Citrus Sinensis ID: 013000

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-
MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
ccHHHHHHHHcccccccccEEEEEcccccccccccccccccccccEEEccHHHHHHHHHcccHHHHHHHHcccccEEEEEccccccEEEEccccccccccEEEEccHHHHHHHHHHHHcccccEEEcccEEEEEEEccccccccccccccccccccccccEEEEcccccEEEEcEEEEEcccccHHHHHHcccccccccccEEEEEEEEEcccccEEEEEEcccccEEEcccccccEEEEEcccHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccHHHHccccEEEEccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccc
cHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccEEEccHHHHHHHHHccHHHHHHHHHccHHHccEEEcccccEEEEEcHHHccccHccHEHHHHHHHHHHHHHHHHccccEEEcccHEEEEEcccccccccccccccHHHHccccccEEEEEccccEEEEEEEEEcccccHHHHHHcccccEcEccccEEEEEEEEcccccccEEEEEcccccEEEEcccccccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHcccccccccccccccEEEEEccccccccccHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccc
MVGMALACSlasmpltkHLSVAIidsnpalgksnfikkedppdprvstvtpaTISFFKEIGAWQYVQQHRHAYFDKMqvwdytglgytkynardvNKEILGCVVENKVLHSSLLScmqntefqktiypsrltsmallpssssisvdstpsattlftkghlakldlsdgtsLYAKLVVGADGGKSRVRELAGfkttgwsysQNAIICTVEHNKENYCAWqrflpagpiallpigdnfsnivwtmnpkdasdcksmneDDFVKILNHAldygygphpksissgsvdmfswfrgdatlsakecfevpprVVKLASermvfplslkhannyvsKRVVLIGDaahtvhplagqgvnlgfgdasTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQkaysvdfgplNILRAAAFHgaqyisplkrniisyasgeqrlplplplft
MVGMALACSLASMPLTKHLSVAIIDSNPALGKsnfikkedppdprvSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLvvgadggksRVRELAgfkttgwsysqNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISyasgeqrlplplplft
MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRltsmallpssssisvdstpsatTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
*****LACSLASMPLTKHLSVAIIDS*********************TVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLT********************TLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYAS*************
MVGMALACSLASMPLTKHLSVAIIDSNPAL**********PPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLF*
MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPS**********SATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query451 2.2.26 [Sep-21-2011]
Q6DF46464 Ubiquinone biosynthesis m yes no 0.922 0.896 0.339 8e-68
Q8R1S0476 Ubiquinone biosynthesis m yes no 0.915 0.867 0.35 3e-66
Q68FU7476 Ubiquinone biosynthesis m yes no 0.915 0.867 0.345 3e-65
Q9Y2Z9468 Ubiquinone biosynthesis m yes no 0.913 0.880 0.335 1e-64
F1RAX8484 Ubiquinone biosynthesis m yes no 0.924 0.861 0.323 3e-64
Q2KIL4469 Ubiquinone biosynthesis m yes no 0.915 0.880 0.343 2e-63
Q54EN1495 Ubiquinone biosynthesis m yes no 0.944 0.860 0.319 3e-58
O01884451 Probable ubiquinone biosy yes no 0.931 0.931 0.289 5e-52
Q9VMQ5477 Putative ubiquinone biosy yes no 0.922 0.872 0.290 1e-50
P25535400 Protein VisC OS=Escherich N/A no 0.847 0.955 0.293 7e-50
>sp|Q6DF46|COQ6_XENTR Ubiquinone biosynthesis monooxygenase COQ6 OS=Xenopus tropicalis GN=coq6 PE=2 SV=1 Back     alignment and function desciption
 Score =  258 bits (658), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 151/445 (33%), Positives = 249/445 (55%), Gaps = 29/445 (6%)

Query: 1   MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEI 60
           MVG A+AC+L S P  +H  V ++++     +  F    +    RVS++TP + +     
Sbjct: 41  MVGTAMACALGSDPHLQHKKVLLLEAG---NRKPFDHLPENFSNRVSSITPGSATLLASF 97

Query: 61  GAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQ-N 119
           GAW ++   R   + +MQVWD        ++   +  E +G +VEN ++  +L   ++  
Sbjct: 98  GAWDHILAMRLKPYKRMQVWDACSDALITFDKDAL--EDMGYIVENDIIIEALTKQLELM 155

Query: 120 TEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGA 179
           ++  + +Y SR  S +  P  ++    +TP            +++L+DG  L+ KL++GA
Sbjct: 156 SDHVEVMYRSRALSYSWPPPYNN--GKATP----------WVEIELADGQRLHTKLLIGA 203

Query: 180 DGGKSRVRELAGFKTTGWSYSQNAIICTVEHNK--ENYCAWQRFLPAGPIALLPIGDNFS 237
           DG  S VR  AG ++  W+Y+  A++ T+  ++  +N  AWQRFLP GPIALLP+ D  S
Sbjct: 204 DGHNSMVRSAAGMQSVQWNYNHAAVVATLHLSEATDNNVAWQRFLPTGPIALLPLSDTCS 263

Query: 238 NIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISS-GSV--DMFSWFRGDAT 294
           ++VW+ +P+ AS+  SM+E+ FV  +N A  +    H + I+S GS+     S+F     
Sbjct: 264 SLVWSTSPEHASELVSMDEESFVDTVNSAF-WSNENHSEFITSAGSLLHSALSFFMP--- 319

Query: 295 LSAKECFEVPPRVVKLA-SERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLG 353
            +     ++PP V ++  + R  FPL LKHA  Y+  RV LIGDAAH VHPLAGQGVN+G
Sbjct: 320 -TGSSPRQLPPSVSRVEQNSRASFPLGLKHATEYIRHRVALIGDAAHRVHPLAGQGVNMG 378

Query: 354 FGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLN 413
           FGD + L+  +++    G+D+G    L +YE ER+  N+ +MA +D  ++ Y+    P+ 
Sbjct: 379 FGDVACLAHHLSQAAFNGSDLGSTKHLLEYETERQRHNLPLMAAVDLLKRLYNTKQPPIV 438

Query: 414 ILRAAAFHGAQYISPLKRNIISYAS 438
           +LR         ++P+K  I+++AS
Sbjct: 439 LLRTLGLQATNALTPVKEQIMAFAS 463

Xenopus tropicalis (taxid: 8364)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|Q8R1S0|COQ6_MOUSE Ubiquinone biosynthesis monooxygenase COQ6 OS=Mus musculus GN=Coq6 PE=2 SV=3 Back     alignment and function description
>sp|Q68FU7|COQ6_RAT Ubiquinone biosynthesis monooxygenase COQ6 OS=Rattus norvegicus GN=Coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2Z9|COQ6_HUMAN Ubiquinone biosynthesis monooxygenase COQ6 OS=Homo sapiens GN=COQ6 PE=1 SV=2 Back     alignment and function description
>sp|F1RAX8|COQ6_DANRE Ubiquinone biosynthesis monooxygenase COQ6 OS=Danio rerio GN=coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q2KIL4|COQ6_BOVIN Ubiquinone biosynthesis monooxygenase COQ6 OS=Bos taurus GN=COQ6 PE=2 SV=2 Back     alignment and function description
>sp|Q54EN1|COQ6_DICDI Ubiquinone biosynthesis monooxygenase COQ6 homolog OS=Dictyostelium discoideum GN=coq6 PE=3 SV=1 Back     alignment and function description
>sp|O01884|COQ6_CAEEL Probable ubiquinone biosynthesis monooxygenase coq-6 OS=Caenorhabditis elegans GN=coq-6 PE=3 SV=2 Back     alignment and function description
>sp|Q9VMQ5|COQ6_DROME Putative ubiquinone biosynthesis monooxygenase COQ6 OS=Drosophila melanogaster GN=CG7277 PE=2 SV=1 Back     alignment and function description
>sp|P25535|VISC_ECOLI Protein VisC OS=Escherichia coli (strain K12) GN=visC PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query451
255554178515 monoxygenase, putative [Ricinus communis 0.986 0.864 0.806 0.0
224057583447 predicted protein [Populus trichocarpa] 0.986 0.995 0.817 0.0
359494703525 PREDICTED: ubiquinone biosynthesis monoo 0.966 0.830 0.793 0.0
449524910510 PREDICTED: ubiquinone biosynthesis monoo 0.986 0.872 0.784 0.0
449457604510 PREDICTED: ubiquinone biosynthesis monoo 0.986 0.872 0.782 0.0
79416711505 ubiquinone biosynthesis monooxygenase Co 0.982 0.877 0.748 0.0
79313357507 ubiquinone biosynthesis monooxygenase Co 0.982 0.873 0.748 0.0
51968852505 monooxygenase, putatve [Arabidopsis thal 0.982 0.877 0.746 0.0
297831190505 monooxygenase [Arabidopsis lyrata subsp. 0.982 0.877 0.734 0.0
357450969509 Ubiquinone biosynthesis monooxygenase CO 0.986 0.874 0.725 0.0
>gi|255554178|ref|XP_002518129.1| monoxygenase, putative [Ricinus communis] gi|223542725|gb|EEF44262.1| monoxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/445 (80%), Positives = 395/445 (88%)

Query: 1   MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEI 60
           MVGMA  CSLA+ PLTKHL+VAIIDSNPALG    I +ED PDPRVSTVTPATISFFK+I
Sbjct: 69  MVGMAFTCSLATTPLTKHLNVAIIDSNPALGSKFSINREDSPDPRVSTVTPATISFFKDI 128

Query: 61  GAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNT 120
           GAWQYVQQHRHAYFDKMQVWDYTGLGYTKY+ARD NK+ LGCVVENKVLHSSLLS +++T
Sbjct: 129 GAWQYVQQHRHAYFDKMQVWDYTGLGYTKYSARDANKDNLGCVVENKVLHSSLLSRVEDT 188

Query: 121 EFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGAD 180
           +FQKTIYPSRLT+M+L  SSSS  VDST SA  L+ KG LAKL+LS G+SLYAKLVVGAD
Sbjct: 189 DFQKTIYPSRLTTMSLHQSSSSTEVDSTSSAEALYIKGRLAKLELSAGSSLYAKLVVGAD 248

Query: 181 GGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIV 240
           GGKS+VRELAGFKTTGW+YSQNA+ICTVEH+ EN CAWQRFLP+GPIALLPIGD FSNIV
Sbjct: 249 GGKSQVRELAGFKTTGWNYSQNAVICTVEHSVENRCAWQRFLPSGPIALLPIGDKFSNIV 308

Query: 241 WTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKEC 300
           WTMNPK++SDCKSMNEDDFVK +NHALD+GYGPHPKS      +MF+W  G++ +SA E 
Sbjct: 309 WTMNPKESSDCKSMNEDDFVKAVNHALDHGYGPHPKSSLFDGANMFTWLSGNSVVSANES 368

Query: 301 FEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTL 360
           FEVPP+VVKLAS R+ FPLSL HA NY SKR+ LIGDAAHTVHPLAGQGVNLGFGDA  L
Sbjct: 369 FEVPPKVVKLASARLAFPLSLMHAKNYTSKRIALIGDAAHTVHPLAGQGVNLGFGDAFAL 428

Query: 361 SRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAF 420
           SRIIAEGIAVG DIGE SLLKKYEAERKPAN+ MMA+LDGFQKAYSVD GPLNILRAAAF
Sbjct: 429 SRIIAEGIAVGTDIGEVSLLKKYEAERKPANVTMMAILDGFQKAYSVDLGPLNILRAAAF 488

Query: 421 HGAQYISPLKRNIISYASGEQRLPL 445
           HGA +ISPLKR+IISYASGEQRLPL
Sbjct: 489 HGAHHISPLKRSIISYASGEQRLPL 513

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224057583|ref|XP_002299279.1| predicted protein [Populus trichocarpa] gi|222846537|gb|EEE84084.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359494703|ref|XP_002269379.2| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449524910|ref|XP_004169464.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449457604|ref|XP_004146538.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79416711|ref|NP_189062.3| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] gi|332643350|gb|AEE76871.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79313357|ref|NP_001030758.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] gi|332643351|gb|AEE76872.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|51968852|dbj|BAD43118.1| monooxygenase, putatve [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831190|ref|XP_002883477.1| monooxygenase [Arabidopsis lyrata subsp. lyrata] gi|297329317|gb|EFH59736.1| monooxygenase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357450969|ref|XP_003595761.1| Ubiquinone biosynthesis monooxygenase COQ6 [Medicago truncatula] gi|355484809|gb|AES66012.1| Ubiquinone biosynthesis monooxygenase COQ6 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query451
TAIR|locus:2093731507 AT3G24200 "AT3G24200" [Arabido 0.982 0.873 0.725 8.6e-175
UNIPROTKB|F1PBF7469 COQ6 "Uncharacterized protein" 0.924 0.889 0.342 4.8e-62
MGI|MGI:1924408476 Coq6 "coenzyme Q6 homolog (yea 0.924 0.876 0.342 3.4e-61
RGD|1311149476 Coq6 "coenzyme Q6 homolog, mon 0.924 0.876 0.342 9e-61
UNIPROTKB|F1S3H4476 COQ6 "Uncharacterized protein" 0.929 0.880 0.334 1.2e-60
UNIPROTKB|Q9Y2Z9468 COQ6 "Ubiquinone biosynthesis 0.924 0.891 0.337 1.5e-60
UNIPROTKB|Q2KIL4469 COQ6 "Ubiquinone biosynthesis 0.924 0.889 0.340 2.2e-59
ZFIN|ZDB-GENE-060825-297484 coq6 "coenzyme Q6 homolog, mon 0.931 0.867 0.312 6.6e-58
UNIPROTKB|F1NBR7470 COQ6 "Uncharacterized protein" 0.926 0.889 0.319 1.5e-53
DICTYBASE|DDB_G0291440495 coq6 "monooxygenase" [Dictyost 0.940 0.856 0.320 3.8e-53
TAIR|locus:2093731 AT3G24200 "AT3G24200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1698 (602.8 bits), Expect = 8.6e-175, P = 8.6e-175
 Identities = 323/445 (72%), Positives = 367/445 (82%)

Query:     1 MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEI 60
             MVG+ALA SLAS PLTKHL+VAIID+NP LG+ N I+K   PDPRVSTVTPATISF K+I
Sbjct:    63 MVGIALAASLASKPLTKHLNVAIIDNNPLLGRRNIIEKGHQPDPRVSTVTPATISFLKDI 122

Query:    61 GAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNT 120
             GAW+Y++Q RHAYFDKMQVWDYTGLGYT+YNA DV++++LGCVVENKVL SS LSC+Q +
Sbjct:   123 GAWKYIEQQRHAYFDKMQVWDYTGLGYTRYNANDVHQDVLGCVVENKVLQSSQLSCVQES 182

Query:   121 EFQKTIYPSRXXXXXXXXXXXXXXXXXXXXXXTLFTKGHLAKLDLSDGTSLYAKLVVGAD 180
             + QKT+YP+R                       LF +G LAKL+LSDG  +YAKLVVGAD
Sbjct:   183 DLQKTVYPARLNAMDMLPSSSLTGLGEVPSTTDLFMRGRLAKLELSDGNRVYAKLVVGAD 242

Query:   181 GGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIV 240
             G KSRVRELAG KTTGW+YSQNAIICTVEH  ENY AWQRFLP GPIALLPIGD FSNIV
Sbjct:   243 GSKSRVRELAGIKTTGWNYSQNAIICTVEHTAENYTAWQRFLPNGPIALLPIGDKFSNIV 302

Query:   241 WTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKEC 300
             WTM+PK+ASD K MNEDDF+K +N ALD GYGP+P++ SS   D  SW  GDAT+SAKE 
Sbjct:   303 WTMDPKEASDRKLMNEDDFIKAVNDALDSGYGPNPETTSSR--DSLSWLTGDATISAKER 360

Query:   301 FEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTL 360
             FE PP+VVKL+SERM+FPLSL+HA +YVSKRV L+GD+AHTVHPLAGQGVNLGF DA  L
Sbjct:   361 FETPPKVVKLSSERMMFPLSLRHAKDYVSKRVALVGDSAHTVHPLAGQGVNLGFADACAL 420

Query:   361 SRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAF 420
             S+ IAEGIA+G DIGEA+LLK+YEAERKPANI MMAVLDG QK YS+DFGPLN LRAAAF
Sbjct:   421 SKAIAEGIALGTDIGEANLLKRYEAERKPANIAMMAVLDGIQKMYSLDFGPLNALRAAAF 480

Query:   421 HGAQYISPLKRNIISYASGEQRLPL 445
             HGA YISPLK+ IISYASGEQ LPL
Sbjct:   481 HGAHYISPLKKRIISYASGEQSLPL 505
GO:0004497 "monooxygenase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0006744 "ubiquinone biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|F1PBF7 COQ6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1924408 Coq6 "coenzyme Q6 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311149 Coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3H4 COQ6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2Z9 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIL4 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060825-297 coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBR7 COQ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291440 coq6 "monooxygenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q68FU7COQ6_RAT1, ., 1, 4, ., 1, 3, ., -0.34540.91570.8676yesno
Q9Y7Z9COQ6_SCHPO1, ., 1, 4, ., 1, 3, ., -0.30950.85580.8058yesno
Q2KIL4COQ6_BOVIN1, ., 1, 4, ., 1, 3, ., -0.34310.91570.8805yesno
Q9Y2Z9COQ6_HUMAN1, ., 1, 4, ., 1, 3, ., -0.33560.91350.8803yesno
Q8R1S0COQ6_MOUSE1, ., 1, 4, ., 1, 3, ., -0.350.91570.8676yesno
F1RAX8COQ6_DANRE1, ., 1, 4, ., 1, 3, ., -0.32350.92460.8615yesno
Q6DF46COQ6_XENTR1, ., 1, 4, ., 1, 3, ., -0.33930.92230.8965yesno
Q54EN1COQ6_DICDI1, ., 1, 4, ., 1, 3, ., -0.31960.94450.8606yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.130.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
TIGR01989437 TIGR01989, COQ6, ubiquinone biosynthesis monooxyge 1e-165
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 1e-139
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-72
PRK05714405 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methox 5e-72
PRK08850405 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol h 3e-71
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 3e-71
PRK08020391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1, 3e-70
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 7e-66
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 2e-64
PRK08849384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methox 5e-63
PRK08013400 PRK08013, PRK08013, oxidoreductase; Provisional 1e-60
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 4e-60
PRK08773392 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methox 1e-59
PRK05732395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl h 3e-53
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 2e-39
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h 7e-38
PRK06996398 PRK06996, PRK06996, hypothetical protein; Provisio 4e-31
PRK06617374 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl h 7e-28
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 2e-15
PRK06834 488 PRK06834, PRK06834, hypothetical protein; Provisio 2e-15
PRK06126 545 PRK06126, PRK06126, hypothetical protein; Provisio 2e-13
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisio 1e-10
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Review 2e-10
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 3e-09
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 3e-08
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 2e-07
PRK08255 765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R 3e-07
TIGR03219414 TIGR03219, salicylate_mono, salicylate 1-monooxyge 6e-07
PRK08244 493 PRK08244, PRK08244, hypothetical protein; Provisio 1e-06
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisio 4e-06
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisio 1e-05
PRK07190487 PRK07190, PRK07190, hypothetical protein; Provisio 3e-05
PRK06475400 PRK06475, PRK06475, salicylate hydroxylase; Provis 1e-04
PTZ00367 567 PTZ00367, PTZ00367, squalene epoxidase; Provisiona 1e-04
TIGR02023388 TIGR02023, BchP-ChlP, geranylgeranyl reductase 2e-04
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 5e-04
TIGR02028398 TIGR02028, ChlP, geranylgeranyl reductase 5e-04
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisio 5e-04
PRK08294 634 PRK08294, PRK08294, phenol 2-monooxygenase; Provis 6e-04
PRK08243392 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygen 0.001
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 0.002
pfam08491276 pfam08491, SE, Squalene epoxidase 0.003
PLN02927 668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa 0.003
>gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 Back     alignment and domain information 
 Score =  471 bits (1214), Expect = e-165
 Identities = 196/442 (44%), Positives = 272/442 (61%), Gaps = 22/442 (4%)

Query: 1   MVGMALACSLASMPLTKHLSVAIIDS--NPALGKSNFIKKEDPPDPRVSTVTPATISFFK 58
            VG+ALA +L + PLTK L V ++D+  NP L   N+ K + P   RVS++TPA+ISFFK
Sbjct: 10  PVGLALAAALGNNPLTKDLKVLLLDAVDNPKLKSRNYEKPDGPYSNRVSSITPASISFFK 69

Query: 59  EIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQ 118
           +IGAW ++Q  R   F +MQVWD   L   ++  RD  KE + C++EN  + +SL + +Q
Sbjct: 70  KIGAWDHIQSDRIQPFGRMQVWDGCSLALIRF-DRDNGKEDMACIIENDNIQNSLYNRLQ 128

Query: 119 --NTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLV 176
             N +  K + P+RL S+ + PS       +               + LSDG  LY KL+
Sbjct: 129 EYNGDNVKILNPARLISVTI-PSKYPNDNSN------------WVHITLSDGQVLYTKLL 175

Query: 177 VGADGGKSRVRELAGFKTTGWSYSQNAIICTVEH--NKENYCAWQRFLPAGPIALLPIGD 234
           +GADG  S VR+ A   TTGW+Y+Q+A++ T++     EN  AWQRFLP GPIALLP+ D
Sbjct: 176 IGADGSNSNVRKAANIDTTGWNYNQHAVVATLKLEEATENDVAWQRFLPTGPIALLPLPD 235

Query: 235 NFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSG-SVDMFSWFRGDA 293
           N S +VW+ +P++A    S+  +DFV  LN A D GY  HP S     +++  +   G  
Sbjct: 236 NNSTLVWSTSPEEALRLLSLPPEDFVDALNAAFDLGYSDHPYSYLLDYAMEKLNEDIGFR 295

Query: 294 TLSAKECFEVPPRVVKLASE-RMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNL 352
           T  +K CF+VPPRV+ +  + R  FPL L HA+ YV+KRV L+GDAAH VHPLAGQGVNL
Sbjct: 296 TEGSKSCFQVPPRVIGVVDKSRAAFPLGLGHADEYVTKRVALVGDAAHRVHPLAGQGVNL 355

Query: 353 GFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPL 412
           GFGD ++L + +AE ++VGADIG  S LK YE ER   N+V++ ++D   K Y+ DF P+
Sbjct: 356 GFGDVASLVKALAEAVSVGADIGSISSLKPYERERYAKNVVLLGLVDKLHKLYATDFPPV 415

Query: 413 NILRAAAFHGAQYISPLKRNII 434
             LR    +   YI PLK  I+
Sbjct: 416 VALRTFGLNLTNYIGPLKNFIM 437

This model represents the monooxygenase responsible for the 4-hydroxylateion of the phenol ring in the aerobic biosynthesis of ubiquinone. Length = 437
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236341 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236139 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|181552 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|235584 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|235905 PRK06996, PRK06996, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168629 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|235870 PRK06834, PRK06834, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235728 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase Back     alignment and domain information
>gnl|CDD|236199 PRK08244, PRK08244, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235955 PRK07190, PRK07190, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional Back     alignment and domain information
>gnl|CDD|233689 TIGR02023, BchP-ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|131083 TIGR02028, ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236223 PRK08294, PRK08294, phenol 2-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|236198 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219864 pfam08491, SE, Squalene epoxidase Back     alignment and domain information
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 451
PRK08013400 oxidoreductase; Provisional 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 100.0
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 100.0
PRK09126392 hypothetical protein; Provisional 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 100.0
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 100.0
PRK06996398 hypothetical protein; Provisional 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 100.0
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 100.0
PRK06185407 hypothetical protein; Provisional 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK08244 493 hypothetical protein; Provisional 100.0
PRK06834 488 hypothetical protein; Provisional 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
PRK06475400 salicylate hydroxylase; Provisional 100.0
PRK08132 547 FAD-dependent oxidoreductase; Provisional 100.0
PRK05868372 hypothetical protein; Validated 100.0
PRK08294 634 phenol 2-monooxygenase; Provisional 100.0
PRK06184 502 hypothetical protein; Provisional 100.0
PRK06847375 hypothetical protein; Provisional 100.0
PLN02985514 squalene monooxygenase 100.0
PRK08163396 salicylate hydroxylase; Provisional 100.0
PRK07190487 hypothetical protein; Provisional 100.0
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 100.0
PRK07538413 hypothetical protein; Provisional 100.0
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 100.0
PRK06126 545 hypothetical protein; Provisional 100.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 100.0
PTZ00367 567 squalene epoxidase; Provisional 100.0
PRK07236386 hypothetical protein; Provisional 100.0
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 100.0
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 100.0
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 100.0
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.98
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.97
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.97
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.97
PRK11445351 putative oxidoreductase; Provisional 99.96
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.96
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.96
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.95
PRK10015429 oxidoreductase; Provisional 99.95
PRK10157428 putative oxidoreductase FixC; Provisional 99.94
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.9
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.89
PLN02697529 lycopene epsilon cyclase 99.85
PLN02463447 lycopene beta cyclase 99.84
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.84
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.78
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.7
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.97
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.96
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.79
COG2081408 Predicted flavoproteins [General function predicti 98.63
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.62
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.58
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.54
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.53
PRK11728393 hydroxyglutarate oxidase; Provisional 98.36
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.3
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.27
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.25
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.24
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.19
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.09
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.08
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.08
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.06
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.06
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.02
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.0
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 97.93
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.85
PRK05257494 malate:quinone oxidoreductase; Validated 97.82
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.81
PLN02661357 Putative thiazole synthesis 97.77
COG0579429 Predicted dehydrogenase [General function predicti 97.73
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.71
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.68
PLN02464627 glycerol-3-phosphate dehydrogenase 97.61
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.56
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.51
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.49
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.41
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.37
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.29
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 97.25
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.24
PRK07804541 L-aspartate oxidase; Provisional 97.24
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.23
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.22
PTZ00383497 malate:quinone oxidoreductase; Provisional 97.19
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.19
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.15
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.15
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.13
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.11
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.04
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.02
PLN02576496 protoporphyrinogen oxidase 97.02
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 96.97
PRK08274466 tricarballylate dehydrogenase; Validated 96.95
TIGR02730493 carot_isom carotene isomerase. Members of this fam 96.91
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 96.9
PRK06481506 fumarate reductase flavoprotein subunit; Validated 96.88
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.88
PRK12416463 protoporphyrinogen oxidase; Provisional 96.81
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.81
PLN02612567 phytoene desaturase 96.8
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 96.76
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 96.76
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 96.76
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.65
PRK09897 534 hypothetical protein; Provisional 96.63
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.58
PRK08401466 L-aspartate oxidase; Provisional 96.52
PRK06175433 L-aspartate oxidase; Provisional 96.42
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.41
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.39
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 96.39
PLN02268435 probable polyamine oxidase 96.39
PRK07121492 hypothetical protein; Validated 96.38
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.36
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.28
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.18
KOG2853509 consensus Possible oxidoreductase [General functio 96.18
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.17
PRK07233434 hypothetical protein; Provisional 96.12
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.07
PRK08275554 putative oxidoreductase; Provisional 96.06
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 96.03
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 96.01
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 95.94
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 95.89
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 95.71
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 95.7
PRK08071510 L-aspartate oxidase; Provisional 95.66
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 95.59
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.57
PRK13977576 myosin-cross-reactive antigen; Provisional 95.56
PRK09077536 L-aspartate oxidase; Provisional 95.49
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.46
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 95.44
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 95.43
PRK05976472 dihydrolipoamide dehydrogenase; Validated 95.36
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 95.35
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 95.33
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 95.24
PLN02676487 polyamine oxidase 95.24
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 95.19
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.15
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 95.11
COG1231450 Monoamine oxidase [Amino acid transport and metabo 95.11
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 95.07
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 95.07
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 95.05
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 94.99
PRK06116450 glutathione reductase; Validated 94.98
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 94.95
PRK14694468 putative mercuric reductase; Provisional 94.94
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 94.87
PRK09564444 coenzyme A disulfide reductase; Reviewed 94.78
PRK10262321 thioredoxin reductase; Provisional 94.77
PLN02976 1713 amine oxidase 94.76
PLN02507499 glutathione reductase 94.75
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 94.72
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 94.72
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 94.71
PRK12839572 hypothetical protein; Provisional 94.71
PRK12779 944 putative bifunctional glutamate synthase subunit b 94.7
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 94.66
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 94.62
PRK07395553 L-aspartate oxidase; Provisional 94.56
PLN02815 594 L-aspartate oxidase 94.53
PRK07845466 flavoprotein disulfide reductase; Reviewed 94.49
PRK06116450 glutathione reductase; Validated 94.38
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.32
PRK12842574 putative succinate dehydrogenase; Reviewed 94.3
PRK07512513 L-aspartate oxidase; Provisional 94.28
PRK07845466 flavoprotein disulfide reductase; Reviewed 94.27
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 94.26
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 94.23
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 94.19
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.05
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 93.99
PRK13748561 putative mercuric reductase; Provisional 93.99
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 93.96
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 93.83
PRK12831464 putative oxidoreductase; Provisional 93.7
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 93.65
PRK06370463 mercuric reductase; Validated 93.6
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 93.54
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 93.44
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 93.31
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 93.27
KOG2852380 consensus Possible oxidoreductase [General functio 93.24
PRK07846451 mycothione reductase; Reviewed 93.2
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 92.95
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 92.89
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 92.72
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 92.71
PRK098531019 putative selenate reductase subunit YgfK; Provisio 92.68
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 92.63
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 92.61
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 92.26
COG3349485 Uncharacterized conserved protein [Function unknow 92.24
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 92.06
PRK13512438 coenzyme A disulfide reductase; Provisional 92.02
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 91.9
TIGR02053463 MerA mercuric reductase. This model represents the 91.85
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 91.64
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 91.56
PLN02546558 glutathione reductase 91.45
PRK06327475 dihydrolipoamide dehydrogenase; Validated 91.4
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 91.36
PRK13512438 coenzyme A disulfide reductase; Provisional 91.35
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 91.35
KOG2960328 consensus Protein involved in thiamine biosynthesi 91.31
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 91.13
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 90.97
PRK07233434 hypothetical protein; Provisional 90.76
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 90.61
PTZ00058561 glutathione reductase; Provisional 90.37
COG1233487 Phytoene dehydrogenase and related proteins [Secon 90.35
PLN02487569 zeta-carotene desaturase 90.23
PLN02487569 zeta-carotene desaturase 90.23
PRK14989 847 nitrite reductase subunit NirD; Provisional 90.14
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 90.13
PLN02328808 lysine-specific histone demethylase 1 homolog 90.1
PLN03000 881 amine oxidase 89.97
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 89.93
PRK14727479 putative mercuric reductase; Provisional 89.82
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 89.77
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 89.12
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 88.96
PRK06292460 dihydrolipoamide dehydrogenase; Validated 88.67
PLN02507499 glutathione reductase 88.6
PRK05976472 dihydrolipoamide dehydrogenase; Validated 88.37
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 88.33
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 88.25
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 88.16
COG1233487 Phytoene dehydrogenase and related proteins [Secon 87.7
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 87.59
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 87.26
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 87.21
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 86.59
PLN02568539 polyamine oxidase 86.57
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 86.26
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 85.99
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 85.87
PTZ00318424 NADH dehydrogenase-like protein; Provisional 85.72
PRK12416463 protoporphyrinogen oxidase; Provisional 85.53
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 85.47
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 85.46
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 85.14
PLN02612567 phytoene desaturase 84.99
TIGR02730493 carot_isom carotene isomerase. Members of this fam 84.89
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 84.15
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 84.11
PTZ00052499 thioredoxin reductase; Provisional 83.8
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 83.76
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 83.4
PRK06292460 dihydrolipoamide dehydrogenase; Validated 83.36
PTZ00318424 NADH dehydrogenase-like protein; Provisional 83.04
PRK06327475 dihydrolipoamide dehydrogenase; Validated 82.96
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 82.95
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 82.94
PLN02529738 lysine-specific histone demethylase 1 82.85
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 82.46
PRK11883451 protoporphyrinogen oxidase; Reviewed 82.43
COG4529474 Uncharacterized protein conserved in bacteria [Fun 81.93
PRK14989 847 nitrite reductase subunit NirD; Provisional 81.92
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 81.72
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 81.29
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 80.88
PTZ00153659 lipoamide dehydrogenase; Provisional 80.82
PRK07208479 hypothetical protein; Provisional 80.62
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 80.49
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 80.08
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.4e-51  Score=405.21  Aligned_cols=383  Identities=34%  Similarity=0.576  Sum_probs=308.5

Q ss_pred             CcHHHHHHHhcCCCCCCCcEEEEEcCCCCCCCC-CCCCCCCCCCCceeeecHHHHHHHHHCCCchhhhhhhcccccEEEE
Q 013000            1 MVGMALACSLASMPLTKHLSVAIIDSNPALGKS-NFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQV   79 (451)
Q Consensus         1 paGl~lA~~L~~~~~~~g~~V~viEr~~~~~~~-~~~~~~~~~~~~g~~l~~~~~~~L~~lgl~~~~~~~~~~~~~~~~~   79 (451)
                      |+||++|+.|++    +|++|+||||.+.+... ++     ....++..|+++++++|+++|+++++.+.+..+...+.+
T Consensus        13 paGl~~A~~La~----~G~~v~viE~~~~~~~~~g~-----~~~~r~~~l~~~s~~~L~~lGl~~~~~~~~~~~~~~~~~   83 (400)
T PRK08013         13 MVGLAVACGLQG----SGLRVAVLEQRVPEPLAADA-----PPALRVSAINAASEKLLTRLGVWQDILARRASCYHGMEV   83 (400)
T ss_pred             HHHHHHHHHHhh----CCCEEEEEeCCCCcccccCC-----CCCceeeecchhHHHHHHHcCCchhhhhhcCccccEEEE
Confidence            689999999999    59999999999876321 11     234578899999999999999999998866557788888


Q ss_pred             EeCCCcceeEeecCCCCCccceeeechHHHHHHHHHHhhcCCCceEEcCCeeEEEEeCCCCCCcccCCCCCccccccCCC
Q 013000           80 WDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGH  159 (451)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~i~R~~L~~~L~~~~~~~g~v~i~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (451)
                      |+.+......+.......+..++.++|..|+++|.+.+.+.++++++++++|++++.                    .+.
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~~~v~i~~~~~v~~i~~--------------------~~~  143 (400)
T PRK08013         84 WDKDSFGRIAFDDQSMGYSHLGHIIENSVIHYALWQKAQQSSDITLLAPAELQQVAW--------------------GEN  143 (400)
T ss_pred             EeCCCCceEEEcccccCCCccEEEEEhHHHHHHHHHHHhcCCCcEEEcCCeeEEEEe--------------------cCC
Confidence            876543444454333333445789999999999999999876699999999999976                    446


Q ss_pred             eeEEEeCCCcEEEeeEEEeecCCCChhhhhhCCCCCCCcccCeEEEEEEeecCCC-CeeEEEecCCCcEEEeecCCCc-e
Q 013000          160 LAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKEN-YCAWQRFLPAGPIALLPIGDNF-S  237 (451)
Q Consensus       160 ~v~v~~~dg~~~~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~g~~~~~p~~~~~-~  237 (451)
                      .+.|++.||++++||+||||||++|.||+.++++.....+...++.+.++.+.++ ...++.|.+++++.++|+.++. .
T Consensus       144 ~v~v~~~~g~~i~a~lvVgADG~~S~vR~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~  223 (400)
T PRK08013        144 EAFLTLKDGSMLTARLVVGADGANSWLRNKADIPLTFWDYQHHALVATIRTEEPHDAVARQVFHGDGILAFLPLSDPHLC  223 (400)
T ss_pred             eEEEEEcCCCEEEeeEEEEeCCCCcHHHHHcCCCccccccCcEEEEEEEeccCCCCCEEEEEEcCCCCEEEEECCCCCeE
Confidence            6889999999999999999999999999999998887778888888887766554 4456778888899999998754 6


Q ss_pred             EEEEEcCccchHHhhcCCHHHHHHHHHHhhccCCCCCCCCCCCCcccccccccCCcccccccccCCCcceeeecCcceee
Q 013000          238 NIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVF  317 (451)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (451)
                      .++|..+............+.|.+.+...+.....                                  ..........|
T Consensus       224 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~----------------------------------~~~~~~~~~~~  269 (400)
T PRK08013        224 SIVWSLSPEEAQRMQQAPEEEFNRALAIAFDNRLG----------------------------------LCELESERQVF  269 (400)
T ss_pred             EEEEEcCHHHHHHHHcCCHHHHHHHHHHHHhHhhC----------------------------------ceEecCCccEE
Confidence            78888876654444455667777776653320000                                  01112223347


Q ss_pred             ecccccccccccCCEEEEcccccccCCcchhccccchHHHHHHHHHHHHhhhcCCCCChHHHHHHHHHhhchhhHHHHHH
Q 013000          318 PLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAV  397 (451)
Q Consensus       318 ~~~~~~~~~~~~g~v~LvGDAAh~~~P~~g~G~~~al~da~~La~~L~~~~~~~~~~~~~~~l~~Ye~~r~~~~~~~~~~  397 (451)
                      ++....+++|..|||+|+|||||.++|+.|||+|+||+||..|+++|...+..+.+.....+|+.|+++|++++..++..
T Consensus       270 ~l~~~~~~~~~~grv~LiGDAAH~~~P~~GQG~n~gi~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~~~~~  349 (400)
T PRK08013        270 PLTGRYARQFAAHRLALVGDAAHTIHPLAGQGVNLGFMDAAELIAELRRLHRQGKDIGQHLYLRRYERSRKHSAALMLAG  349 (400)
T ss_pred             ecceeecccccCCcEEEEechhhcCCccccCchhhhHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHHHHHHHHHHHHHH
Confidence            77777889999999999999999999999999999999999999999987655433333468999999999999999999


Q ss_pred             HHHHHHhhcCCCchHHHHHHHHHHhhccChhHHHHHHHHhhCCCCCCCC
Q 013000          398 LDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLP  446 (451)
Q Consensus       398 s~~~~~~~~~~~~~~~~~r~~~~~~~~~~p~l~~~~~~~~~g~~~~~~~  446 (451)
                      ++.+..+++..+++...+|+..+.++..+|.+++++++.++|+..+|..
T Consensus       350 ~~~~~~l~~~~~~~~~~~R~~~l~~~~~~~~~~~~~~~~~~g~~~~~~~  398 (400)
T PRK08013        350 MQGFRDLFAGNNPAKKLLRDIGLKLADTLPGVKPQLIRQAMGLNDLPEW  398 (400)
T ss_pred             HHHHHHHHcCCchHHHHHHHHHHHHHhhCHHHHHHHHHHHccCcCCccc
Confidence            9999999999999999999999999999999999999999998766654

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
2r0c_A 549 Structure Of The Substrate-Free Form Of The Rebecca 3e-08
4eip_A 549 Native And K252c Bound Rebc-10x Length = 549 4e-08
2qa2_A 499 Crystal Structure Of Cabe, An Aromatic Hydroxylase 1e-07
3all_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 6e-07
3fmw_A 570 The Crystal Structure Of Mtmoiv, A Baeyer-Villiger 7e-07
3alk_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 9e-07
3alh_A379 Higher Resolution And Native Structure Of 2-Methyl- 1e-06
3gmc_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 1e-06
3gmb_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 2e-05
3v3n_A378 Crystal Structure Of Tetx2 T280a: An Adaptive Mutan 7e-05
2y6r_A398 Structure Of The Tetx Monooxygenase In Complex With 8e-05
4a6n_A398 Structure Of The Tetracycline Degrading Monooxygena 8e-05
2xdo_A398 Structure Of The Tetracycline Degrading Monooxygena 8e-05
1pn0_A 665 Phenol Hydroxylase From Trichosporon Cutaneum Lengt 1e-04
2x3n_A399 Crystal Structure Of Pqsl, A Probable Fad-Dependent 1e-04
2qa1_A 500 Crystal Structure Of Pgae, An Aromatic Hydroxylase 3e-04
3p9u_A378 Crystal Structure Of Tetx2 From Bacteroides Thetaio 4e-04
2xyo_A399 Structural Basis For A New Tetracycline Resistance 4e-04
1bgn_A394 P-Hydroxybenzoate Hydroxylase (Phbh) Mutant With Cy 6e-04
>pdb|2R0C|A Chain A, Structure Of The Substrate-Free Form Of The Rebeccamycin Biosynthetic Enzyme Rebc Length = 549 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 55/109 (50%), Gaps = 8/109 (7%)
Query: 292 DATLSAKECFEVPPRVVKLASERMVFPLSLKH-----ANNYVSKRVVLIGDAAHTVHPLA 346
           DA+ S  + FE+  R V   +E  V   S  H     A+++ + RV L GDAAHT+ P  
Sbjct: 266 DASKSTMDSFELVRRAVAFDTEIEVLSDSEWHLTHRVADSFSAGRVFLTGDAAHTLSPSG 325
Query: 347 GQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMM 395
           G G+N G G A+ L   +A  +   A  G   LL  YE ER+P  I  +
Sbjct: 326 GFGMNTGIGSAADLGWKLAATLRGWAGPG---LLATYEEERRPVAITSL 371
>pdb|4EIP|A Chain A, Native And K252c Bound Rebc-10x Length = 549 Back     alignment and structure
>pdb|2QA2|A Chain A, Crystal Structure Of Cabe, An Aromatic Hydroxylase From Angucycline Biosynthesis, Determined To 2.7 A Resolution Length = 499 Back     alignment and structure
>pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 Back     alignment and structure
>pdb|3FMW|A Chain A, The Crystal Structure Of Mtmoiv, A Baeyer-Villiger Monooxygenase From The Mithramycin Biosynthetic Pathway In Streptomyces Argillaceus. Length = 570 Back     alignment and structure
>pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 Back     alignment and structure
>pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 Back     alignment and structure
>pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 Back     alignment and structure
>pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 Back     alignment and structure
>pdb|3V3N|A Chain A, Crystal Structure Of Tetx2 T280a: An Adaptive Mutant In Complex With Minocycline Length = 378 Back     alignment and structure
>pdb|2Y6R|A Chain A, Structure Of The Tetx Monooxygenase In Complex With The Substrate 7-Chlortetracycline Length = 398 Back     alignment and structure
>pdb|4A6N|A Chain A, Structure Of The Tetracycline Degrading Monooxygenase Tetx In Complex With Tigecycline Length = 398 Back     alignment and structure
>pdb|2XDO|A Chain A, Structure Of The Tetracycline Degrading Monooxygenase Tetx2 From Bacteroides Thetaiotaomicron Length = 398 Back     alignment and structure
>pdb|1PN0|A Chain A, Phenol Hydroxylase From Trichosporon Cutaneum Length = 665 Back     alignment and structure
>pdb|2X3N|A Chain A, Crystal Structure Of Pqsl, A Probable Fad-Dependent Monooxygenase From Pseudomonas Aeruginosa Length = 399 Back     alignment and structure
>pdb|2QA1|A Chain A, Crystal Structure Of Pgae, An Aromatic Hydroxylase Involved In Angucycline Biosynthesis Length = 500 Back     alignment and structure
>pdb|3P9U|A Chain A, Crystal Structure Of Tetx2 From Bacteroides Thetaiotaomicron With Substrate Analogue Length = 378 Back     alignment and structure
>pdb|2XYO|A Chain A, Structural Basis For A New Tetracycline Resistance Mechanism Relying On The Tetx Monooxygenase Length = 399 Back     alignment and structure
>pdb|1BGN|A Chain A, P-Hydroxybenzoate Hydroxylase (Phbh) Mutant With Cys 116 Replaced By Ser (C116s) And Arg 269 Replaced By Thr (R269t), In Complex With Fad And 4-Hydroxybenzoic Acid Length = 394 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 1e-102
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 1e-26
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 1e-26
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 2e-23
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 4e-21
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 4e-21
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 1e-20
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 3e-20
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 5e-20
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 2e-18
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 5e-18
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 2e-17
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 9e-14
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 1e-13
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 1e-13
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 2e-13
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 3e-12
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-11
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 2e-07
3atr_A453 Conserved archaeal protein; saturating double bond 2e-07
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-07
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
 Score =  308 bits (791), Expect = e-102
 Identities = 76/450 (16%), Positives = 143/450 (31%), Gaps = 70/450 (15%)

Query: 1   MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEI 60
           + G  LA  L      +   V +++              +        + PA I   +  
Sbjct: 16  IGGAMLAYLLGR----QGHRVVVVEQAR----------RERAINGADLLKPAGIRVVEAA 61

Query: 61  GAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNT 120
           G    V +       +++V+   G     +N   V+      ++  + L   +L  +   
Sbjct: 62  GLLAEVTRRGGRVRHELEVYH-DGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGE 120

Query: 121 EFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGAD 180
              + ++ +R+ ++                         + ++ L+DG  L  ++VVGAD
Sbjct: 121 ATVEMLFETRIEAVQRDER------------------HAIDQVRLNDGRVLRPRVVVGAD 162

Query: 181 GGKSRVRE-LAGFKTTGWSYSQNAIICTVEHNKE-NYCAWQRFLPAGPIA-LLPIGDNFS 237
           G  S VR  L         Y    ++ T                  G +A   PIG + +
Sbjct: 163 GIASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRA 222

Query: 238 NIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSA 297
            +V +   ++A +  +    + ++                                    
Sbjct: 223 RLVVSFPREEARELMADTRGESLRRRLQRF-----------------------------V 253

Query: 298 KECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDA 357
            +        V   S     P+   + + Y +  V ++GDA H VHP+ GQG+NL   DA
Sbjct: 254 GDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDA 313

Query: 358 STLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRA 417
           S L+  +   +     +     L  Y+AER P N  +++       +          +  
Sbjct: 314 SALADALDLALRDACALE--DALAGYQAERFPVNQAIVSYGHALATSLEDR-QRFAGVFD 370

Query: 418 AAFHGAQYISPLKRNIISYASGEQRLPLPL 447
            A  G+           SY     R P PL
Sbjct: 371 TALQGSSRTPEALGGERSYQPV--RSPAPL 398
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query451
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 100.0
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 100.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 100.0
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 100.0
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 100.0
4hb9_A412 Similarities with probable monooxygenase; flavin, 100.0
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 100.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 100.0
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 100.0
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 100.0
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 100.0
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 100.0
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 100.0
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 100.0
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 100.0
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 100.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 100.0
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 100.0
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 100.0
3atr_A453 Conserved archaeal protein; saturating double bond 100.0
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 100.0
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 100.0
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.96
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.96
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 99.96
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.96
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.95
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.93
2bry_A497 NEDD9 interacting protein with calponin homology a 99.82
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.69
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.04
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.01
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.91
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.89
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.88
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.87
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.85
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.8
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.78
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.76
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.71
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.7
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.67
3dme_A369 Conserved exported protein; structural genomics, P 98.67
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.66
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.62
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.62
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.6
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.49
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.48
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.46
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.42
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.4
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.38
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.38
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.35
2cul_A232 Glucose-inhibited division protein A-related PROT 98.34
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.33
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.28
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.26
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.26
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.23
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.21
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.21
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.18
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.17
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.14
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.14
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.11
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.07
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.07
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.04
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.98
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.96
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.92
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.89
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.87
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.84
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.83
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.83
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.81
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.77
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.76
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.73
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.71
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.71
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.7
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.69
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.68
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.68
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.66
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.66
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.63
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.6
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.59
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.55
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.54
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.53
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.51
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.46
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.38
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.37
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.32
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.31
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.3
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.28
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.27
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.17
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.16
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.09
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.07
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.97
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.95
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.82
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.78
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.76
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.7
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.66
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 96.6
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.6
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.5
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.46
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.3
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.17
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.15
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.13
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.12
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 96.11
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 95.94
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 95.82
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 95.78
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 95.74
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 95.74
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 95.65
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 95.64
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.62
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.6
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.48
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 95.48
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.42
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 95.41
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 95.37
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.32
1ojt_A482 Surface protein; redox-active center, glycolysis, 95.3
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 95.27
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.26
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.25
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 95.25
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 95.22
1fec_A490 Trypanothione reductase; redox-active center, oxid 95.17
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.11
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 95.09
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.08
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 95.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 94.99
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 94.96
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 94.86
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 94.61
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 94.48
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 94.34
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 94.34
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 94.31
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 94.31
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 94.3
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 94.23
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.18
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 94.14
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 94.14
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 94.12
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.05
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 94.01
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 93.93
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 93.89
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 93.82
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 93.69
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 93.62
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 93.55
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 93.38
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 93.35
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 93.22
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 93.14
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 93.05
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 93.03
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 93.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 92.73
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 92.65
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 92.61
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 92.6
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 92.59
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 92.49
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 91.98
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 91.68
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 91.62
4dna_A463 Probable glutathione reductase; structural genomic 91.57
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 91.44
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 91.33
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 91.25
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 91.24
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 91.22
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 90.99
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 90.78
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 90.77
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 90.59
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 90.51
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 90.21
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 90.04
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 90.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 89.49
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 89.38
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 89.3
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 89.25
1fec_A490 Trypanothione reductase; redox-active center, oxid 89.17
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 88.83
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 88.65
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 88.54
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 88.52
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 88.03
4dna_A463 Probable glutathione reductase; structural genomic 87.66
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 87.61
3r9u_A315 Thioredoxin reductase; structural genomics, center 87.36
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 87.18
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 87.06
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 87.04
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 86.89
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 86.68
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 86.58
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 85.23
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 85.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 84.9
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 84.58
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 84.32
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 82.92
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 82.8
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 82.03
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 82.03
1vg0_A650 RAB proteins geranylgeranyltransferase component A 81.64
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 81.58
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 80.99
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 80.84
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 80.6
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 80.05
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
Probab=100.00  E-value=4.6e-42  Score=348.45  Aligned_cols=358  Identities=19%  Similarity=0.223  Sum_probs=274.8

Q ss_pred             CcHHHHHHHhcCCCCCCCcEEEEEcCCCCCCCCCCCCCCCCCCCceeeecHHHHHHHHHCCCchhhhhhhcccccEEEEE
Q 013000            1 MVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVW   80 (451)
Q Consensus         1 paGl~lA~~L~~~~~~~g~~V~viEr~~~~~~~~~~~~~~~~~~~g~~l~~~~~~~L~~lgl~~~~~~~~~~~~~~~~~~   80 (451)
                      |+||++|+.|++    +|++|+||||.+.+.          ..++++.++++++++|+++|+++++... . ...... +
T Consensus        22 paGl~~A~~La~----~G~~v~vlE~~~~~~----------~~~r~~~l~~~~~~~l~~lGl~~~~~~~-~-~~~~~~-~   84 (499)
T 2qa2_A           22 PAGLMLAGELRL----GGVDVMVLEQLPQRT----------GESRGLGFTARTMEVFDQRGILPAFGPV-E-TSTQGH-F   84 (499)
T ss_dssp             HHHHHHHHHHHH----TTCCEEEEESCSSCC----------CCCCSEEECHHHHHHHHHTTCGGGGCSC-C-EESEEE-E
T ss_pred             HHHHHHHHHHHH----CCCCEEEEECCCCCC----------CCCceeEECHHHHHHHHHCCCHHHHHhc-c-ccccce-e
Confidence            689999999999    499999999998873          3455999999999999999999998765 2 222221 1


Q ss_pred             eCCCcceeEeecCCCC-CccceeeechHHHHHHHHHHhhcCCCceEEcCCeeEEEEeCCCCCCcccCCCCCccccccCCC
Q 013000           81 DYTGLGYTKYNARDVN-KEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGH  159 (451)
Q Consensus        81 ~~~~~~~~~~~~~~~~-~~~~~~~i~R~~L~~~L~~~~~~~g~v~i~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (451)
                      .  + .  .++..... ..+.++.++|..|+++|.+.+.+.+ ++|+++++|++++.                    +++
T Consensus        85 ~--~-~--~~~~~~~~~~~~~~~~i~~~~l~~~L~~~~~~~g-v~v~~~~~v~~i~~--------------------~~~  138 (499)
T 2qa2_A           85 G--G-R--PVDFGVLEGAHYGVKAVPQSTTESVLEEWALGRG-AELLRGHTVRALTD--------------------EGD  138 (499)
T ss_dssp             T--T-E--EEEGGGSTTCCCEEEEEEHHHHHHHHHHHHHHTT-CEEEESCEEEEEEE--------------------CSS
T ss_pred             c--c-e--ecccccCCCCCCceEecCHHHHHHHHHHHHHhCC-CEEEcCCEEEEEEE--------------------eCC
Confidence            1  1 1  22221111 2234688999999999999999886 99999999999987                    445


Q ss_pred             eeEEEeCCCc---EEEeeEEEeecCCCChhhhhhCCCCCCCcccCeEEEEEEeecCCCCeeEEEecCCCcEEEeecCCCc
Q 013000          160 LAKLDLSDGT---SLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNF  236 (451)
Q Consensus       160 ~v~v~~~dg~---~~~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~  236 (451)
                      .|+|++.||+   +++||+||||||.+|.||+++++......+...++.+.+..+.........+.++++++++|++++.
T Consensus       139 ~v~v~~~~~~g~~~~~a~~vVgADG~~S~VR~~lg~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~g~~~~~P~~~g~  218 (499)
T 2qa2_A          139 HVVVEVEGPDGPRSLTTRYVVGCDGGRSTVRKAAGFDFPGTSASREMFLADIRGCEITPRPIGETVPLGMVMSAPLGDGV  218 (499)
T ss_dssp             CEEEEEECSSCEEEEEEEEEEECCCTTCHHHHHTTCCCCEECCCCCEEEEEEESCCCCCEEEEEEETTEEEEEEECSSSC
T ss_pred             EEEEEEEcCCCcEEEEeCEEEEccCcccHHHHHcCCCCCCCCCccEEEEEEEEECCCCcceEEEECCCeEEEEEEcCCCE
Confidence            6888888875   8999999999999999999999887776666777777777654333334456788999999999888


Q ss_pred             eEEEEEcCccc-hHHhhcCCHHHHHHHHHHhhccCCCCCCCCCCCCcccccccccCCcccccccccCCCcceeeecCcce
Q 013000          237 SNIVWTMNPKD-ASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERM  315 (451)
Q Consensus       237 ~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  315 (451)
                      .++++...... .......+.+++.+.+...+.....                              +    .. .....
T Consensus       219 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~------------------------------~----~~-~~~~~  263 (499)
T 2qa2_A          219 DRIIVCERGAPARRRTGPPPYQEVAAAWQRLTGQDIS------------------------------H----GE-PVWVS  263 (499)
T ss_dssp             EEEEEEETTCCCCCCSSSCCHHHHHHHHHHHHSCCCT------------------------------T----CE-EEEEE
T ss_pred             EEEEEEecCCCCccccCCCCHHHHHHHHHHHhCCCCC------------------------------c----cc-eeEEE
Confidence            77777653321 1112235677888777765431000                              0    00 01112


Q ss_pred             eeecccccccccccCCEEEEcccccccCCcchhccccchHHHHHHHHHHHHhhhcCCCCChHHHHHHHHHhhchhhHHHH
Q 013000          316 VFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMM  395 (451)
Q Consensus       316 ~~~~~~~~~~~~~~g~v~LvGDAAh~~~P~~g~G~~~al~da~~La~~L~~~~~~~~~~~~~~~l~~Ye~~r~~~~~~~~  395 (451)
                      .|+...+.+++|..|||+|+|||||.|+|++|||+|+||+||.+|+++|...++..   ..+.+|+.|+++|++++..++
T Consensus       264 ~~~~~~~~a~~~~~grv~L~GDAAH~~~P~~GqG~n~gi~DA~~La~~La~~l~g~---~~~~~L~~Ye~eR~~~~~~~~  340 (499)
T 2qa2_A          264 AFGDPARQVSAYRRGRVLLAGDSAHVHLPAGGQGMNVSVQDSVNLGWKLAAVVSGR---APAGLLDTYHEERHPVGRRLL  340 (499)
T ss_dssp             EECCCEEECSCSEETTEEECGGGTEEECCCSSCHHHHHHHHHHHHHHHHHHHHTTS---SCTHHHHHHHHHHHHHHHHHH
T ss_pred             EEeCCcEEcccccCCCEEEEecccccCCCccccchhhhHHHHHHHHHHHHHHHcCC---CChHHHHHHHHHHHHHHHHHH
Confidence            36666677889999999999999999999999999999999999999999987532   237899999999999999999


Q ss_pred             HHHHHHHHhhcCCCchHHHHHHHHHHhhccChhHHHHHHHHhhCCC
Q 013000          396 AVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQ  441 (451)
Q Consensus       396 ~~s~~~~~~~~~~~~~~~~~r~~~~~~~~~~p~l~~~~~~~~~g~~  441 (451)
                      ..++.+..++.. ++....+|+.++.++ ..|.+++.+...++|..
T Consensus       341 ~~s~~~~~l~~~-~~~~~~~R~~~~~~~-~~~~~~~~~~~~~~~~~  384 (499)
T 2qa2_A          341 MNTQAQGMLFLS-GDEMQPLRDVLSELI-RYDEVSRHLAGMVSGLD  384 (499)
T ss_dssp             HHHHHHHHHHHC-CGGGHHHHHHHHHHH-TSSHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHhcC-CchHHHHHHHHHHhh-cCHHHHHHHHHHHhCCC
Confidence            999999998874 566778999888777 67888888888887754
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 451
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 1e-19
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 2e-07
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 4e-04
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 3e-05
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Phenol hydroxylase
species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]

 Score = 87.9 bits (216), Expect = 1e-19
 Identities = 59/440 (13%), Positives = 97/440 (22%), Gaps = 104/440 (23%)

Query: 1   MVGMALACSLASMPLTKH-LSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKE 59
             G+  A  L+     K  L V IID                 + +   +   T+   K 
Sbjct: 17  PAGLMAARVLSEYVRQKPDLKVRIIDKRSTK----------VYNGQADGLQCRTLESLKN 66

Query: 60  IGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQN 119
           +G    +    +     + +++    G+ +   R  +           VLH   +     
Sbjct: 67  LGLADKILSEANDM-STIALYNPDENGHIRRTDRIPDTLPGISRYHQVVLHQGRIERRIL 125

Query: 120 TEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGA 179
               +           L                                  +        
Sbjct: 126 DSIAEISDTRIKVERPL------------------------------IPEKMEIDSSKAE 155

Query: 180 DGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNI 239
           D     V     + +   S        T   N       Q          LP G     I
Sbjct: 156 DPEAYPVTMTLRYMSEDESTPLQFGHKTE--NGLFRSNLQTQEEEDANYRLPEGKEAGEI 213

Query: 240 VWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKE 299
                                        Y  G             F     +       
Sbjct: 214 ET-----------------------VHCKYVIGCDGGHSWVRRTLGFEMIVTEKF----- 245

Query: 300 CFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDAST 359
                                         +RV + GDA HT  P AGQG+N    D   
Sbjct: 246 ---------------------------SKDERVFIAGDACHTHSPKAGQGMNTSMMDTYN 278

Query: 360 LSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAA 419
           L   +     V     +  +LK YE ER+P    ++     F + +S      ++     
Sbjct: 279 LGWKLG---LVLTGRAKRDILKTYEEERQPFAQALIDFDHQFSRLFSGR-PAKDVADEMG 334

Query: 420 FHGAQYISPLKRNIISYASG 439
                +     +    +ASG
Sbjct: 335 VSMDVFKEAFVKG-NEFASG 353
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query451
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.96
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.95
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.93
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.84
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.63
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.95
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.55
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.43
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.43
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.39
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.21
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.08
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 97.94
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.83
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.83
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.65
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.61
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.59
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.55
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.53
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.36
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.23
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.22
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.18
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.18
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.03
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.03
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.92
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.86
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.83
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.75
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.75
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.59
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 96.5
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.3
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.12
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.87
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.83
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 95.75
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 95.67
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 95.4
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.14
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.97
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.97
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.41
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 94.09
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.95
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 93.82
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.21
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 93.14
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 93.02
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.01
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.98
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.66
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.19
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.08
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.55
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 91.53
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 91.48
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.4
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.36
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 90.89
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.81
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 90.59
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 90.15
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 89.57
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.4
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 89.26
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.33
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 87.91
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.59
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 85.57
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 85.29
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 84.27
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.25
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 81.65
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 81.34
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.21
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monooxygenase PhzS
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.96  E-value=3.4e-28  Score=226.45  Aligned_cols=259  Identities=19%  Similarity=0.209  Sum_probs=188.0

Q ss_pred             CcHHHHHHHhcCCCCCCCc-EEEEEcCCCCCCCCCCCCCCCCCCCceeeecHHHHHHHHHCCCchhhhhhhcccccEEEE
Q 013000            1 MVGMALACSLASMPLTKHL-SVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQV   79 (451)
Q Consensus         1 paGl~lA~~L~~~~~~~g~-~V~viEr~~~~~~~~~~~~~~~~~~~g~~l~~~~~~~L~~lgl~~~~~~~~~~~~~~~~~   79 (451)
                      ||||++|+.|+++    |+ +|+|+||++.++..          ++++.|+++++++|+++|+.+.+.+.+. ......+
T Consensus        11 ~aGl~~A~~L~~~----Gi~~V~V~Er~~~~~~~----------g~~i~l~~~~~~~l~~~~~~~~~~~~~~-~~~~~~~   75 (288)
T d3c96a1          11 IGGLSCALALHQA----GIGKVTLLESSSEIRPL----------GVGINIQPAAVEALAELGLGPALAATAI-PTHELRY   75 (288)
T ss_dssp             HHHHHHHHHHHHT----TCSEEEEEESSSSCCCC----------SCEEEECHHHHHHHHHTTCHHHHHHHSE-EECEEEE
T ss_pred             HHHHHHHHHHHhC----CCCeEEEEeCCCCCCCC----------ceEEEECHHHHHHHHHcCchhhhHhhhc-cccccee
Confidence            6899999999994    96 89999999988444          4599999999999999999999998776 4445556


Q ss_pred             EeCCCcceeEeecCCC-CCccceeeechHHHHHHHHHHhhc-CCCceEEcCCeeEEEEeCCCCCCcccCCCCCccccccC
Q 013000           80 WDYTGLGYTKYNARDV-NKEILGCVVENKVLHSSLLSCMQN-TEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTK  157 (451)
Q Consensus        80 ~~~~~~~~~~~~~~~~-~~~~~~~~i~R~~L~~~L~~~~~~-~g~v~i~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (451)
                      ++.++.....+..... ......+...+......+.+...+ ...+++.++++++.++.                    .
T Consensus        76 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~--------------------~  135 (288)
T d3c96a1          76 IDQSGATVWSEPRGVEAGNAYPQYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEE--------------------R  135 (288)
T ss_dssp             ECTTSCEEEEEECGGGGTCSSCEEEEEHHHHHHHHHHHHHHHHCTTSEEESEEEEEEEE--------------------E
T ss_pred             EcCCCCEEEeccccccccccCcccccchhhhHHHHHHHHHHhccCeeeecCcEEEEeee--------------------c
Confidence            6666655554443222 222233445566666665555433 24579999999999876                    5


Q ss_pred             CCeeEEEeCCC----cEEEeeEEEeecCCCChhhhhhCCCCCCCcccCeEEEEEEeecCCCCeeEEEecCCCcEEEeecC
Q 013000          158 GHLAKLDLSDG----TSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIG  233 (451)
Q Consensus       158 ~~~v~v~~~dg----~~~~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~  233 (451)
                      ++.+.|.+.||    +++.+|+||+|||.+|.||+...........                                  
T Consensus       136 ~~~v~v~~~~g~~~~~~~~ad~vi~ADG~~S~vr~~~~~~~~~~~~----------------------------------  181 (288)
T d3c96a1         136 DGRVLIGARDGHGKPQALGADVLVGADGIHSAVRAHLHPDQRPLRD----------------------------------  181 (288)
T ss_dssp             TTEEEEEEEETTSCEEEEEESEEEECCCTTCHHHHHHCTTCCCCCC----------------------------------
T ss_pred             CCcEEEEEEcCCCCeEEEeeceeeccCCccceeeeeeccccccccc----------------------------------
Confidence            67788988876    3799999999999999998776333111000                                  


Q ss_pred             CCceEEEEEcCccchHHhhcCCHHHHHHHHHHhhccCCCCCCCCCCCCcccccccccCCcccccccccCCCcceeeecCc
Q 013000          234 DNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASE  313 (451)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (451)
                                                                                                      
T Consensus       182 --------------------------------------------------------------------------------  181 (288)
T d3c96a1         182 --------------------------------------------------------------------------------  181 (288)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ceeeecccccccccccCCEEEEcccccccCCcchhccccchHHHHHHHHHHHHhhhcCCCCChHHHHHHHHHhhchhhHH
Q 013000          314 RMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIV  393 (451)
Q Consensus       314 ~~~~~~~~~~~~~~~~g~v~LvGDAAh~~~P~~g~G~~~al~da~~La~~L~~~~~~~~~~~~~~~l~~Ye~~r~~~~~~  393 (451)
                               ....|..++++++|||+|.++|+.|||+|++|+|+..|++.|.+.    .  +.+.+|+.|++.|.+++..
T Consensus       182 ---------~~~~~~~~~~~~~gda~h~~~p~~g~G~~~ai~d~~~l~~~l~~~----~--~~~~al~~y~~~r~pr~~~  246 (288)
T d3c96a1         182 ---------PLPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELAAALARN----A--DVAAALREYEEARRPTANK  246 (288)
T ss_dssp             ---------CCSCCCBTTEEECTHHHHCCCSSTTCTHHHHHHHHHHHHHHHHHC----S--SHHHHHHHHHHHHHHHHHH
T ss_pred             ---------cccccccCcceecccccceeCCccccchhhhhhhHHHHHHHHhhC----C--CHHHHHHHHHHHHHHHHHH
Confidence                     012345689999999999999999999999999999999999763    2  3488999999999999999


Q ss_pred             HHHHHHHHHHhhcCCCchHHHHHHHHHHhh
Q 013000          394 MMAVLDGFQKAYSVDFGPLNILRAAAFHGA  423 (451)
Q Consensus       394 ~~~~s~~~~~~~~~~~~~~~~~r~~~~~~~  423 (451)
                      ++..++................|+..+..+
T Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  276 (288)
T d3c96a1         247 IILANREREKEEWAAASRPKTEKSAALEAI  276 (288)
T ss_dssp             HHHHHHHHHHHHHHHHHCC-----------
T ss_pred             HHHHHHHHHHhhccCCCchHHHHHHHHHHH
Confidence            999998888775444344445555555544
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure