Citrus Sinensis ID: 012877

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKRKRGGLGDDDDEEDEDNASDKDEESMERGRRKKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLNSMHS
ccccccccHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHccccEEEcccccccccccccccEEEEEcccccccHHcccccccccccccccEEEEEcccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcHHHHHHHcccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHccc
ccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEHHHccHHHHHHHHHHHHHHHHcccEEEEEHHHHccccccccccEEEEEcccccHHHEEEEccccEcccccccEEEEEcccHHHHHHHHHHccccccEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHcccccccccEEEccccccccccccccccccccccccccHHHHccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccccccccHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEcccccccccHHHHHHHHHHHHHHccc
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKklrpgiplmclygrmKQDRRMAIYAQFCEKRSVLFCTDVasrgldfnkaVDWVVQvdcpedvaSYIHRVGrtarynsggrsvlflTPTEMKMLEKLREAkipihftkantkrlqPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIqkdkevfdVTKLSIDEFsaslglpmtpkirflnqkkgkmvpvkpvldnaeKEDKLMISRekllpdnfteenvdrdiletkdiedEGKADLLEDVMRATRVKKNkklkinvhrplgtrlvfdeecntvpplamladtknanvsldqdqKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKrkrgglgddddeedednasdkdeeSMERGRRKKAKiyfdsdsdndnderkqnkddngpnidsISLAEQEALALKLLNSMHS
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEafkklrpgiplMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHrvgrtarynsggrsvLFLTPTEMKMLEKLREAKIPIhftkantkrlqpVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEfsaslglpmtpkirflnqkkgkmvpvkpvldnaekeDKLMisrekllpdnfteenvdrdiletkdiedegkadlleDVMRatrvkknkklkinvhrplgtrlvfdEECNTVPPLamladtknanvsldqdqkteyYKKIReelkradkedklldrqrrrekrikqkmkrkrgglgddddeedednasdkdeesmergrrkkakiyfdsdsdndnderkqnkddngpnidSISLAEQEALALKLLNSMHS
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADkedklldrqrrrekrikqkmkrkrGGLGddddeedednasdkdeeSMERGRRKKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISlaeqealalkllNSMHS
******QKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQ***********************************************************VMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLAD**********************************************************************************************************************************
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPK*********************************************************************************************************************************************************************************************************************************ALAL*LLN****
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKR*************************************KKAKIYFDSD**************NGPNIDSISLAEQEALALKLLNSMHS
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQ******************************************************DLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKR******************************************************************DSISLAEQEALALKLLNS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYxxxxxxxxxxxxxxxxxxxxxRRREKRIKQKMKRKRGGLGDDDDEEDEDNASDKDEESMERGRRKKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLNSMHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query454 2.2.26 [Sep-21-2011]
Q9FFT9739 DEAD-box ATP-dependent RN yes no 0.960 0.589 0.547 1e-133
Q0D622773 DEAD-box ATP-dependent RN no no 0.947 0.556 0.451 1e-104
Q7RZ35823 ATP-dependent RNA helicas N/A no 0.812 0.448 0.365 8e-68
Q4WM60787 ATP-dependent RNA helicas yes no 0.484 0.279 0.542 1e-67
Q9UTP9735 ATP-dependent RNA helicas yes no 0.964 0.595 0.360 5e-67
Q1EB31806 ATP-dependent RNA helicas N/A no 0.922 0.519 0.367 5e-67
Q0CMM5804 ATP-dependent RNA helicas N/A no 0.484 0.273 0.520 1e-66
A1CTZ2823 ATP-dependent RNA helicas N/A no 0.484 0.267 0.529 2e-66
Q2UHB7796 ATP-dependent RNA helicas yes no 0.484 0.276 0.515 2e-66
A2QS00802 ATP-dependent RNA helicas yes no 0.484 0.274 0.511 3e-66
>sp|Q9FFT9|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1 Back     alignment and function desciption
 Score =  476 bits (1225), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 250/457 (54%), Positives = 341/457 (74%), Gaps = 21/457 (4%)

Query: 1   MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQD 60
           MIVP+E+KLDMLWSFIK HLNS+ILVFL++ KQVK+V EAF KLRPGIPL  L+G+M Q+
Sbjct: 296 MIVPVEKKLDMLWSFIKTHLNSRILVFLSTKKQVKFVHEAFNKLRPGIPLKSLHGKMSQE 355

Query: 61  RRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSG 120
           +RM +Y+QF E++SVLFCTDV +RGLDF+KAVDWVVQVDCPEDVASYIHRVGRTAR+ + 
Sbjct: 356 KRMGVYSQFIERQSVLFCTDVLARGLDFDKAVDWVVQVDCPEDVASYIHRVGRTARFYTQ 415

Query: 121 GRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAF 180
           G+S+LFLTP+E KM+EKL+EAK+PI   KAN ++LQ VS LLAALLVKYPD+Q  AQ+AF
Sbjct: 416 GKSLLFLTPSEEKMIEKLQEAKVPIKLIKANNQKLQEVSRLLAALLVKYPDLQGVAQRAF 475

Query: 181 ITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLN---QKKGKM-VPVKPVLD 236
           ITYLRS+H ++DKE+FDV+KLSI+ FSASLGLPMTP+IRF N   +KKG     +   ++
Sbjct: 476 ITYLRSIHKRRDKEIFDVSKLSIENFSASLGLPMTPRIRFTNLKTKKKGVYESSIAMEIE 535

Query: 237 NAEKEDKLMISREKLLPDNFTEENVD-RDILETKDIEDEGKADLLEDVMRATRVKKNKKL 295
           NA++ +  ++ ++ LL ++  EE+   +   E K +E   K +  E ++   RV KNKKL
Sbjct: 536 NAQEYEAPLVVKKDLLGEDLEEEDFALKPRKEGKVVEKSTKEE--EVLIPGNRVLKNKKL 593

Query: 296 KINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKED 355
           KIN+HRP G+R+V DEE N++ PLA +A      V+LD+++  +YYKK+  E+++AD ED
Sbjct: 594 KINLHRPFGSRVVLDEEGNSLAPLASVAAEAGTEVALDEERMNDYYKKVGAEMRKADIED 653

Query: 356 KLLDRQRRREKRIKQKMKRKRGGL--GDDDDEEDEDNASDKDEESMERGRRKKAKIYFDS 413
           K +D++RRREKR+KQK+KRKRG +   ++++EED D +   D+E+    +R K  +    
Sbjct: 654 KKVDKERRREKRMKQKIKRKRGAMEDEEEEEEEDHDGSGSSDDETGRNSKRAKKIV---- 709

Query: 414 DSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLN 450
            SDN+ +  K        N DS+S+A+ E +ALK + 
Sbjct: 710 -SDNEENGGK-------INTDSLSVADLEEMALKFIT 738

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0D622|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2 Back     alignment and function description
>sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 Back     alignment and function description
>sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 Back     alignment and function description
>sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 Back     alignment and function description
>sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 Back     alignment and function description
>sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 Back     alignment and function description
>sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 Back     alignment and function description
>sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query454
224126463 766 predicted protein [Populus trichocarpa] 0.986 0.584 0.689 1e-179
255563905 753 dead box ATP-dependent RNA helicase, put 0.984 0.593 0.680 1e-166
356501519 746 PREDICTED: DEAD-box ATP-dependent RNA he 0.986 0.600 0.655 1e-166
356553180 743 PREDICTED: DEAD-box ATP-dependent RNA he 0.980 0.598 0.642 1e-162
449515263 734 PREDICTED: DEAD-box ATP-dependent RNA he 0.938 0.580 0.624 1e-147
357494471 747 ATP-dependent RNA helicase DBP4 [Medicag 0.962 0.585 0.612 1e-146
449470439 734 PREDICTED: DEAD-box ATP-dependent RNA he 0.938 0.580 0.622 1e-146
225460999 750 PREDICTED: DEAD-box ATP-dependent RNA he 0.988 0.598 0.626 1e-144
297796361 741 hypothetical protein ARALYDRAFT_495573 [ 0.958 0.587 0.554 1e-135
15240418 739 DEAD-box ATP-dependent RNA helicase 32 [ 0.960 0.589 0.547 1e-131
>gi|224126463|ref|XP_002319844.1| predicted protein [Populus trichocarpa] gi|222858220|gb|EEE95767.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  635 bits (1639), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 331/480 (68%), Positives = 384/480 (80%), Gaps = 32/480 (6%)

Query: 1   MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQD 60
           MIVPLEQKLDMLWSF+KAHLNSKILVFL+SCKQVK+VFEAFKKLRPGIPL CL+GRMKQ+
Sbjct: 293 MIVPLEQKLDMLWSFVKAHLNSKILVFLSSCKQVKFVFEAFKKLRPGIPLKCLHGRMKQE 352

Query: 61  RRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSG 120
           +RM IY+QFCE  SVLF TDVASRGLDFNKAVDWVVQVDCP+DVASYIHRVGRTARY +G
Sbjct: 353 KRMGIYSQFCESHSVLFSTDVASRGLDFNKAVDWVVQVDCPDDVASYIHRVGRTARYLAG 412

Query: 121 GRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAF 180
           GRSVLFL P+EMKMLEKL+ AKIP+ F KANTKRLQPVSGLL+ALLVKYPDMQ  AQ+AF
Sbjct: 413 GRSVLFLMPSEMKMLEKLQTAKIPVQFIKANTKRLQPVSGLLSALLVKYPDMQQLAQRAF 472

Query: 181 ITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQK-KGKMVPVKPVL---D 236
           ITYLRS+HIQKDKEVFDV KLSI+EFSASLGLPMTPK+RFLNQK KGK    K  L   +
Sbjct: 473 ITYLRSIHIQKDKEVFDVLKLSIEEFSASLGLPMTPKVRFLNQKIKGKKAFGKSALLESE 532

Query: 237 NAEKEDKLMISREKLLPDNF-----------------TEENVDRDILETKDI--EDEGKA 277
           ++EKED   I  EKL   NF                  EENV++  L+TK+     E K 
Sbjct: 533 DSEKEDAAEIPGEKLDIGNFREESVGRLKENLKIGDSEEENVEKGFLQTKNALNGSEAKT 592

Query: 278 DLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVS--LDQD 335
             +ED++ ATRV K KKLKINVHRP+GTR+VFDEE NT+PPLA +AD KN + S  LDQD
Sbjct: 593 GEIEDLVPATRVLKKKKLKINVHRPVGTRVVFDEEGNTLPPLARVADRKNVDNSSLLDQD 652

Query: 336 QKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKRKRGGLGDDDDEEDEDNASDKD 395
           ++ EYYK +RE++K  DKEDK+LDRQRRREKRIK+KMKRK G +G ++D E ED+ S  +
Sbjct: 653 KREEYYKNMREQMKHVDKEDKVLDRQRRREKRIKEKMKRKIGSMGLEEDGEGEDDLSGSE 712

Query: 396 EESMERGRR-KKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLNSMHS 454
            E    GR+ K++KIYFDSDS  DN E  ++KD+ G + DSISLA+QEALALKLL+SMHS
Sbjct: 713 GE----GRKHKRSKIYFDSDS--DNAEMTESKDNAGISTDSISLADQEALALKLLSSMHS 766

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563905|ref|XP_002522952.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223537764|gb|EEF39382.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356501519|ref|XP_003519572.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Glycine max] Back     alignment and taxonomy information
>gi|356553180|ref|XP_003544936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Glycine max] Back     alignment and taxonomy information
>gi|449515263|ref|XP_004164669.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357494471|ref|XP_003617524.1| ATP-dependent RNA helicase DBP4 [Medicago truncatula] gi|355518859|gb|AET00483.1| ATP-dependent RNA helicase DBP4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449470439|ref|XP_004152924.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225460999|ref|XP_002278373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297796361|ref|XP_002866065.1| hypothetical protein ARALYDRAFT_495573 [Arabidopsis lyrata subsp. lyrata] gi|297311900|gb|EFH42324.1| hypothetical protein ARALYDRAFT_495573 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15240418|ref|NP_200302.1| DEAD-box ATP-dependent RNA helicase 32 [Arabidopsis thaliana] gi|75333773|sp|Q9FFT9.1|RH32_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 32 gi|9758271|dbj|BAB08770.1| RNA helicase-like protein [Arabidopsis thaliana] gi|332009172|gb|AED96555.1| DEAD-box ATP-dependent RNA helicase 32 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query454
TAIR|locus:2160225739 AT5G54910 [Arabidopsis thalian 0.770 0.473 0.593 8.1e-108
ASPGD|ASPL0000061778812 AN0589 [Emericella nidulans (t 0.484 0.270 0.506 4.8e-64
UNIPROTKB|E9PIF2835 DDX10 "Probable ATP-dependent 0.559 0.304 0.453 2.9e-62
UNIPROTKB|Q13206 875 DDX10 "Probable ATP-dependent 0.559 0.290 0.453 6.3e-62
UNIPROTKB|F1P0I3 875 DDX10 "Probable ATP-dependent 0.528 0.274 0.454 1.9e-61
UNIPROTKB|Q5ZJF6 875 DDX10 "Probable ATP-dependent 0.528 0.274 0.454 1.9e-61
POMBASE|SPAC1093.05735 SPAC1093.05 "ATP-dependent RNA 0.482 0.297 0.502 4.2e-61
DICTYBASE|DDB_G0284017878 ddx10 "DEAD/DEAH box helicase" 0.656 0.339 0.396 1.2e-60
CGD|CAL0004182765 HCA4 [Candida albicans (taxid: 0.493 0.292 0.506 2e-59
MGI|MGI:1924841 875 Ddx10 "DEAD (Asp-Glu-Ala-Asp) 0.561 0.291 0.454 2.1e-59
TAIR|locus:2160225 AT5G54910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1066 (380.3 bits), Expect = 8.1e-108, P = 8.1e-108
 Identities = 212/357 (59%), Positives = 280/357 (78%)

Query:     1 MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQD 60
             MIVP+E+KLDMLWSFIK HLNS+ILVFL++ KQVK+V EAF KLRPGIPL  L+G+M Q+
Sbjct:   296 MIVPVEKKLDMLWSFIKTHLNSRILVFLSTKKQVKFVHEAFNKLRPGIPLKSLHGKMSQE 355

Query:    61 RRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSG 120
             +RM +Y+QF E++SVLFCTDV +RGLDF+KAVDWVVQVDCPEDVASYIHRVGRTAR+ + 
Sbjct:   356 KRMGVYSQFIERQSVLFCTDVLARGLDFDKAVDWVVQVDCPEDVASYIHRVGRTARFYTQ 415

Query:   121 GRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAF 180
             G+S+LFLTP+E KM+EKL+EAK+PI   KAN ++LQ VS LLAALLVKYPD+Q  AQ+AF
Sbjct:   416 GKSLLFLTPSEEKMIEKLQEAKVPIKLIKANNQKLQEVSRLLAALLVKYPDLQGVAQRAF 475

Query:   181 ITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQK-KGKMVPVKPV---LD 236
             ITYLRS+H ++DKE+FDV+KLSI+ FSASLGLPMTP+IRF N K K K V    +   ++
Sbjct:   476 ITYLRSIHKRRDKEIFDVSKLSIENFSASLGLPMTPRIRFTNLKTKKKGVYESSIAMEIE 535

Query:   237 NAEKEDKLMISREKLLPDNFTEENVD-RDILETKDIEDEGKADLLEDVMRATRVKKNKKL 295
             NA++ +  ++ ++ LL ++  EE+   +   E K +E   K +  E ++   RV KNKKL
Sbjct:   536 NAQEYEAPLVVKKDLLGEDLEEEDFALKPRKEGKVVEKSTKEE--EVLIPGNRVLKNKKL 593

Query:   296 KINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRAD 352
             KIN+HRP G+R+V DEE N++ PLA +A      V+LD+++  +YYKK+  E+++AD
Sbjct:   594 KINLHRPFGSRVVLDEEGNSLAPLASVAAEAGTEVALDEERMNDYYKKVGAEMRKAD 650
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0005730 "nucleolus" evidence=IDA
GO:0006606 "protein import into nucleus" evidence=RCA
ASPGD|ASPL0000061778 AN0589 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E9PIF2 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13206 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0I3 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJF6 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
POMBASE|SPAC1093.05 SPAC1093.05 "ATP-dependent RNA helicase Hca4 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284017 ddx10 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0004182 HCA4 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
MGI|MGI:1924841 Ddx10 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00130918
hypothetical protein (766 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.4832.1
hypothetical protein (422 aa)
   •  • 0.490
eugene3.00160311
hypothetical protein (691 aa)
   ••   0.472
estExt_fgenesh4_pg.C_LG_XV0629
hypothetical protein (314 aa)
   •• • 0.469
eugene3.00640202
hypothetical protein (1181 aa)
   •  • 0.438
estExt_Genewise1_v1.C_LG_VII2715
hypothetical protein (380 aa)
   •    0.438
estExt_fgenesh4_pm.C_280108
hypothetical protein (960 aa)
   •    0.412
gw1.86.17.1
hypothetical protein (573 aa)
   •    0.409
eugene3.00090493
hypothetical protein (840 aa)
   •    0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 4e-28
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-24
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-19
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 7e-18
smart0049082 smart00490, HELICc, helicase superfamily c-termina 7e-18
pfam1395964 pfam13959, DUF4217, Domain of unknown function (DU 6e-16
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 2e-14
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-10
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-10
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-10
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 3e-09
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-08
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 8e-08
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-06
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-04
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 1e-04
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-04
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 0.004
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  116 bits (292), Expect = 4e-28
 Identities = 58/260 (22%), Positives = 99/260 (38%), Gaps = 16/260 (6%)

Query: 6   EQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAI 65
           E+KL++L   +K     +++VF+ + + V+ + E+ +K   G  +  L+G + Q+ R   
Sbjct: 258 EEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKR--GFKVAALHGDLPQEERDRA 315

Query: 66  YAQFCEKR-SVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSV 124
             +F +    VL  TDVA+RGLD    V  V+  D P D   Y+HR+GRT R    G ++
Sbjct: 316 LEKFKDGELRVLVATDVAARGLDI-PDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAI 374

Query: 125 LFLTP-TEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITY 183
            F+T   E+K L+++ +            ++L     L          ++          
Sbjct: 375 SFVTEEEEVKKLKRIEKRLE---------RKLPSAVLLPLDEPEDAKLLKTTRPGLEEES 425

Query: 184 LRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDK 243
             S  I+K K         +        L             G  V + P L+       
Sbjct: 426 DISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKE--IPGAGDAVTIDPELERRSPNSA 483

Query: 244 LMISREKLLPDNFTEENVDR 263
             I           EE   +
Sbjct: 484 DDIEYILKGLSYRAEERTAK 503

Length = 513
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|222474 pfam13959, DUF4217, Domain of unknown function (DUF4217) Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 454
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.97
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.96
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.95
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.95
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.95
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.94
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.94
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.93
KOG0347731 consensus RNA helicase [RNA processing and modific 99.93
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.93
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.93
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.92
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.92
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.92
PTZ00110545 helicase; Provisional 99.92
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.92
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.91
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.91
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.9
PTZ00424401 helicase 45; Provisional 99.9
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.9
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.9
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.9
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.89
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.89
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.88
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.88
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.88
KOG0346569 consensus RNA helicase [RNA processing and modific 99.87
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.87
KOG0327397 consensus Translation initiation factor 4F, helica 99.86
PRK04914956 ATP-dependent helicase HepA; Validated 99.86
KOG0334997 consensus RNA helicase [RNA processing and modific 99.84
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.84
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.83
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.82
PRK13767 876 ATP-dependent helicase; Provisional 99.81
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.81
KOG4284 980 consensus DEAD box protein [Transcription] 99.8
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.79
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.79
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.78
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.78
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.78
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.77
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.77
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.77
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.76
PHA02653675 RNA helicase NPH-II; Provisional 99.75
PRK05298652 excinuclease ABC subunit B; Provisional 99.75
PRK106891147 transcription-repair coupling factor; Provisional 99.75
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.74
PRK13766773 Hef nuclease; Provisional 99.74
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.73
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.73
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.72
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.71
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.7
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.7
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.7
PRK02362737 ski2-like helicase; Provisional 99.68
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.68
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.67
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.66
PHA02558501 uvsW UvsW helicase; Provisional 99.65
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.63
KOG0354746 consensus DEAD-box like helicase [General function 99.62
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.62
smart0049082 HELICc helicase superfamily c-terminal domain. 99.6
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.6
PRK00254720 ski2-like helicase; Provisional 99.6
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.59
PRK01172674 ski2-like helicase; Provisional 99.58
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.57
PF1395965 DUF4217: Domain of unknown function (DUF4217) 99.56
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.41
PRK09401 1176 reverse gyrase; Reviewed 99.4
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.4
PRK09694878 helicase Cas3; Provisional 99.39
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.39
PRK14701 1638 reverse gyrase; Provisional 99.39
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.37
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.35
COG1202830 Superfamily II helicase, archaea-specific [General 99.3
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.3
PRK05580679 primosome assembly protein PriA; Validated 99.25
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.23
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.22
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.17
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.17
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.14
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.09
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.06
COG1205851 Distinct helicase family with a unique C-terminal 98.95
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.93
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 98.85
COG1204766 Superfamily II helicase [General function predicti 98.83
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 98.79
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.71
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 98.7
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 98.68
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.67
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 98.62
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.59
PRK12326764 preprotein translocase subunit SecA; Reviewed 98.54
KOG0387923 consensus Transcription-coupled repair protein CSB 98.51
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.48
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 98.43
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 98.42
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.4
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.38
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 98.36
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.35
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.28
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 98.28
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.23
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 98.23
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 98.16
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.16
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.15
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.1
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 98.09
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.08
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 98.07
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 98.05
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.02
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.01
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.01
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.98
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 97.9
KOG1123776 consensus RNA polymerase II transcription initiati 97.84
COG4096875 HsdR Type I site-specific restriction-modification 97.66
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 97.66
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.63
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 97.62
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.56
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 97.51
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 97.47
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.45
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.43
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.25
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.17
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.13
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 97.08
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 97.03
KOG4439901 consensus RNA polymerase II transcription terminat 97.01
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 96.99
COG4889 1518 Predicted helicase [General function prediction on 96.95
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.87
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 96.49
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.42
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 96.41
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.08
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.64
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.49
PF13871278 Helicase_C_4: Helicase_C-like 95.27
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 95.24
PRK14873665 primosome assembly protein PriA; Provisional 95.2
PRK05580679 primosome assembly protein PriA; Validated 95.07
TIGR00595505 priA primosomal protein N'. All proteins in this f 94.74
TIGR00643630 recG ATP-dependent DNA helicase RecG. 94.59
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.21
PRK14873665 primosome assembly protein PriA; Provisional 93.62
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 93.44
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 93.17
PRK106891147 transcription-repair coupling factor; Provisional 93.08
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 92.98
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.93
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 92.49
COG1198730 PriA Primosomal protein N' (replication factor Y) 92.37
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 92.0
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 91.95
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.53
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 89.87
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 88.76
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 88.66
PRK14701 1638 reverse gyrase; Provisional 88.57
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 88.48
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 87.99
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 87.12
KOG0347731 consensus RNA helicase [RNA processing and modific 87.02
KOG2340698 consensus Uncharacterized conserved protein [Funct 85.91
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 85.88
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 85.01
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 84.95
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 84.2
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 83.72
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 82.68
PRK13766 773 Hef nuclease; Provisional 82.47
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 81.22
PTZ00110545 helicase; Provisional 81.06
COG1200677 RecG RecG-like helicase [DNA replication, recombin 80.05
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=8.1e-83  Score=659.28  Aligned_cols=429  Identities=43%  Similarity=0.677  Sum_probs=353.5

Q ss_pred             CccCcchHHHHHHHHHHhcCCCcEEEEeCChHHHHHHHHHHHhcCCCCceEeecCCCCHHHHHHHHHHHhc-CCcEEEec
Q 012877            1 MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCE-KRSVLFCT   79 (454)
Q Consensus         1 ivv~~~~Kl~~L~~~Lk~~~~~KiIVF~sS~k~v~~l~~~L~~l~~gi~v~~LHG~msq~~R~~il~~F~~-~~~VLVaT   79 (454)
                      |+||..+|+++||+||++|+..|+|||++||++|.|+|+.|++++||+++++|||+|+|..|..++.+|.. ...|||||
T Consensus       293 ~~v~l~~Ki~~L~sFI~shlk~K~iVF~SscKqvkf~~e~F~rlrpg~~l~~L~G~~~Q~~R~ev~~~F~~~~~~vLF~T  372 (758)
T KOG0343|consen  293 VIVPLEDKIDMLWSFIKSHLKKKSIVFLSSCKQVKFLYEAFCRLRPGIPLLALHGTMSQKKRIEVYKKFVRKRAVVLFCT  372 (758)
T ss_pred             EEEehhhHHHHHHHHHHhccccceEEEEehhhHHHHHHHHHHhcCCCCceeeeccchhHHHHHHHHHHHHHhcceEEEee
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999 99999999


Q ss_pred             cccccccccCCCccEEEecCCCCChhHHHHHHhccccCCCCceEEEEeCcch-HHHHHHHHHcCCCcccccccccccchH
Q 012877           80 DVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTE-MKMLEKLREAKIPIHFTKANTKRLQPV  158 (454)
Q Consensus        80 DvaaRGLD~~p~Vd~VIq~D~P~~~~~YIhRvGRtgR~g~~G~ail~l~p~E-~~~l~~L~~~~i~i~~~~i~~~k~~~i  158 (454)
                      ||++||||| |+||||||||||.++++||||||||||++..|.|+++++|+| +.|+..|+.++||+.++.+++.++.+|
T Consensus       373 Dv~aRGLDF-paVdwViQ~DCPedv~tYIHRvGRtAR~~~~G~sll~L~psEeE~~l~~Lq~k~I~i~~i~i~~~k~~~i  451 (758)
T KOG0343|consen  373 DVAARGLDF-PAVDWVIQVDCPEDVDTYIHRVGRTARYKERGESLLMLTPSEEEAMLKKLQKKKIPIKEIKIDPEKLTSI  451 (758)
T ss_pred             hhhhccCCC-cccceEEEecCchhHHHHHHHhhhhhcccCCCceEEEEcchhHHHHHHHHHHcCCCHHhhccCHHHhhhH
Confidence            999999999 999999999999999999999999999999999999999999 589999999999999999999999999


Q ss_pred             HHHHHHHHhhChhHHHHHHHHHHHHHHHhhcCCCcccccccCCCHHHHHHHcCCCCCcc-cccccccccCCCCCCCCCcc
Q 012877          159 SGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPK-IRFLNQKKGKMVPVKPVLDN  237 (454)
Q Consensus       159 ~~~l~~ll~~~~el~~~aqrAf~sylrs~~~~~~k~iF~v~~Ldl~~~A~S~GL~~~P~-i~~l~~~~~~k~~~~~~~~~  237 (454)
                      +.+++++|+++|+|++.||+||++|+||+|.++++.+|++..|++.+||.||||+++|+ ++|+.....+++ +.+..+.
T Consensus       452 ~~~l~~ll~~~~eLk~~aqka~isY~rsi~~~rdK~~f~~~~l~~~afa~s~Gl~~~p~~~~~l~~~~k~~~-~~~l~e~  530 (758)
T KOG0343|consen  452 RNKLEALLAKDPELKEYAQKAFISYLRSIYLMRDKRVFDVEKLDIEAFADSLGLPGTPRIVRFLNKKAKKQG-IEQLMEQ  530 (758)
T ss_pred             HHHHHHHHhhCHHHHHHHHHHHHHHHHHHHhhccchhhcchhccHHHHHHhcCCCCCchhccchhhHHHhcC-hHhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999 999886554444 2211100


Q ss_pred             hhhhhhhhhhhccCCCCCCc-CcCCCCCCeeeecccccccc------c-----ccchh-------hhHHHHhhhhhhhhh
Q 012877          238 AEKEDKLMISREKLLPDNFT-EENVDRDILETKDIEDEGKA------D-----LLEDV-------MRATRVKKNKKLKIN  298 (454)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~-~~~~~~d~~~~k~~~~~~~~------~-----~~~~~-------~~~~k~~~~kk~~~~  298 (454)
                      +-            +  +.+ +..+++|||+||+++...+-      +     ....+       .+.+|.+.+||+ ++
T Consensus       531 ~~------------~--~eeee~~~~ed~f~vK~~dvlge~~~l~ee~~~ek~d~~~~svkk~~k~~~tKva~aKKa-~~  595 (758)
T KOG0343|consen  531 SV------------D--EEEEEATDDEDFFKVKKHDVLGEPEQLKEEDAAEKEDNDFISVKKKDKKRVTKVALAKKA-LK  595 (758)
T ss_pred             hc------------c--chhhhccchhhhhheeccccccchhhhhhhhhhhcccCCCceeccchhhhHHHHHHHHHH-HH
Confidence            00            0  111 11135567777776554320      0     00111       235899999999 99


Q ss_pred             ccCCCCCeeeecCCCCCCCchhhhhccc---ccCcCcChHHHHHHHHHHHHHHHHhcHHhHHHHHHHHHHHHHHHHHHHh
Q 012877          299 VHRPLGTRLVFDEECNTVPPLAMLADTK---NANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKRK  375 (454)
Q Consensus       299 ~~~~~~~k~~fd~~g~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~d~~dk~~~k~~~~~k~~k~k~~~~  375 (454)
                      +++++|+|++|||||+++| .|++..+.   ..|+.  +++...|+.+++++|+++|++||+++|+++++||+++++++|
T Consensus       596 k~~kvnsK~~FddEGe~~~-~~~~~~e~~~~~~~~d--~~~~g~~l~k~~a~l~~~D~~DK~~~kek~~ek~r~k~~k~r  672 (758)
T KOG0343|consen  596 KNLKVNSKLTFDDEGELAP-EYEQMPETITSKAGDD--DDTGGINLEKAKAELKEEDKEDKKRFKEKRKEKRREKLEKER  672 (758)
T ss_pred             HhhccCceeeecCccccch-hhhhchhhhhhhccCc--hhhccchHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999888 77776665   33554  888889999999999999999999999999999999999998


Q ss_pred             cCCCCC--CC-CCc-cc-----CCcCCCC-chhhhhccccccccccCCCCCCchhh-hhcCCCCCCCCCCCCChHHHHHH
Q 012877          376 RGGLGD--DD-DEE-DE-----DNASDKD-EESMERGRRKKAKIYFDSDSDNDNDE-RKQNKDDNGPNIDSISLAEQEAL  444 (454)
Q Consensus       376 ~~~~~~--~~-~~~-~~-----~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~l~~~e~l  444 (454)
                      +.+++.  ++ ++. .+     +.|+++| +.++-+.|.+..|+|+.+.++.+... .....+++.+. ++.++||+|+|
T Consensus       673 r~aeea~~~e~e~~e~d~~~~~~~gs~dD~d~s~lPd~dk~~kk~~~d~de~e~k~~s~~~~~g~k~~-~~~~~eD~e~~  751 (758)
T KOG0343|consen  673 RRAEEANEEEAEAEEEDGDFVDWSGSEDDPDISWLPDPDKVRKKKESDSDENEGKIQSALAADGIKEV-SNSSVEDVEPL  751 (758)
T ss_pred             HHHHhcccccccchhccCchhcccCCcccCCcccCCChhhhhhccccCchhhcccccccccccccccc-CCcchhhcchh
Confidence            754321  11 111 11     1244444 33345566677777876555544321 22334566666 89999999999


Q ss_pred             HHHhHh
Q 012877          445 ALKLLN  450 (454)
Q Consensus       445 a~~ll~  450 (454)
                      |++|..
T Consensus       752 ~~k~~~  757 (758)
T KOG0343|consen  752 ALKLKK  757 (758)
T ss_pred             hHHhhc
Confidence            999875

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PF13959 DUF4217: Domain of unknown function (DUF4217) Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-17
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-17
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-17
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 5e-17
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-17
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-17
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 6e-10
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 2e-09
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-09
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-09
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-09
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 2e-09
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-09
2hyi_C413 Structure Of The Human Exon Junction Complex With A 2e-09
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-09
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 3e-09
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 1e-08
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-08
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 2e-08
2jgn_A185 Ddx3 Helicase Domain Length = 185 2e-08
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-08
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 3e-08
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 3e-08
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 5e-08
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 6e-08
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 7e-08
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 8e-08
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 9e-08
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 9e-08
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-07
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 1e-07
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-07
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-07
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-07
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-07
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 3e-07
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 9e-07
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-06
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 4e-06
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 76/124 (61%), Gaps = 3/124 (2%)
Query: 21  NSKILVFLTSCKQVKYVFEAFK-KLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRS-VLFC 78
           N K ++F  + K   ++    K + +  +P++  +G++ Q++R ++  +F +  S +L C
Sbjct: 288 NYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVC 347
Query: 79  TDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKL 138
           TDV +RG+DF   V  V+Q+  P ++A+YIHR+GRTAR    G SVLF+   E+  + +L
Sbjct: 348 TDVGARGMDF-PNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVREL 406
Query: 139 REAK 142
            +AK
Sbjct: 407 EDAK 410
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-56
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-55
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-21
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 4e-21
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-20
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-20
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 7e-20
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-19
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-19
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-19
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-19
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 4e-19
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-18
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-18
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 4e-18
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 6e-18
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-18
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 9e-18
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-17
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 6e-17
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-15
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-14
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 2e-14
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-14
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-10
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-08
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-05
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-05
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 9e-05
1yks_A440 Genome polyprotein [contains: flavivirin protease 1e-04
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 5e-04
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 7e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  195 bits (497), Expect = 1e-56
 Identities = 55/242 (22%), Positives = 110/242 (45%), Gaps = 12/242 (4%)

Query: 1   MIVP-LEQKLDMLWSFIKAHL-----NSKILVFLTSCKQVKYVFEAFK-KLRPGIPLMCL 53
           +I       +      IK  +     N K ++F  + K   ++    K + +  +P++  
Sbjct: 313 VISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEF 372

Query: 54  YGRMKQDRRMAIYAQFCE-KRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVG 112
           +G++ Q++R ++  +F + +  +L CTDV +RG+DF   V  V+Q+  P ++A+YIHR+G
Sbjct: 373 HGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFP-NVHEVLQIGVPSELANYIHRIG 431

Query: 113 RTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDM 172
           RTAR    G SVLF+   E+  + +L +AK  +   +   +  + +   +   + + P+ 
Sbjct: 432 RTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPED 491

Query: 173 QHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLP---MTPKIRFLNQKKGKMV 229
                 + I+  RS   +       +       +   L  P   +    RFL++      
Sbjct: 492 ISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRS 551

Query: 230 PV 231
           P+
Sbjct: 552 PI 553
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query454
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.97
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.96
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.96
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.96
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.96
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.95
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.95
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.95
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.95
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.9
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.92
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.92
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.92
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.91
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.91
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.91
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.91
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.91
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.9
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.9
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.88
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.88
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.87
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.86
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.86
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.85
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.85
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.85
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.85
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.84
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.84
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.84
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.84
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.83
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.83
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.83
3jux_A822 Protein translocase subunit SECA; protein transloc 99.83
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.82
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.81
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.81
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.81
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.8
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.8
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.79
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.78
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.78
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.78
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.76
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.75
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.75
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.74
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.74
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.74
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.74
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.73
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.72
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.72
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.71
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.71
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.71
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.71
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.7
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.69
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.68
3h1t_A590 Type I site-specific restriction-modification syst 99.65
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.63
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.55
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.47
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.23
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.27
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 98.2
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.22
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.93
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 96.46
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 94.48
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 93.61
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 92.79
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 92.25
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.97
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 91.64
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 91.48
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 90.92
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 90.76
3bor_A237 Human initiation factor 4A-II; translation initiat 89.5
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 89.32
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 88.72
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 88.71
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 88.25
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 86.47
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 86.46
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 86.24
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 86.02
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 85.9
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 85.61
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 85.19
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 84.62
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 84.31
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 83.78
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 83.74
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 83.35
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 83.28
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 81.51
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 81.45
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 81.29
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
Probab=99.97  E-value=1.7e-29  Score=228.55  Aligned_cols=144  Identities=28%  Similarity=0.468  Sum_probs=135.6

Q ss_pred             ccCcchHHHHHHHHHHhcCCCcEEEEeCChHHHHHHHHHHHhcCCCCceEeecCCCCHHHHHHHHHHHhc-CCcEEEecc
Q 012877            2 IVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCE-KRSVLFCTD   80 (454)
Q Consensus         2 vv~~~~Kl~~L~~~Lk~~~~~KiIVF~sS~k~v~~l~~~L~~l~~gi~v~~LHG~msq~~R~~il~~F~~-~~~VLVaTD   80 (454)
                      .++...|+..|..+|....+.++||||+|...++.++..|...  |+.+..+||+|++.+|..+++.|+. ...|||||+
T Consensus        16 ~~~~~~K~~~L~~ll~~~~~~~~lVF~~~~~~~~~l~~~L~~~--~~~~~~~hg~~~~~~r~~~~~~f~~g~~~vlv~T~   93 (163)
T 2hjv_A           16 QVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDL--GYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATD   93 (163)
T ss_dssp             ECCGGGHHHHHHHHHHHHCCSSEEEECSSHHHHHHHHHHHHHT--TCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEECG
T ss_pred             ECChHHHHHHHHHHHHhcCCCcEEEEECCHHHHHHHHHHHHHc--CCcEEEEeCCCCHHHHHHHHHHHHcCCCeEEEECC
Confidence            4678899999999999888899999999999999999999987  8999999999999999999999999 999999999


Q ss_pred             ccccccccCCCccEEEecCCCCChhHHHHHHhccccCCCCceEEEEeCcchHHHHHHHHHc-CCCcccc
Q 012877           81 VASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREA-KIPIHFT  148 (454)
Q Consensus        81 vaaRGLD~~p~Vd~VIq~D~P~~~~~YIhRvGRtgR~g~~G~ail~l~p~E~~~l~~L~~~-~i~i~~~  148 (454)
                      ++++|||+ |++++||+||+|+++.+|+||+||+||.|+.|.+++|+++.+..+++.++.. +.++..+
T Consensus        94 ~~~~Gld~-~~~~~Vi~~~~p~~~~~~~qr~GR~~R~g~~g~~~~~~~~~~~~~~~~i~~~~~~~~~~~  161 (163)
T 2hjv_A           94 VAARGIDI-ENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKI  161 (163)
T ss_dssp             GGTTTCCC-SCCSEEEESSCCSSHHHHHHHTTTSSCTTCCEEEEEEECGGGHHHHHHHHHHHTSCCEEC
T ss_pred             hhhcCCch-hcCCEEEEeCCCCCHHHHHHhccccCcCCCCceEEEEecHHHHHHHHHHHHHHCCCcCcc
Confidence            99999999 9999999999999999999999999999999999999999999999998876 6666543
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 454
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 1e-17
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-16
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-14
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 7e-14
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 9e-14
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 9e-14
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-13
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 3e-13
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-11
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-11
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-09
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-09
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 1e-08
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 7e-05
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 9e-04
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 77.3 bits (189), Expect = 1e-17
 Identities = 36/146 (24%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 1   MIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQD 60
           + V   ++ + L   +K +     LVF  + +  K +    + +      +      +  
Sbjct: 9   VEVNENERFEALCRLLK-NKEFYGLVFCKTKRDTKELASMLRDIGFKAGAIH-GDLSQSQ 66

Query: 61  RRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSG 120
           R   I     +K  +L  TDV SRG+D N  ++ V+    P++  SY+HR+GRT R    
Sbjct: 67  REKVIRLFKQKKIRILIATDVMSRGIDVND-LNCVINYHLPQNPESYMHRIGRTGRAGKK 125

Query: 121 GRSVLFLTPTEMKMLEKL-REAKIPI 145
           G+++  +   E K L  + R  K+ I
Sbjct: 126 GKAISIINRREYKKLRYIERAMKLKI 151
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query454
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.97
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.94
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.93
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.88
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.85
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.82
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.8
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.79
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.76
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.7
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.58
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.57
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.54
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.37
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.28
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.53
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.54
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.87
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 91.5
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 90.09
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 83.16
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 80.24
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=3.9e-33  Score=252.71  Aligned_cols=144  Identities=22%  Similarity=0.422  Sum_probs=130.9

Q ss_pred             cchHHHHHHHHHHhcCCCcEEEEeCChHHHHHHHHHHHhcCCCCceEeecCCCCHHHHHHHHHHHhc-CCcEEEeccccc
Q 012877            5 LEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCE-KRSVLFCTDVAS   83 (454)
Q Consensus         5 ~~~Kl~~L~~~Lk~~~~~KiIVF~sS~k~v~~l~~~L~~l~~gi~v~~LHG~msq~~R~~il~~F~~-~~~VLVaTDvaa   83 (454)
                      .+.|+++|..+++.....++||||+|+..++.++..|...  |+.+..+||+|++.+|..+++.|+. ...||||||+++
T Consensus        11 ~e~K~~~L~~ll~~~~~~k~iIF~~s~~~~~~l~~~L~~~--~~~~~~~~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~   88 (162)
T d1fuka_          11 EEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRND--KFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLA   88 (162)
T ss_dssp             GGGHHHHHHHHHHHTTCSCEEEEESSHHHHHHHHHHHHHT--TCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEEEGGGT
T ss_pred             cHHHHHHHHHHHHhCCCCcEEEEEEEEchHHHHHHHHhhc--CceEEEeccCCchhhHHHHHHHHhhcccceeecccccc
Confidence            4569999999999999999999999999999999999987  9999999999999999999999999 999999999999


Q ss_pred             cccccCCCccEEEecCCCCChhHHHHHHhccccCCCCceEEEEeCcchHHHHHHHHHc-CCCccccccc
Q 012877           84 RGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREA-KIPIHFTKAN  151 (454)
Q Consensus        84 RGLD~~p~Vd~VIq~D~P~~~~~YIhRvGRtgR~g~~G~ail~l~p~E~~~l~~L~~~-~i~i~~~~i~  151 (454)
                      ||||+ |+|++|||||+|++++.|+||+|||||+|+.|.|++|+++.|..++..|+.. +..+++++.+
T Consensus        89 rGiDi-~~v~~VI~~d~P~~~~~yihR~GR~gR~g~~g~~i~~~~~~d~~~~~~i~~~~~~~~~~ip~~  156 (162)
T d1fuka_          89 RGIDV-QQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSD  156 (162)
T ss_dssp             TTCCC-CSCSEEEESSCCSSGGGGGGSSCSCC-----CEEEEEEETTTHHHHHHHHHHSSCCCEECCSC
T ss_pred             ccccC-CCceEEEEeccchhHHHHHhhccccccCCCccEEEEEcCHHHHHHHHHHHHHHcCcCCCCChH
Confidence            99999 9999999999999999999999999999999999999999999999999875 7777766554
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure