Citrus Sinensis ID: 012946
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 452 | ||||||
| 255550277 | 448 | aminoadipic semialdehyde synthase, putat | 0.984 | 0.993 | 0.780 | 0.0 | |
| 359484440 | 1052 | PREDICTED: alpha-aminoadipic semialdehyd | 0.991 | 0.425 | 0.747 | 0.0 | |
| 255550269 | 1050 | aminoadipic semialdehyde synthase, putat | 0.991 | 0.426 | 0.749 | 0.0 | |
| 23193176 | 518 | monofunctional lysine-ketoglutarate redu | 0.980 | 0.855 | 0.727 | 0.0 | |
| 23193174 | 1052 | bifunctional lysine-ketoglutarate reduct | 0.980 | 0.421 | 0.720 | 0.0 | |
| 449452622 | 1050 | PREDICTED: alpha-aminoadipic semialdehyd | 0.991 | 0.426 | 0.711 | 0.0 | |
| 356547992 | 1048 | PREDICTED: alpha-aminoadipic semialdehyd | 0.980 | 0.422 | 0.720 | 0.0 | |
| 2052508 | 1064 | lysine-ketoglutarate reductase/saccharop | 0.988 | 0.420 | 0.7 | 0.0 | |
| 2052510 | 1064 | lysine-ketoglutarate reductase/saccharop | 0.988 | 0.420 | 0.7 | 0.0 | |
| 18418158 | 1064 | lysine-ketoglutarate reductase/saccharop | 0.988 | 0.420 | 0.7 | 0.0 |
| >gi|255550277|ref|XP_002516189.1| aminoadipic semialdehyde synthase, putative [Ricinus communis] gi|223544675|gb|EEF46191.1| aminoadipic semialdehyde synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 743 bits (1917), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 352/451 (78%), Positives = 400/451 (88%), Gaps = 6/451 (1%)
Query: 1 MLDNGVVGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQPSTKRIFNDAQYE 60
ML NGVVGILAE+SNKWERRAPLTP++C+ LLL GR K+GV+RI+VQPS KRI++DA Y+
Sbjct: 1 MLGNGVVGILAESSNKWERRAPLTPTNCATLLLHGRNKAGVSRIIVQPSPKRIYHDALYQ 60
Query: 61 EAGCEITSDLSECGLILGIKKPKLEMILPDRAYAFFSHTHKAQPENMALLDKILAQRVSL 120
+AGCEI+ DLSECGLILGIKKPKLEMILPDRAYAFFSHTHKAQ ENM LLD+ILA+RVSL
Sbjct: 61 QAGCEISDDLSECGLILGIKKPKLEMILPDRAYAFFSHTHKAQQENMLLLDEILAKRVSL 120
Query: 121 FDYELVEGNQGKRRLIAFGKFAGRAAIIDLLKGLGQRYLNLGYSTPFLTLGAAYMYPSLA 180
FDYELV+G Q ++RLIAFGKFAG AA++DL+ GLG+RYLNLGYSTPFL+LGAAYMY S+A
Sbjct: 121 FDYELVDGEQ-RKRLIAFGKFAGEAAMVDLMSGLGKRYLNLGYSTPFLSLGAAYMYTSVA 179
Query: 181 AAKAAIISVGEEIATEGLPSGICPLVFVFTGSGHASIAAQELFKLLPHTFVDPSRLPELF 240
AAKAA+ISVGEEIA GLP GICPLVFVFTGSG+AS+AAQE+FKLLPH FVDPSR PEL
Sbjct: 180 AAKAAVISVGEEIAANGLPPGICPLVFVFTGSGNASVAAQEIFKLLPHAFVDPSRCPELL 239
Query: 241 EKAGDSSQSTCSSSTKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIFHEK 300
+ + ++S+ RVFQVYGCVVT ++MVE KD+++ FDK DYY +PE Y PIFHEK
Sbjct: 240 -----AGKDMPAASSGRVFQVYGCVVTCKDMVEHKDTTKEFDKADYYANPEHYKPIFHEK 294
Query: 301 IAPYASAIINCIYWEKQFPRLLSTQQLRDLAQKGCPLVGISDLTCDMEGSIEILNQTTTI 360
IAPYAS IINCIYWEK+FPRLLST+QLRDLA KGCPL I+DLTCDMEGSIEILNQTTTI
Sbjct: 295 IAPYASVIINCIYWEKRFPRLLSTRQLRDLASKGCPLTAITDLTCDMEGSIEILNQTTTI 354
Query: 361 DSPFFRYDPKNDSYHHDMEGDGIICSVVDNLPTEFPKEASQHFGGLLSQFIGSLASVADI 420
D+PFFRYDP NDSYHHD+EG G+ICSVVDNLPTEFPKEA QHFG LLSQFIG+LAS ADI
Sbjct: 355 DTPFFRYDPLNDSYHHDIEGSGLICSVVDNLPTEFPKEACQHFGALLSQFIGTLASTADI 414
Query: 421 AKLPGNLRRACIAHGGALTSLYEYIPTMRNS 451
AKLP +LRRACIAH GALT L+EYI MRN+
Sbjct: 415 AKLPAHLRRACIAHEGALTPLFEYIKQMRNT 445
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359484440|ref|XP_003633109.1| PREDICTED: alpha-aminoadipic semialdehyde synthase-like [Vitis vinifera] gi|297738495|emb|CBI27740.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255550269|ref|XP_002516185.1| aminoadipic semialdehyde synthase, putative [Ricinus communis] gi|223544671|gb|EEF46187.1| aminoadipic semialdehyde synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|23193176|gb|AAN14411.1| monofunctional lysine-ketoglutarate reductase 1 [Gossypium hirsutum] gi|23193178|gb|AAN14412.1| monofunctional lysine-ketoglutarate reductase 2 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|23193174|gb|AAN14410.1| bifunctional lysine-ketoglutarate reductase/saccharopine dehydrogenase [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|449452622|ref|XP_004144058.1| PREDICTED: alpha-aminoadipic semialdehyde synthase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356547992|ref|XP_003542388.1| PREDICTED: alpha-aminoadipic semialdehyde synthase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|2052508|gb|AAB96826.1| lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|2052510|gb|AAB96825.1| lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18418158|ref|NP_567914.1| lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme [Arabidopsis thaliana] gi|30689619|ref|NP_849486.1| lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme [Arabidopsis thaliana] gi|332660782|gb|AEE86182.1| lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme [Arabidopsis thaliana] gi|332660783|gb|AEE86183.1| lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 452 | ||||||
| TAIR|locus:2125964 | 1064 | AT4G33150 [Arabidopsis thalian | 0.988 | 0.420 | 0.693 | 2e-175 | |
| DICTYBASE|DDB_G0284835 | 909 | aass "lysine-ketoglutarate red | 0.933 | 0.464 | 0.433 | 5.5e-93 | |
| WB|WBGene00019819 | 934 | R02D3.1 [Caenorhabditis elegan | 0.926 | 0.448 | 0.398 | 7.4e-82 | |
| UNIPROTKB|E1BWX4 | 930 | AASS "Uncharacterized protein" | 0.942 | 0.458 | 0.407 | 2e-81 | |
| UNIPROTKB|Q6GN76 | 927 | aass "MGC82978 protein" [Xenop | 0.940 | 0.458 | 0.389 | 2.7e-77 | |
| MGI|MGI:1353573 | 926 | Aass "aminoadipate-semialdehyd | 0.938 | 0.457 | 0.384 | 1.5e-76 | |
| RGD|1310811 | 926 | Aass "aminoadipate-semialdehyd | 0.938 | 0.457 | 0.384 | 2.4e-76 | |
| UNIPROTKB|F1SLX5 | 926 | AASS "Uncharacterized protein" | 0.938 | 0.457 | 0.381 | 3.1e-76 | |
| UNIPROTKB|A8E657 | 926 | AASS "Alpha-aminoadipic semial | 0.938 | 0.457 | 0.381 | 6.3e-76 | |
| ZFIN|ZDB-GENE-061220-8 | 935 | aass "aminoadipate-semialdehyd | 0.933 | 0.451 | 0.387 | 6.3e-76 |
| TAIR|locus:2125964 AT4G33150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1704 (604.9 bits), Expect = 2.0e-175, P = 2.0e-175
Identities = 312/450 (69%), Positives = 383/450 (85%)
Query: 2 LDNGVVGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQPSTKRIFNDAQYEE 61
L NGVVGILAET NKWERR PLTPSHC+RLL G+ ++G++RI+VQPS KRI +DA YE+
Sbjct: 12 LGNGVVGILAETVNKWERRTPLTPSHCARLLHGGKDRTGISRIVVQPSAKRIHHDALYED 71
Query: 62 AGCEITSDLSECGLILGIKKPKLEMILPDRAYAFFSHTHKAQPENMALLDKILAQRVSLF 121
GCEI+ DLS+CGLILGIK+P+LEMILP+RAYAFFSHTHKAQ ENM LLDKIL++RV+L
Sbjct: 72 VGCEISDDLSDCGLILGIKQPELEMILPERAYAFFSHTHKAQKENMPLLDKILSERVTLC 131
Query: 122 DYELVEGNQGKRRLIAFGKFAGRAAIIDLLKGLGQRYLNLGYSTPFLTLGAAYMYPSLAA 181
DYEL+ G+ GKR L+AFGK+AGRA ++D L GLGQRYL+LGYSTPFL+LGA+YMY SLAA
Sbjct: 132 DYELIVGDHGKR-LLAFGKYAGRAGLVDFLHGLGQRYLSLGYSTPFLSLGASYMYSSLAA 190
Query: 182 AKAAIISVGEEIATEGLPSGICPLVFVFTGSGHASIAAQELFKLLPHTFVDPSRLPELFE 241
AKAA+ISVGEEIA++GLP GICPLVFVFTG+G+ S+ AQE+FKLLPHTFV+PS+LPELF
Sbjct: 191 AKAAVISVGEEIASQGLPLGICPLVFVFTGTGNVSLGAQEIFKLLPHTFVEPSKLPELFV 250
Query: 242 KAGDXXXXXXXXXXKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIFHEKI 301
K D KRV+QVYGC++TS++MVE KD S++FDK DYY HPE YNP+FHEKI
Sbjct: 251 K--DKGISQNGISTKRVYQVYGCIITSQDMVEHKDPSKSFDKADYYAHPEHYNPVFHEKI 308
Query: 302 APYASAIINCIYWEKQFPRLLSTQQLRDLAQKGCPLVGISDLTCDMEGSIEILNQTTTID 361
+PY S ++NC+YWEK+FP LLST+QL+DL +KG PLVGI D+TCD+ GSIE +N+ T ID
Sbjct: 309 SPYTSVLVNCMYWEKRFPCLLSTKQLQDLTKKGLPLVGICDITCDIGGSIEFVNRATLID 368
Query: 362 SPFFRYDPKNDSYHHDMEGDGIICSVVDNLPTEFPKEASQHFGGLLSQFIGSLASVADIA 421
SPFFR++P N+SY+ DM+GDG++C VD LPTEF KEASQHFG +LS F+GSLAS+ +I+
Sbjct: 369 SPFFRFNPSNNSYYDDMDGDGVLCMAVDILPTEFAKEASQHFGDILSGFVGSLASMTEIS 428
Query: 422 KLPGNLRRACIAHGGALTSLYEYIPTMRNS 451
LP +L+RACI++ G LTSLYEYIP MR S
Sbjct: 429 DLPAHLKRACISYRGELTSLYEYIPRMRKS 458
|
|
| DICTYBASE|DDB_G0284835 aass "lysine-ketoglutarate reductase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00019819 R02D3.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWX4 AASS "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GN76 aass "MGC82978 protein" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1353573 Aass "aminoadipate-semialdehyde synthase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1310811 Aass "aminoadipate-semialdehyde synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SLX5 AASS "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8E657 AASS "Alpha-aminoadipic semialdehyde synthase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061220-8 aass "aminoadipate-semialdehyde synthase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 452 | |||
| PLN02819 | 1042 | PLN02819, PLN02819, lysine-ketoglutarate reductase | 0.0 | |
| cd12189 | 433 | cd12189, LKR_SDH_like, bifunctional lysine ketoglu | 0.0 | |
| cd05199 | 319 | cd05199, SDH_like, Saccharopine Dehydrogenase like | 6e-74 | |
| cd05199 | 319 | cd05199, SDH_like, Saccharopine Dehydrogenase like | 6e-32 | |
| pfam05222 | 135 | pfam05222, AlaDh_PNT_N, Alanine dehydrogenase/PNT, | 1e-26 | |
| smart01003 | 133 | smart01003, AlaDh_PNT_N, Alanine dehydrogenase/PNT | 1e-25 | |
| pfam01262 | 150 | pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, | 8e-22 | |
| cd12188 | 351 | cd12188, SDH, Saccharopine Dehydrogenase NAD-bindi | 7e-18 | |
| smart01002 | 149 | smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT | 2e-13 | |
| cd05304 | 363 | cd05304, Rubrum_tdh, Rubrum transdehydrogenase NAD | 4e-09 | |
| cd01620 | 317 | cd01620, Ala_dh_like, Alanine dehydrogenase and re | 1e-07 | |
| cd05305 | 359 | cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin | 4e-07 | |
| cd12181 | 295 | cd12181, ceo_syn, N(5)-(carboxyethyl)ornithine syn | 4e-05 | |
| COG0686 | 371 | COG0686, Ald, Alanine dehydrogenase [Amino acid tr | 5e-05 | |
| cd12188 | 351 | cd12188, SDH, Saccharopine Dehydrogenase NAD-bindi | 4e-04 | |
| cd01620 | 317 | cd01620, Ala_dh_like, Alanine dehydrogenase and re | 5e-04 | |
| cd12181 | 295 | cd12181, ceo_syn, N(5)-(carboxyethyl)ornithine syn | 8e-04 | |
| TIGR00518 | 370 | TIGR00518, alaDH, alanine dehydrogenase | 0.001 |
| >gnl|CDD|215439 PLN02819, PLN02819, lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
Score = 778 bits (2010), Expect = 0.0
Identities = 327/452 (72%), Positives = 389/452 (86%), Gaps = 9/452 (1%)
Query: 1 MLDNGVVGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQPSTKRIFNDAQYE 60
L NGVVGILAET NKWERRAPLTPSHC+RLL +G+ V+RI+VQPS+KRI +DAQYE
Sbjct: 2 KLGNGVVGILAETVNKWERRAPLTPSHCARLLHSGKD-RTVSRIIVQPSSKRIHHDAQYE 60
Query: 61 EAGCEITSDLSECGLILGIKKPKLEMILPDRAYAFFSHTHKAQPENMALLDKILAQRVSL 120
+ GCEI+ DLS+CGLILG+K+PKLEM+LPDRAYAFFSHTHKAQPENM LLDKIL +RVSL
Sbjct: 61 DVGCEISEDLSDCGLILGVKQPKLEMLLPDRAYAFFSHTHKAQPENMPLLDKILEERVSL 120
Query: 121 FDYELVEGNQGKRRLIAFGKFAGRAAIIDLLKGLGQRYLNLGYSTPFLTLGAAYMYPSLA 180
FDYEL+ G+ GKR L+AFGK+AGRA +ID +GLGQR L+LGYSTPFL+LG++YMY SLA
Sbjct: 121 FDYELIVGDHGKR-LVAFGKYAGRAGMIDFFRGLGQRLLSLGYSTPFLSLGSSYMYSSLA 179
Query: 181 AAKAAIISVGEEIATEGLPSGICPLVFVFTGSGHASIAAQELFKLLPHTFVDPSRLPELF 240
AAKAA+ISVGEEIA+ GLP GICPLVFVFTGSG+ S AQE+FKLLPHTFV+PS+LPEL
Sbjct: 180 AAKAAVISVGEEIASSGLPLGICPLVFVFTGSGNVSQGAQEIFKLLPHTFVEPSKLPEL- 238
Query: 241 EKAGDSSQSTCSSSTKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIFHEK 300
SQ+ STKRV+QVYGCVVTS++MVE KD S+ FDK DYY HPE YNP+FHEK
Sbjct: 239 ---KGISQN--KISTKRVYQVYGCVVTSQDMVEHKDPSKQFDKADYYAHPEHYNPVFHEK 293
Query: 301 IAPYASAIINCIYWEKQFPRLLSTQQLRDLAQK-GCPLVGISDLTCDMEGSIEILNQTTT 359
IAPYAS I+NC+YWEK+FPRLL+T+QL+DL +K GCPLVG+ D+TCD+ GSIE LN+TT+
Sbjct: 294 IAPYASVIVNCMYWEKRFPRLLTTKQLQDLTRKGGCPLVGVCDITCDIGGSIEFLNKTTS 353
Query: 360 IDSPFFRYDPKNDSYHHDMEGDGIICSVVDNLPTEFPKEASQHFGGLLSQFIGSLASVAD 419
I+ PFFRY+P N+SYH DM+GDGI+C VD LPTEF KEASQHFG +LS F+GSLAS+ +
Sbjct: 354 IEKPFFRYNPSNNSYHDDMDGDGILCMAVDILPTEFAKEASQHFGNILSPFVGSLASMKE 413
Query: 420 IAKLPGNLRRACIAHGGALTSLYEYIPTMRNS 451
+A+LP +LRRACIAH G+LT L+EYIP MRNS
Sbjct: 414 LAELPSHLRRACIAHRGSLTPLFEYIPRMRNS 445
|
Length = 1042 |
| >gnl|CDD|240665 cd12189, LKR_SDH_like, bifunctional lysine ketoglutarate reductase /saccharopine dehydrogenase enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|240623 cd05199, SDH_like, Saccharopine Dehydrogenase like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240623 cd05199, SDH_like, Saccharopine Dehydrogenase like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|218508 pfam05222, AlaDh_PNT_N, Alanine dehydrogenase/PNT, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|214967 smart01003, AlaDh_PNT_N, Alanine dehydrogenase/PNT, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240664 cd12188, SDH, Saccharopine Dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240629 cd05304, Rubrum_tdh, Rubrum transdehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240621 cd01620, Ala_dh_like, Alanine dehydrogenase and related dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240658 cd12181, ceo_syn, N(5)-(carboxyethyl)ornithine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223758 COG0686, Ald, Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240664 cd12188, SDH, Saccharopine Dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240621 cd01620, Ala_dh_like, Alanine dehydrogenase and related dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240658 cd12181, ceo_syn, N(5)-(carboxyethyl)ornithine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|129609 TIGR00518, alaDH, alanine dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 452 | |||
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 100.0 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 100.0 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 100.0 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 100.0 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 100.0 | |
| COG3288 | 356 | PntA NAD/NADP transhydrogenase alpha subunit [Ener | 100.0 | |
| PF05222 | 136 | AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal | 100.0 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 99.97 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 99.92 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 99.16 | |
| KOG0172 | 445 | consensus Lysine-ketoglutarate reductase/saccharop | 99.09 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 97.98 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 97.67 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 97.56 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 97.53 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 97.48 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.43 | |
| PLN02928 | 347 | oxidoreductase family protein | 97.39 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 97.23 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.19 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.18 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 97.17 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.13 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 97.1 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 97.01 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 97.01 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 96.97 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 96.95 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 96.94 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 96.92 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 96.89 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 96.88 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 96.82 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 96.82 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 96.81 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 96.76 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 96.76 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.72 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 96.69 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 96.66 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 96.65 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 96.61 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 96.59 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 96.58 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 96.54 | |
| PLN02494 | 477 | adenosylhomocysteinase | 96.51 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 96.3 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 96.22 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 96.2 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 96.2 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.2 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 96.19 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.16 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.15 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.14 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 96.08 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 96.05 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.04 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 96.02 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.91 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.9 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 95.84 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 95.81 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 95.76 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 95.76 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 95.72 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 95.61 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 95.6 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 95.46 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.45 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 95.45 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.43 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.38 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 95.29 | |
| KOG1370 | 434 | consensus S-adenosylhomocysteine hydrolase [Coenzy | 95.29 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.26 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 95.18 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.1 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.03 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.98 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.85 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 94.83 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.76 | |
| PLN02477 | 410 | glutamate dehydrogenase | 94.7 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.59 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.55 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 94.54 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 94.51 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 94.48 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 94.43 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.34 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 94.33 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 94.29 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.28 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 94.27 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.18 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 94.17 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 94.1 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.0 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 93.93 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 93.71 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.68 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 93.67 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.67 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 93.64 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 93.59 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.52 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 93.18 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 92.67 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.65 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 92.63 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 92.53 | |
| KOG0068 | 406 | consensus D-3-phosphoglycerate dehydrogenase, D-is | 92.46 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.1 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 92.05 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 91.92 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 91.28 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 91.26 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 91.2 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 91.12 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 91.11 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 90.92 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 90.48 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 90.23 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 90.21 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 89.66 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 89.58 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 89.55 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 89.52 | |
| PLN02712 | 667 | arogenate dehydrogenase | 89.49 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 89.29 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 89.25 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 88.9 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 88.64 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 88.49 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 87.89 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 87.88 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 87.74 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 87.69 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 86.98 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 86.47 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 86.31 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 86.26 | |
| PLN02256 | 304 | arogenate dehydrogenase | 86.2 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 85.6 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 85.1 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 85.03 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 84.77 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 84.66 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 84.36 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 84.32 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 84.21 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 84.12 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 83.87 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 83.76 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 83.67 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 82.48 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 82.46 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 82.38 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 82.21 | |
| PLN00106 | 323 | malate dehydrogenase | 82.09 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 81.82 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 81.35 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 81.19 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 81.1 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 80.47 | |
| KOG2250 | 514 | consensus Glutamate/leucine/phenylalanine/valine d | 80.33 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 80.1 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 80.07 |
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-102 Score=873.48 Aligned_cols=442 Identities=72% Similarity=1.244 Sum_probs=411.5
Q ss_pred CCCcEEEEeeccCCCCCcceecChHHHHHHHHcCCCCCCeeEEEEcCCCCCCCCchhhhhcCcEEccccccccEEEEecC
Q 012946 2 LDNGVVGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQPSTKRIFNDAQYEEAGCEITSDLSECGLILGIKK 81 (452)
Q Consensus 2 ~~~~~IGi~kE~~~~~ErRvaLtP~~v~~L~~~G~~~~~~~~V~VE~gag~~FsD~eY~~aGa~I~~~~~~~diIl~Vke 81 (452)
....+|||+||++++|||||||||++|++|+++||. .+.++|+||+|++|+|+|++|++|||+|++++++||||||||+
T Consensus 3 ~~~~~IgI~kE~~~~~E~RVaLtP~~v~~L~~~G~~-~~~~~V~VE~gA~a~f~D~~Y~~AGA~I~~~~~~adiIl~Vke 81 (1042)
T PLN02819 3 LGNGVVGILAETVNKWERRAPLTPSHCARLLHSGKD-RTVSRIIVQPSSKRIHHDAQYEDVGCEISEDLSDCGLILGVKQ 81 (1042)
T ss_pred cCCcEEEEEecCCCCCCCccCcCHHHHHHHHHCCCC-CCCCEEEEcCCCCCCCChHHHHHCCCEEECCCCCCCEEEEECC
Confidence 356789999999966999999999999999999941 1235999999999999999999999999998899999999999
Q ss_pred CCcccccCCCceEEEecccCCCCCCHHHHHHHHHcCCeEEEeecccccCCCccccchhHHHHHHHHHHHHHHHHHHHhhc
Q 012946 82 PKLEMILPDRAYAFFSHTHKAQPENMALLDKILAQRVSLFDYELVEGNQGKRRLIAFGKFAGRAAIIDLLKGLGQRYLNL 161 (452)
Q Consensus 82 p~~~~l~~~~~~~~fs~~~~~q~~n~~ll~~l~~k~it~i~~E~i~~~~g~~~L~s~~~~AG~~avi~al~~~g~~~l~~ 161 (452)
|+++++++++++++|+|+||+|++|++++++|+++|+|+||||.|+|++|+| |.+||+|||++|++++|+++|+++|.+
T Consensus 82 P~~eell~~~~~i~fs~~~~aq~~n~~ll~~l~~k~it~~ayE~i~~~~G~r-l~~fg~~AG~~g~~~~l~~~g~~~L~~ 160 (1042)
T PLN02819 82 PKLEMLLPDRAYAFFSHTHKAQPENMPLLDKILEERVSLFDYELIVGDHGKR-LVAFGKYAGRAGMIDFFRGLGQRLLSL 160 (1042)
T ss_pred CCHHHhcCCCEEEEEecccccccCCHHHHHHHHHcCCeEEEEeceECCCCCE-EeechHHHHHHHHHHHHHHHHHHHHhc
Confidence 9999998888889999999999999999999999999999999999999999 999999999999999999999999999
Q ss_pred CCCCCcccccccccCccHHHHHHHHHHhhHHHHhcCCCCCCCCceEEEEcCcHHHHHHHHHHhcCCCEEeCCCChhhHHh
Q 012946 162 GYSTPFLTLGAAYMYPSLAAAKAAIISVGEEIATEGLPSGICPLVFVFTGSGHASIAAQELFKLLPHTFVDPSRLPELFE 241 (452)
Q Consensus 162 ~~~~P~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~G~~~~i~p~kv~V~G~G~vg~gAi~~a~~LGa~vv~~~~l~~~~e 241 (452)
++.+|||.++++|+|+|+++++++|++.|++|+.+|+|.+++|++|+|+|+|+||.||+++|..|||+.++|.+|+++.+
T Consensus 161 ~~~~pf~~l~~~~~y~~~~~~~~a~~~~G~~i~~~g~p~gv~P~~vVi~G~G~Vg~gA~~i~~~lg~~~v~~~~l~~l~~ 240 (1042)
T PLN02819 161 GYSTPFLSLGSSYMYSSLAAAKAAVISVGEEIASSGLPLGICPLVFVFTGSGNVSQGAQEIFKLLPHTFVEPSKLPELKG 240 (1042)
T ss_pred cCCCcccccccccccCCHHHHHHHHHhccceeeccCCCCCCCCeEEEEeCCchHHHHHHHHHhhcCCCccCHHHHHHHHH
Confidence 99999999999999999999999999999999999998899999999999999999999999999999999999998863
Q ss_pred hhCCCCCccccCCCCceeEEEeeeeecccccccCCCCCCCcccccccCcCCcCcchHhhhcCCCcEEEeccccCCCCCcc
Q 012946 242 KAGDSSQSTCSSSTKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIFHEKIAPYASAIINCIYWEKQFPRL 321 (452)
Q Consensus 242 ~~~~~~~~~~~~~~~~~~~v~~~~~~~~d~~~~~~~~~~~~~~~~~~~~e~y~~~f~~~~~~~~DIvIn~a~~~~~~P~L 321 (452)
.++ + . ....+++++|+|.+..||++++++.++.|+++|||+|||.|.+.|++++++++||||||++|..++|+|
T Consensus 241 ~~~---~-~--~~~~~~~~~y~~~~~~~~~~~~~~~~~~f~~~~y~~~Pe~y~s~F~~~~~~~advlIn~i~~~~~~P~l 314 (1042)
T PLN02819 241 ISQ---N-K--ISTKRVYQVYGCVVTSQDMVEHKDPSKQFDKADYYAHPEHYNPVFHEKIAPYASVIVNCMYWEKRFPRL 314 (1042)
T ss_pred hhc---C-C--ccccccceeeeeecChHHHhhccCCccccchhhhccCchhccchhHHHhHhhCCEEEeeeecCCCCCce
Confidence 210 0 0 111334458999999999999998677999999999999999999999999999999999999999999
Q ss_pred cCHH-HHHHhhcCCCCeEEEEEeeecCCCCeeeecccccCCCCEEEeCCCCCCCCCCCCCCCeEEEeeCCcCCcchHHHH
Q 012946 322 LSTQ-QLRDLAQKGCPLVGISDLTCDMEGSIEILNQTTTIDSPFFRYDPKNDSYHHDMEGDGIICSVVDNLPTEFPKEAS 400 (452)
Q Consensus 322 it~e-~l~~mk~gs~~l~vIvDvs~D~gG~iE~~~~~Tt~~~P~~~~~~~~~~~~~~~~~~gV~~~~vdnLPs~lp~~AS 400 (452)
||++ |++.||+|++||+||||||||+||||||+.++|||++|+|.|||.+++.+|++..+||+||||||||++||++||
T Consensus 315 vt~~~~~~~mk~G~~~l~vI~DVs~D~gG~ie~~~~~Tt~~~P~~~~~~~~~~~~~~~~~~gv~~~~VdNlP~~lPr~AS 394 (1042)
T PLN02819 315 LTTKQLQDLTRKGGCPLVGVCDITCDIGGSIEFLNKTTSIEKPFFRYNPSNNSYHDDMDGDGILCMAVDILPTEFAKEAS 394 (1042)
T ss_pred eCHHHHHHhhcCCCccceEEEEEccCCCCCeeecccCCCCcCCeEeecccccccccccCCCCeEEEEECCccccCHHHHH
Confidence 9999 777889999999999999999999999988999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhhcccccccCCHHHHhchhhcCCeecCCCCchHHhhhC
Q 012946 401 QHFGGLLSQFIGSLASVADIAKLPGNLRRACIAHGGALTSLYEYIPTMRNS 451 (452)
Q Consensus 401 ~~fs~~l~~~l~~l~~~~~~~~~~~~l~~a~i~~~G~lt~~~~yl~~~~~~ 451 (452)
++||++|+|||..|++.+.....++.|++|+++++|+||++|+||++||+.
T Consensus 395 ~~f~n~llpyv~~la~~g~~~~~~~~l~~a~~~~~G~lT~~~~yi~~~~~~ 445 (1042)
T PLN02819 395 QHFGNILSPFVGSLASMKELAELPSHLRRACIAHRGSLTPLFEYIPRMRNS 445 (1042)
T ss_pred HHHHHHHHHHHHHHHhCCchhccCHHHhcceeeeCCEecCchHHHHHHHhc
Confidence 999999999999999776422679999999999999999999999999985
|
|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 452 | ||||
| 2q99_A | 381 | Crystal Structure Of Saccharopine Dehydrogenase Fro | 7e-07 | ||
| 3ugk_A | 373 | Crystal Structure Of C205s Mutant And Saccharopine | 1e-06 | ||
| 2qrj_A | 394 | Crystal Structure Of Sulfate-Bound Saccharopine Deh | 1e-06 |
| >pdb|2Q99|A Chain A, Crystal Structure Of Saccharopine Dehydrogenase From Saccharomyces Cerevisiae Length = 381 | Back alignment and structure |
|
| >pdb|3UGK|A Chain A, Crystal Structure Of C205s Mutant And Saccharopine Dehydrogenase From Saccharomyces Cerevisiae. Length = 373 | Back alignment and structure |
| >pdb|2QRJ|A Chain A, Crystal Structure Of Sulfate-Bound Saccharopine Dehydrogenase (L-Lys Forming) From Saccharomyces Cerevisiae Length = 394 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 452 | |||
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 5e-72 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 2e-07 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 2e-07 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 1e-06 |
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Length = 394 | Back alignment and structure |
|---|
Score = 231 bits (590), Expect = 5e-72
Identities = 86/435 (19%), Positives = 138/435 (31%), Gaps = 91/435 (20%)
Query: 6 VVGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQPSTKRIFNDAQYEEAGCE 65
+ + AET E RA LTP+ +L+ G +I V+ S + FN +Y +AG
Sbjct: 26 TLHLRAETKP-LEARAALTPTTVKKLIAKG------FKIYVEDSPQSTFNINEYRQAGAI 78
Query: 66 ITSDLSE-----CGLILGIKK-PKLEMILPDRAYAFFSHTHKAQPENMALLDKILAQRVS 119
I S +I+G+K+ P+ + + F+H +K Q +L + + +
Sbjct: 79 IVPAGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGT 138
Query: 120 LFDYELVEGNQGKRRLIAFGKFAGRAAIIDLLKGLGQRYLNLGYSTPFLTLGAAYMYPSL 179
L+D E +E N RR+ AFG +AG A ++ + + L A YP+
Sbjct: 139 LYDLEFLE-NDQGRRVAAFGFYAGFAGAALGVRDWAFKQTHSD----DEDLPAVSPYPN- 192
Query: 180 AAAKAAIISVGEEIATEGLPSGICPLVFVFTGSGHASIAAQELFKLLPHTFVDPSRLPEL 239
KA + V ++ P V + G A +L +
Sbjct: 193 --EKALVKDVTKDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDA-------- 242
Query: 240 FEKAGDSSQSTCSSSTKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIFHE 299
+ D + E
Sbjct: 243 -------------------------------NILKWDIKETSRGGPFDEI---------- 261
Query: 300 KIAPYASAIINCIYWEKQFPRLLSTQQLRDLAQKGCPLVGISDLTCDMEG---SIEILNQ 356
P A INCIY K + L L + D++ D I I
Sbjct: 262 ---PQADIFINCIYLSKPIAPFTNM---EKLNNPNRRLRTVVDVSADTTNPHNPIPIYTV 315
Query: 357 TTTIDSPFFRYDPKNDSYHHDMEGDGIICSVVDNLPTEFPKEASQHFGGLLSQFIGSLAS 416
T + P G + +D+LP+ P+EAS+ F L + L
Sbjct: 316 ATVFNKPTVLV--------PTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQ 367
Query: 417 VADIAKLPGNLRRAC 431
RA
Sbjct: 368 RKT----APVWVRAK 378
|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Length = 401 | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Length = 381 | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Length = 405 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Length = 384 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 452 | |||
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 100.0 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 100.0 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 100.0 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 100.0 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 100.0 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 100.0 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 100.0 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 100.0 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 99.75 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 99.64 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 99.3 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 99.19 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 98.11 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 98.09 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 97.97 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 97.95 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 97.95 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 97.88 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 97.87 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 97.76 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 97.71 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 97.63 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 97.59 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 97.57 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 97.52 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 97.51 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 97.5 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 97.43 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 97.24 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 97.18 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 97.13 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 97.12 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 97.11 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 97.11 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 97.08 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 97.08 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 97.04 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 97.01 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 97.01 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 96.99 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 96.98 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 96.95 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 96.94 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 96.9 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 96.85 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 96.8 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 96.8 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 96.8 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 96.75 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 96.75 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 96.73 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 96.71 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 96.69 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 96.68 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 96.67 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 96.67 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 96.66 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 96.66 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 96.64 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 96.58 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 96.36 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 96.31 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 96.26 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 96.23 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 96.18 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 96.14 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 96.11 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 95.93 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 95.9 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 95.89 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 95.83 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 95.81 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 95.75 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.67 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 95.59 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 95.58 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 95.56 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.47 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 95.41 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.33 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 95.15 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 95.14 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 94.88 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 94.69 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 94.62 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 94.51 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 94.49 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 94.36 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 94.31 | |
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 94.3 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 93.66 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 93.61 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 93.56 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.24 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 93.24 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 93.19 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 93.12 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 93.02 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 92.97 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 92.91 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 92.56 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 92.49 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 92.46 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 92.3 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 92.29 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 92.16 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 91.78 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 91.07 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 90.71 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 90.48 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 90.42 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 90.13 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 90.11 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 90.01 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 89.94 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 89.79 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 89.67 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 89.53 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 89.4 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 89.26 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 89.24 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 89.18 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 88.9 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 88.67 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 88.22 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 88.12 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 88.06 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 87.93 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 87.93 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 87.89 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 87.84 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 87.78 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 87.72 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 87.52 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 87.28 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 87.24 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 86.81 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 86.8 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 86.58 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 86.45 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 86.37 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 86.19 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 85.99 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 85.95 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 85.79 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 85.78 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 85.74 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 85.73 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 85.52 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 85.17 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 85.03 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 85.01 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 84.39 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 84.27 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 83.87 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 83.82 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 83.73 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 83.65 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 83.64 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 83.63 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 83.5 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 83.34 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 82.99 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 82.78 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 82.72 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 82.64 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 82.41 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 82.39 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 81.75 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 81.64 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 81.6 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 81.59 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 81.39 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 81.16 | |
| 1pg5_A | 299 | Aspartate carbamoyltransferase; 2.60A {Sulfolobus | 81.14 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 80.98 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 80.9 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 80.88 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 80.77 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 80.75 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 80.69 | |
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 80.62 | |
| 2i6u_A | 307 | Otcase, ornithine carbamoyltransferase; X-RAY crys | 80.62 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 80.54 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 80.43 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 80.36 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 80.35 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 80.34 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 80.33 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 80.03 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 80.01 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 80.01 |
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-76 Score=608.39 Aligned_cols=347 Identities=23% Similarity=0.299 Sum_probs=290.6
Q ss_pred CCCcEEEEeeccCCCCCcceecChHHHHHHHHcCCCCCCeeEEEEcCCCCCCCCchhhhhcCcEEccc-cc-c--ccE-E
Q 012946 2 LDNGVVGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQPSTKRIFNDAQYEEAGCEITSD-LS-E--CGL-I 76 (452)
Q Consensus 2 ~~~~~IGi~kE~~~~~ErRvaLtP~~v~~L~~~G~~~~~~~~V~VE~gag~~FsD~eY~~aGa~I~~~-~~-~--~di-I 76 (452)
|++|+||||||++ +||+||||||++|++|+++|| +|+||+|++++|+|++|++|||+|+++ +| + ||+ |
T Consensus 22 m~~m~IGvpkE~k-~~E~RValtP~~V~~L~~~G~------~V~VE~gA~a~f~D~~Y~~AGA~I~~~~~~~~a~aDi~I 94 (394)
T 2qrj_A 22 MAAVTLHLRAETK-PLEARAALTPTTVKKLIAKGF------KIYVEDSPQSTFNINEYRQAGAIIVPAGSWKTAPRDRII 94 (394)
T ss_dssp --CCEEEECCCCS-TTCCCCSSCHHHHHHHHHTTC------EEEEECCSSCSSCHHHHHHTTCEEECTTGGGGSCTTSEE
T ss_pred CcceEEEEEcCCC-CCCceeccCHHHHHHHHhCCC------EEEEeCCCCCCCCHHHHHhCCcEEechhhhhcCCCCeEE
Confidence 3568999999999 599999999999999999995 999999999999999999999999975 44 3 886 9
Q ss_pred EEecCCCc-ccccCCCceEEEecccCCCCCCHHHHHHHHHcCCeEEEeecccccCCCccccchhHHHHHHHHHHHHHHHH
Q 012946 77 LGIKKPKL-EMILPDRAYAFFSHTHKAQPENMALLDKILAQRVSLFDYELVEGNQGKRRLIAFGKFAGRAAIIDLLKGLG 155 (452)
Q Consensus 77 l~Vkep~~-~~l~~~~~~~~fs~~~~~q~~n~~ll~~l~~k~it~i~~E~i~~~~g~~~L~s~~~~AG~~avi~al~~~g 155 (452)
||||||++ +++.+++++++|+|+|++|++|++++++|+++|+|+||||.|++++|+| |++||+||||+|+++|++.||
T Consensus 95 lkVkeP~~~~e~~~~~~~i~f~~~~~~q~~~~~l~~~l~~~~it~ia~E~v~~~~g~r-L~sf~~iAG~~av~~a~~~lg 173 (394)
T 2qrj_A 95 IGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLEFLENDQGRR-VAAFGFYAGFAGAALGVRDWA 173 (394)
T ss_dssp ECSSCCCTTCCSCCCSEEEECCCCSSCCTTHHHHHHHHHHHTCEEEEGGGCBCTTSCB-SCCCHHHHHHHHHHHHHHHHH
T ss_pred EEECCCCcHHhhccCCcEEEEechhhccccCHHHHHHHHHCCCeEEEeeccCcCCCCE-EeehhhHhHHHHHHHHHHHHH
Confidence 99999999 9998899999999999998889999999999999999999999999988 999999999999999999999
Q ss_pred HHHhhcCCCCCcccccccccCccHHHHHHHHHHhhHHHHhcCCCCCCCCceEEEEcC-cHHHHHHHHHHhcCCC---EEe
Q 012946 156 QRYLNLGYSTPFLTLGAAYMYPSLAAAKAAIISVGEEIATEGLPSGICPLVFVFTGS-GHASIAAQELFKLLPH---TFV 231 (452)
Q Consensus 156 ~~~l~~~~~~P~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~G~~~~i~p~kv~V~G~-G~vg~gAi~~a~~LGa---~vv 231 (452)
.+++..+. .+| +....|.|..++++++++. +..++. .+.+|+||+|||+ |+||++|+++|++||| .|
T Consensus 174 ~~~~g~~g-~~l---~~~~pm~s~~al~q~~~~~---l~~~~~-~g~~~~kV~ViG~~G~vG~~A~~~a~~lGa~~~~V- 244 (394)
T 2qrj_A 174 FKQTHSDD-EDL---PAVSPYPNEKALVKDVTKD---YKEALA-TGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANI- 244 (394)
T ss_dssp HHHHSCTT-CCC---CCCCCCSSHHHHHHHHHHH---HHHHHT-TTCCCCCEEEETTTSHHHHHHHHHHHHTTCCGGGE-
T ss_pred HhhcCCcc-ccC---CCccCccCHHHHHHHHHHH---Hhhhhc-cCCCCCeEEEEcCCCHHHHHHHHHHHhCCCCcCce-
Confidence 99876532 132 2333477877766666654 332111 2448999999999 9999999999999997 33
Q ss_pred CCCChhhHHhhhCCCCCccccCCCCceeEEEeeeeecccccccCCCCCCCcccccccCcCCcCcchHhhhcCCCcEEEec
Q 012946 232 DPSRLPELFEKAGDSSQSTCSSSTKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIFHEKIAPYASAIINC 311 (452)
Q Consensus 232 ~~~~l~~~~e~~~~~~~~~~~~~~~~~~~v~~~~~~~~d~~~~~~~~~~~~~~~~~~~~e~y~~~f~~~~~~~~DIvIn~ 311 (452)
..+|+.++..|+ +| +.++++||||||
T Consensus 245 -----------------------------------~v~D~~~~~~g~-~~------------------~~i~~aDivIn~ 270 (394)
T 2qrj_A 245 -----------------------------------LKWDIKETSRGG-PF------------------DEIPQADIFINC 270 (394)
T ss_dssp -----------------------------------EEECHHHHTTCS-CC------------------THHHHSSEEEEC
T ss_pred -----------------------------------EEeeccccccCC-ch------------------hhHhhCCEEEEC
Confidence 112332222221 22 235589999999
Q ss_pred cccCCCCCcccCHHHHHHh-hcCCCCeEEEEEeeecCCCCeeee---cccccCCCCEEEeCCCCCCCCCCCCCCCeEEEe
Q 012946 312 IYWEKQFPRLLSTQQLRDL-AQKGCPLVGISDLTCDMEGSIEIL---NQTTTIDSPFFRYDPKNDSYHHDMEGDGIICSV 387 (452)
Q Consensus 312 a~~~~~~P~Lit~e~l~~m-k~gs~~l~vIvDvs~D~gG~iE~~---~~~Tt~~~P~~~~~~~~~~~~~~~~~~gV~~~~ 387 (452)
++|..++|+|||+||+++| |||+ ||||||||+|||||++ +++||+++|+|.++..+ +++|+|||
T Consensus 271 vlig~~aP~Lvt~e~v~~m~k~gs----VIVDVA~D~GG~~et~~f~~~~Tt~~~P~~~~~g~~--------~~~V~~~~ 338 (394)
T 2qrj_A 271 IYLSKPIAPFTNMEKLNNPNRRLR----TVVDVSADTTNPHNPIPIYTVATVFNKPTVLVPTTA--------GPKLSVIS 338 (394)
T ss_dssp CCCCSSCCCSCCHHHHCCTTCCCC----EEEETTCCTTCTTCSSCSCCCCCBTTBCCEEECCSS--------SSCEEEEC
T ss_pred cCcCCCCCcccCHHHHhcCcCCCe----EEEEEecCCCCCcCcccccccCCccCCCEEEECCCC--------CCCEEEEE
Confidence 9997799999999999999 9999 9999999999999973 29999999999987321 35699999
Q ss_pred eCCcCCcchHHHHHHHHHHHHHHHHHhhcccccccCCHHHHhchhhcC
Q 012946 388 VDNLPTEFPKEASQHFGGLLSQFIGSLASVADIAKLPGNLRRACIAHG 435 (452)
Q Consensus 388 vdnLPs~lp~~AS~~fs~~l~~~l~~l~~~~~~~~~~~~l~~a~i~~~ 435 (452)
|||||++||++||++||++++|||..|++. ..+.++++|.+..+
T Consensus 339 v~nlP~~lPrtAS~~~sn~llp~l~~l~~~----~~~~v~~~A~~~~~ 382 (394)
T 2qrj_A 339 IDHLPSLLPREASEFFSHDLLPSLELLPQR----KTAPVWVRAKKLFD 382 (394)
T ss_dssp CTTGGGGSHHHHHHHHHHHHHHHHHTCTTT----TTCHHHHHHHHHHH
T ss_pred eCChhhhhHHHHHHHHHHHHHHHHHHHhcc----CccHHHHHHHHHhh
Confidence 999999999999999999999999999876 45778888876644
|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
| >2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 452 | ||||
| d1pjca2 | 193 | c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogen | 1e-08 |
| >d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Length = 193 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Formate/glycerate dehydrogenase catalytic domain-like family: L-alanine dehydrogenase-like domain: L-alanine dehydrogenase species: Phormidium lapideum [TaxId: 32060]
Score = 52.7 bits (126), Expect = 1e-08
Identities = 30/165 (18%), Positives = 54/165 (32%), Gaps = 20/165 (12%)
Query: 7 VGILAETSNKWERRAPLTPSHCSRLLLAGRQKSGVARILVQ--PSTKRIFNDAQYEEAGC 64
+G+ E N+ E R L+PS L+ AG + ++ F D Y +AG
Sbjct: 3 IGVPKEIKNQ-EFRVGLSPSSVRTLVEAG------HTVFIETQAGIGAGFADQDYVQAGA 55
Query: 65 EITSDLSECGLILGIKKPK------LEMILPDRAYAFFSHTHKAQPENMALLDKILAQRV 118
++ + + K K +++ D+ + H A+ L+ +
Sbjct: 56 QVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRV----GL 111
Query: 119 SLFDYELVEGNQGKRRLI-AFGKFAGRAAIIDLLKGLGQRYLNLG 162
+ YE VE L+ A L + L
Sbjct: 112 TAIAYETVELPNRSLPLLTPMSIIVPWTATQALNNSTLPYVVKLA 156
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 452 | |||
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 100.0 | |
| d1l7da2 | 194 | Nicotinamide nucleotide transhydrogenase dI compon | 100.0 | |
| d1pjca2 | 193 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 100.0 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 100.0 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 97.8 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 97.8 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 97.74 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 97.57 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 97.47 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 97.38 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 97.36 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 97.36 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 97.21 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 97.13 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 97.0 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 96.71 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 96.66 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.25 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 95.6 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 95.47 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 95.44 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 95.23 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 95.12 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 95.07 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 94.99 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 94.68 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 94.64 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 94.56 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 94.41 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 94.24 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 94.19 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 94.05 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 93.91 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 93.68 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 93.57 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.52 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 93.31 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 93.25 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 93.12 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 93.03 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 92.73 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 92.72 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 92.56 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 92.53 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 92.52 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 92.44 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 92.33 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 91.95 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 91.6 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 91.53 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 91.43 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 91.4 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 91.14 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 91.05 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 90.81 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 90.77 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 90.76 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 90.7 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 90.61 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 90.39 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 90.36 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 90.26 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 90.15 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 90.08 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 90.05 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 89.56 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 89.52 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 89.42 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 89.3 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 88.85 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 88.76 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 88.63 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 88.59 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 88.11 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 87.78 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 87.46 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 87.43 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 87.35 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 87.34 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 87.26 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 87.17 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 87.11 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 86.99 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 86.71 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 86.7 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 86.23 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 85.84 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 85.58 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 85.39 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 85.38 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 85.37 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 85.34 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 85.15 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 84.59 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 84.53 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 84.37 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 84.16 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 84.14 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 84.12 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 83.93 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 83.92 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 83.91 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 83.75 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 83.73 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 83.71 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 83.35 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 83.34 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 83.12 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 83.1 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 82.95 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 82.93 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 82.77 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 82.66 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 82.64 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 82.61 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 82.16 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 82.14 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 82.14 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 81.99 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 81.78 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 81.63 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 81.45 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 81.45 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 81.44 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 81.35 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 81.24 | |
| d1l7da2 | 194 | Nicotinamide nucleotide transhydrogenase dI compon | 81.15 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 80.97 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 80.79 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 80.72 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 80.61 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 80.57 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 80.52 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 80.44 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 80.26 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 80.2 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 80.11 |
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Formate/glycerate dehydrogenases, NAD-domain domain: L-alanine dehydrogenase species: Phormidium lapideum [TaxId: 32060]
Probab=100.00 E-value=1.6e-40 Score=301.88 Aligned_cols=163 Identities=23% Similarity=0.332 Sum_probs=135.7
Q ss_pred HHHHHHHHHHHHHHHHHhhcCCCCCcccccccccCccHHHHHHHHHHhhHHHHhcCCCCCCCCceEEEEcCcHHHHHHHH
Q 012946 142 AGRAAIIDLLKGLGQRYLNLGYSTPFLTLGAAYMYPSLAAAKAAIISVGEEIATEGLPSGICPLVFVFTGSGHASIAAQE 221 (452)
Q Consensus 142 AG~~avi~al~~~g~~~l~~~~~~P~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~G~~~~i~p~kv~V~G~G~vg~gAi~ 221 (452)
|||.+++ +|+++|.+.++ |++++.+|+| +++|++|+|+|+|+||++|++
T Consensus 1 AG~~av~-----~ga~~L~~~~g-------------------------G~G~Llgg~~-gv~pa~V~ViGaGvaG~~A~~ 49 (168)
T d1pjca1 1 AGRLSVQ-----FGARFLERQQG-------------------------GRGVLLGGVP-GVKPGKVVILGGGVVGTEAAK 49 (168)
T ss_dssp HHHHHHH-----HHHHHTSGGGT-------------------------SCCCCTTCBT-TBCCCEEEEECCSHHHHHHHH
T ss_pred CcHHHHH-----HHHHHhhhhcC-------------------------CcEEEecCCC-CCCCcEEEEECCChHHHHHHH
Confidence 8999999 58888876554 6778888885 799999999999999999999
Q ss_pred HHhcCCCEE----eCCCChhhHHhhhCCCCCccccCCCCceeEEEeeeeecccccccCCCCCCCcccccccCcCCcCcch
Q 012946 222 LFKLLPHTF----VDPSRLPELFEKAGDSSQSTCSSSTKRVFQVYGCVVTSENMVEPKDSSRAFDKNDYYEHPEQYNPIF 297 (452)
Q Consensus 222 ~a~~LGa~v----v~~~~l~~~~e~~~~~~~~~~~~~~~~~~~v~~~~~~~~d~~~~~~~~~~~~~~~~~~~~e~y~~~f 297 (452)
+|++|||+| +++++++++... ++.+... .+.+++ .
T Consensus 50 ~A~~lGA~V~~~D~~~~~l~~l~~~-----------~~~~~~~-------------------------~~~~~~-----~ 88 (168)
T d1pjca1 50 MAVGLGAQVQIFDINVERLSYLETL-----------FGSRVEL-------------------------LYSNSA-----E 88 (168)
T ss_dssp HHHHTTCEEEEEESCHHHHHHHHHH-----------HGGGSEE-------------------------EECCHH-----H
T ss_pred HHhhCCCEEEEEeCcHHHHHHHHHh-----------hccccee-------------------------ehhhhh-----h
Confidence 999999988 455556666622 1222111 112222 2
Q ss_pred HhhhcCCCcEEEeccccCC-CCCcccCHHHHHHhhcCCCCeEEEEEeeecCCCCeeeecccccCCCCEEEeCCCCCCCCC
Q 012946 298 HEKIAPYASAIINCIYWEK-QFPRLLSTQQLRDLAQKGCPLVGISDLTCDMEGSIEILNQTTTIDSPFFRYDPKNDSYHH 376 (452)
Q Consensus 298 ~~~~~~~~DIvIn~a~~~~-~~P~Lit~e~l~~mk~gs~~l~vIvDvs~D~gG~iE~~~~~Tt~~~P~~~~~~~~~~~~~ 376 (452)
+++.++++||||+|++||+ ++|+|||++||++||||| ||||||||+|||||+ ++|||+++|+|.++
T Consensus 89 l~~~~~~aDivI~aalipG~~aP~lIt~~mv~~Mk~GS----VIVDvaidqGG~~Et-s~ptt~~~p~~~~~-------- 155 (168)
T d1pjca1 89 IETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGS----VIVDVAVDQGGCVET-LHPTSHTQPTYEVF-------- 155 (168)
T ss_dssp HHHHHHTCSEEEECCCCTTSSCCCCBCHHHHTTSCTTC----EEEETTCTTCCSBTT-CCCCCSSSCEEEET--------
T ss_pred HHHhhccCcEEEEeeecCCcccCeeecHHHHhhcCCCc----EEEEeecCCCCcccc-CCCCcccCCeEEEC--------
Confidence 3778899999999999995 999999999999999999 999999999999999 79999999999975
Q ss_pred CCCCCCeEEEeeCCcCCc
Q 012946 377 DMEGDGIICSVVDNLPTE 394 (452)
Q Consensus 377 ~~~~~gV~~~~vdnLPs~ 394 (452)
||+|||++|||+.
T Consensus 156 -----gV~~y~v~N~Pga 168 (168)
T d1pjca1 156 -----GVVHYGVPNMPGA 168 (168)
T ss_dssp -----TEEEECCSCGGGG
T ss_pred -----CEEEEecCCCCCC
Confidence 9999999999973
|
| >d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|