHHcCCHHHHHHHHhcCCcccCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCcchhhhcCCCCcHHHHHHHc
Q 012836            8 MDRRLIAAALTGDVQTLQQLFVENPLILHTPAFASAGNPLHVASAYGHVDFVKEIIRLKPDFAKEVNQDGFSPMHMASAN   87 (455)
Q Consensus         8 ~~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~Aa~~   87 (455)
                      .++.|+.+|++|+.+.++.+++.++......+ ..|+||||+|+..|+.+++++|++..... ...+..+.++++.|+..
T Consensus         3 ~~~~~~~~a~~G~~~~v~~~l~~~~~~~~~~D-~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~   80 (223)
T d1uoha_           3 SNLMVCNLAYSGKLEELKESILADKSLATRTD-QDSRTALHWACSAGHTEIVEFLLQLGVPV-NDKDDAGWSPLHIAASA   80 (223)
T ss_dssp             SSSHHHHHHHTTCHHHHHHHHHHCGGGGGCCC-TTSCCHHHHHHHHTCHHHHHHHHHHTCCS-CCCCTTCCCHHHHHHHH
T ss_pred             CHHHHHHHHHhCCHHHHHHHHHhCCCcCcCcC-CCCCCHHHHHHHhhhhccccccccccccc-ccccccccccccccccc
Confidence            46789999999999999999998887766554 35999999999999999999999998763 45577889999999999


Q ss_pred             CCHHHHHHHHhcCccccccCCCCCCCHHHHHHHhCCHHHHHHHHHhcCccccccccCCCcHHHHHHHcCCHHHHHHHHHH
Q 012836           88 GQIDVVRGLMKFDQKLCHLQGPERKTPLHFAAIKGRVDVVSEMLSAYGECAEDVSVQRETVLHLAVKNNQFEVVRALVDW  167 (455)
Q Consensus        88 g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~~  167 (455)
                      |+.+++++|++++.++ +.+|.+|.||||+|+..|+.++++.|+++ |.+++..+.+|.||||+|+..++.+++++|.+.
T Consensus        81 ~~~~i~~~Ll~~~~d~-~~~d~~g~tpL~~A~~~~~~e~~~~Ll~~-g~d~~~~~~~~~t~L~~a~~~~~~~~~~~L~~~  158 (223)
T d1uoha_          81 GRDEIVKALLGKGAQV-NAVNQNGCTPLHYAASKNRHEIAVMLLEG-GANPDAKDHYEATAMHRAAAKGNLKMIHILLYY  158 (223)
T ss_dssp             TCHHHHHHHHHTTCCT-TCCCTTCCCHHHHHHHHTCHHHHHHHHHT-TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             cccchhHHHhccCcee-EeeCCCCCchhhHHHHcCCHHHHHHHHHC-CCCCCCcCCCCCccchhhhhcCCcchhhhhccc
Confidence            9999999999999987 88999999999999999999999999987 889999999999999999999999999999998


Q ss_pred             hhhhcccccccccCCCCCcHHHHHHhcCChHHHHHHHhcCCCCCCCccccccCCCCCCHHHHHhhCCCCcCchhHHHHHH
Q 012836          168 IRDVKKENILNMKDKQGNTALHLATWKRECQVVELLLSHGANASGGLEVNATNHSGLTALDVLLSFPSEAGDREIEEIFW  247 (455)
Q Consensus       168 g~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~ga~~~~~v~~~~~n~~g~t~l~~a~~~~~~~~~~~i~~~L~  247 (455)
                      +.++      +.+|.+|+||||+|+..|+.+++++|+++|+      +++.+|..|+||||+|     ..+..++++.|+
T Consensus       159 ~~~i------~~~d~~g~TpL~~Aa~~g~~~~v~~LL~~Ga------d~~~~d~~g~tpl~~A-----~~~~~~i~~~Ll  221 (223)
T d1uoha_         159 KAST------NIQDTEGNTPLHLACDEERVEEAKLLVSQGA------SIYIENKEEKTPLQVA-----KGGLGLILKRMV  221 (223)
T ss_dssp             TCCS------CCCCTTCCCHHHHHHHTTCHHHHHHHHHTTC------CSCCCCTTSCCHHHHC-----CTTHHHHHHHHH
T ss_pred             ccee------eeccCCCCceeccccccCcHHHHHHHHHCCC------CCCCCCCCCCCHHHHH-----HCCCHHHHhccc
Confidence            8776      8999999999999999999999999999999      8999999999999998     347888998887


Q ss_pred             H
Q 012836          248 S  248 (455)
Q Consensus       248 ~  248 (455)
                      +
T Consensus       222 ~  222 (223)
T d1uoha_         222 E  222 (223)
T ss_dssp             C
T ss_pred             C
Confidence            5



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure