Citrus Sinensis ID: 013164
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 448 | ||||||
| 73587480 | 505 | beclin 1 protein [Malus x domestica] | 0.982 | 0.871 | 0.843 | 0.0 | |
| 225454518 | 522 | PREDICTED: beclin 1 protein [Vitis vinif | 1.0 | 0.858 | 0.854 | 0.0 | |
| 224067974 | 516 | predicted protein [Populus trichocarpa] | 0.988 | 0.858 | 0.849 | 0.0 | |
| 351724517 | 509 | beclin 1 protein [Glycine max] gi|735874 | 0.982 | 0.864 | 0.833 | 0.0 | |
| 357456733 | 517 | Beclin 1 protein [Medicago truncatula] g | 0.979 | 0.849 | 0.849 | 0.0 | |
| 255564727 | 523 | Beclin-1, putative [Ricinus communis] gi | 1.0 | 0.856 | 0.836 | 0.0 | |
| 357456731 | 567 | Beclin 1 protein [Medicago truncatula] g | 0.979 | 0.774 | 0.75 | 0.0 | |
| 356508412 | 509 | PREDICTED: beclin-1-like protein-like is | 0.982 | 0.864 | 0.835 | 0.0 | |
| 449526106 | 509 | PREDICTED: beclin-1-like protein-like [C | 0.982 | 0.864 | 0.827 | 0.0 | |
| 449445541 | 509 | PREDICTED: beclin-1-like protein-like [C | 0.982 | 0.864 | 0.825 | 0.0 |
| >gi|73587480|emb|CAJ27522.1| beclin 1 protein [Malus x domestica] | Back alignment and taxonomy information |
|---|
Score = 786 bits (2030), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 376/446 (84%), Positives = 408/446 (91%), Gaps = 6/446 (1%)
Query: 1 MDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIP 60
MDNSFVVLP+QR Q GVPPRPRG + + SG AMDESFVV+ KSES++DGGG H+P
Sbjct: 64 MDNSFVVLPQQRAQ--GVPPRPRGGAVNT--GHSGNAMDESFVVVNKSESSADGGGAHLP 119
Query: 61 PPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDV 120
P+GG NGP+QPNNSGFHSTI++LKRAFEIA++QTQVEQPLC+ECMRVLSDKLDKEV+DV
Sbjct: 120 SPDGGPNGPLQPNNSGFHSTISLLKRAFEIASTQTQVEQPLCVECMRVLSDKLDKEVEDV 179
Query: 121 TRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELK 180
RDI+AYEACL+RLEGE R+VLSE DFLKEKLKIEEE+RKLEA IEE EKQNAEVN ELK
Sbjct: 180 NRDIKAYEACLKRLEGETREVLSETDFLKEKLKIEEEQRKLEAEIEEMEKQNAEVNNELK 239
Query: 181 ELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDA 240
LELKS RFKELEE+YW +FNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDA
Sbjct: 240 GLELKSSRFKELEEQYWHKFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDA 299
Query: 241 FPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIP 300
FPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKF YRIKI+P
Sbjct: 300 FPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFQYRIKILP 359
Query: 301 MGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDK 360
MGSYPRIMD+NNNTYELFGPVNLFWSTRYDKAMTLFL+CLKDFAEFANSKDQENNIPP+K
Sbjct: 360 MGSYPRIMDNNNNTYELFGPVNLFWSTRYDKAMTLFLTCLKDFAEFANSKDQENNIPPEK 419
Query: 361 CFKLPYKIENDKVENYSITQSFNKQENWTKALKYTLCNLKWALFWFVGNTNFQPVSAM-- 418
FKLPYKIENDKVE YSITQSFNKQENWTKALKYTLCNLKWAL+WFVGNTNFQP+SA+
Sbjct: 420 RFKLPYKIENDKVETYSITQSFNKQENWTKALKYTLCNLKWALYWFVGNTNFQPLSAVVS 479
Query: 419 SSPAEVSAVGSLYAKRGADLKSVGRN 444
SS AEVS GS Y++R + KS +N
Sbjct: 480 SSHAEVSGTGSSYSRRSTNSKSEFQN 505
|
Source: Malus x domestica Species: Malus x domestica Genus: Malus Family: Rosaceae Order: Rosales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225454518|ref|XP_002277370.1| PREDICTED: beclin 1 protein [Vitis vinifera] gi|297745431|emb|CBI40511.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224067974|ref|XP_002302626.1| predicted protein [Populus trichocarpa] gi|222844352|gb|EEE81899.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351724517|ref|NP_001238340.1| beclin 1 protein [Glycine max] gi|73587474|emb|CAJ27519.1| beclin 1 protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357456733|ref|XP_003598647.1| Beclin 1 protein [Medicago truncatula] gi|355487695|gb|AES68898.1| Beclin 1 protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255564727|ref|XP_002523358.1| Beclin-1, putative [Ricinus communis] gi|223537446|gb|EEF39074.1| Beclin-1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357456731|ref|XP_003598646.1| Beclin 1 protein [Medicago truncatula] gi|355487694|gb|AES68897.1| Beclin 1 protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356508412|ref|XP_003522951.1| PREDICTED: beclin-1-like protein-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449526106|ref|XP_004170055.1| PREDICTED: beclin-1-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449445541|ref|XP_004140531.1| PREDICTED: beclin-1-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 448 | ||||||
| TAIR|locus:2076715 | 517 | ATG6 "AT3G61710" [Arabidopsis | 0.975 | 0.845 | 0.731 | 2.6e-173 | |
| MGI|MGI:1891828 | 448 | Becn1 "beclin 1, autophagy rel | 0.683 | 0.683 | 0.358 | 3.8e-53 | |
| UNIPROTKB|Q14457 | 450 | BECN1 "Beclin-1" [Homo sapiens | 0.683 | 0.68 | 0.355 | 6.3e-53 | |
| UNIPROTKB|Q4A1L4 | 448 | BECN1 "Beclin-1" [Bos taurus ( | 0.683 | 0.683 | 0.355 | 8e-53 | |
| UNIPROTKB|E2RNW7 | 463 | AARSD1 "Uncharacterized protei | 0.683 | 0.660 | 0.355 | 8e-53 | |
| UNIPROTKB|Q4A1L5 | 448 | BECN1 "Beclin-1" [Sus scrofa ( | 0.683 | 0.683 | 0.355 | 8e-53 | |
| UNIPROTKB|Q5R878 | 450 | BECN1 "Beclin-1" [Pongo abelii | 0.683 | 0.68 | 0.355 | 8e-53 | |
| UNIPROTKB|F1S1F6 | 448 | BECN1 "Beclin-1" [Sus scrofa ( | 0.683 | 0.683 | 0.355 | 2.1e-52 | |
| UNIPROTKB|Q6GP52 | 445 | becn1 "Beclin-1" [Xenopus laev | 0.683 | 0.687 | 0.355 | 2.7e-52 | |
| RGD|620190 | 448 | Becn1 "beclin 1, autophagy rel | 0.683 | 0.683 | 0.355 | 2.7e-52 |
| TAIR|locus:2076715 ATG6 "AT3G61710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1684 (597.9 bits), Expect = 2.6e-173, P = 2.6e-173
Identities = 322/440 (73%), Positives = 353/440 (80%)
Query: 1 MDNSFVVLPKQRP-QSHGVPPRPRXXXXXX-XXXXXXKAMDESFVVIYKSESASDXXXXX 58
MDNSFVVLP+ +P QS G+PPRPR KAM+ESFVV+YKSE SD
Sbjct: 69 MDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEPVSDSGGSH 128
Query: 59 XXXXXXXTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVD 118
NGP+ N SGF++TI VL RAF+IA +QTQVEQPLCLECMRVLSDKL+KEV+
Sbjct: 129 NLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLSDKLEKEVE 188
Query: 119 DVTRDIEAYEACLQRLEGEARDVLSEADFLXXXXXXXXXXXXXXXXXXXXXKQNAEVNAE 178
DVTRD+EAYEAC+QRLEGE +DVLSEADFL KQNAEVN +
Sbjct: 189 DVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEKQNAEVNHQ 248
Query: 179 LKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLN 238
LKELE K RF ELE+RYWQEFNNFQFQLIAHQEERDAI +KIEVSQAHLELL +TNVL
Sbjct: 249 LKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLELLNKTNVLI 308
Query: 239 DAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKI 298
DAFPI +DGEFGTINNFRLGRLP I VEWDEINAAWGQACLLLHTMC YFRPKF ++KI
Sbjct: 309 DAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRPKFQCQVKI 368
Query: 299 IPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPP 358
PMGSYPRI+DSNN TYELFGPVNLFWSTRYDKAMTL+L CLKDFA+FANSKDQENNIPP
Sbjct: 369 QPMGSYPRIVDSNNETYELFGPVNLFWSTRYDKAMTLYLMCLKDFADFANSKDQENNIPP 428
Query: 359 DKCFKLPYKIENDKVENYSITQSFNKQENWTKALKYTLCNLKWALFWFVGNTNFQPVSA- 417
D C LPYKIE DKV YSITQSFNKQE+WTKALKYTLCNLKWAL+WFVGNTNFQP+SA
Sbjct: 429 DNCLNLPYKIEKDKVLGYSITQSFNKQESWTKALKYTLCNLKWALYWFVGNTNFQPLSAT 488
Query: 418 MSSPAEVSAVGSLYAKRGAD 437
+S P+ +SA GSLYAKRG D
Sbjct: 489 VSLPSNISAAGSLYAKRGPD 508
|
|
| MGI|MGI:1891828 Becn1 "beclin 1, autophagy related" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14457 BECN1 "Beclin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4A1L4 BECN1 "Beclin-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RNW7 AARSD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4A1L5 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R878 BECN1 "Beclin-1" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1F6 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GP52 becn1 "Beclin-1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| RGD|620190 Becn1 "beclin 1, autophagy related" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 448 | |||
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 1e-75 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| pfam12325 | 121 | pfam12325, TMF_TATA_bd, TATA element modulatory fa | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.004 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 0.004 |
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
Score = 240 bits (614), Expect = 1e-75
Identities = 122/356 (34%), Positives = 187/356 (52%), Gaps = 40/356 (11%)
Query: 81 ITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARD 140
+ + F+I +SQT ++ PLC EC +L ++LD E+ D ++ + Y+ L +LE + +
Sbjct: 2 VKAMTNLFDILSSQTNIDHPLCEECADILLERLDSELRDAEKERDTYKQYLSKLESQNVE 61
Query: 141 VLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEF 200
+ + E ++++EE +L +EE EK++ +++ EL EL+ + ++ + E +Y +E+
Sbjct: 62 ISNYEALDSELDELKKEEERLLDELEELEKEDDDLDGELVELQEEKEQLENEELQYLREY 121
Query: 201 NNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRL 260
N F + ++ ++ + E S L+ L++TN+ N F I H G F TIN RLGRL
Sbjct: 122 NLFDRNNLQLEDNLQSLELQYEYSLNQLDKLRKTNIFNATFHISHSGPFATINGLRLGRL 181
Query: 261 PKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRI--MDSNNNTYE-- 316
P + V W EINAAWGQ LLL + + F R +++P GS+ I + N+ Y
Sbjct: 182 PSVVVPWKEINAAWGQTVLLLAALAKKLGLNFV-RYRLVPFGSHSYIEKLMVNSVEYNNS 240
Query: 317 --------LFGPVNL----------FWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPP 358
L PV L FW T++DKAM FL CL F +
Sbjct: 241 TTNAPGDWLILPVELDLYFSGGLKFFWDTKFDKAMVAFLDCLSQFTREVEKIATQ----- 295
Query: 359 DKCFKLPYKIENDK-----VEN----YSITQSFNKQENWTKALKYTLCNLKWALFW 405
F LPY++E++K VEN YSI FN E WTKALK+ L NLKW L W
Sbjct: 296 ---FLLPYQMESEKGKINDVENSGGSYSIKYQFNSDEQWTKALKFMLTNLKWLLAW 348
|
In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway. Length = 356 |
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|192987 pfam12325, TMF_TATA_bd, TATA element modulatory factor 1 TATA binding | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 100.0 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 100.0 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 99.45 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 99.04 | |
| KOG2896 | 377 | consensus UV radiation resistance associated prote | 98.62 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 97.36 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.01 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.85 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.07 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 95.81 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.75 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 95.74 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 95.66 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 95.62 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.59 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.45 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.42 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.41 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.27 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.07 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 94.98 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 94.9 | |
| PRK11637 | 428 | AmiB activator; Provisional | 94.81 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 94.78 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 94.75 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.39 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.36 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.21 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.09 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 93.99 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.97 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 93.89 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 93.86 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.85 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 93.81 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.76 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 93.74 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 93.65 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 93.62 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 93.61 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 93.54 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.34 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 93.31 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.14 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 93.11 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.08 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.06 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.89 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.87 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 92.84 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 92.8 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 92.8 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 92.72 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.56 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 92.52 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 92.46 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.45 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 92.19 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 92.13 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.08 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 91.94 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 91.93 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 91.83 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 91.81 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.73 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 91.71 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 91.7 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.67 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 91.63 | |
| COG4985 | 289 | ABC-type phosphate transport system, auxiliary com | 91.45 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 91.44 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.35 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 91.22 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 91.2 | |
| PF15285 | 25 | BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: | 91.19 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 91.19 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 90.86 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 90.86 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 90.82 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 90.79 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 90.75 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.75 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 90.65 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 90.6 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 90.58 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 90.49 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 90.42 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 90.4 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 90.08 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 90.04 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 90.04 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 90.02 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 89.83 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 89.79 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 89.62 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 89.58 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.48 | |
| PRK09039 | 343 | hypothetical protein; Validated | 89.48 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.47 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 89.47 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 89.46 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 89.38 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 89.35 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 89.33 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 88.96 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 88.81 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 88.61 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 88.59 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 88.44 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 88.4 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 88.14 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 88.11 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 88.07 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 88.03 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 87.92 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 87.64 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 87.63 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 87.59 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 87.44 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 87.24 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 87.18 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 87.04 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 86.92 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 86.73 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 86.55 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 86.49 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 86.48 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 86.42 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 86.32 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 86.2 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 85.92 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 85.78 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 85.62 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 85.31 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 85.29 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 85.21 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 85.18 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 85.14 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 85.01 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 85.0 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 84.92 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 84.61 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 84.4 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 84.35 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.2 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 84.07 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 83.88 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 83.87 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 83.64 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 83.57 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 83.52 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 83.52 | |
| PF11414 | 84 | Suppressor_APC: Adenomatous polyposis coli tumour | 83.5 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 83.32 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 83.26 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 83.06 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 82.83 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 82.52 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 82.48 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 82.48 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 82.46 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 82.35 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 82.25 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 82.07 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 82.02 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 81.82 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 81.71 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 81.69 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 81.56 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 81.41 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 81.4 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 81.32 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 81.26 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 81.23 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 81.1 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 80.82 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 80.81 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 80.69 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 80.61 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 80.56 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 80.45 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 80.41 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 80.33 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 80.13 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 80.1 | |
| cd07674 | 261 | F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/A | 80.05 |
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-102 Score=791.69 Aligned_cols=396 Identities=53% Similarity=0.888 Sum_probs=362.2
Q ss_pred CCCccccccCCCC-CCCCCCCCCCCCCCCCccccCCCCCCCceEEEeccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccc
Q 013164 1 MDNSFVVLPKQRP-QSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHS 79 (448)
Q Consensus 1 ~d~s~~~l~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~esfv~l~~s~~~~d~~~~~~~~~~~~~~~~~~~~~~~ls~ 79 (448)
|+.+++|+|.+.+ |..+.|++++++.. ++.. ++.++.++||+.+.+.+..+..+.+-+....+-.+..+.+..++++
T Consensus 37 ~~~~~~~~p~~~~~~~~~~~t~~~~a~~-~~~~-~~~~~~~~~~~~~~~~p~r~~~~~~~~~~~~~~~~~~~~~~~~~s~ 114 (447)
T KOG2751|consen 37 MDISELVLPLHKPPQSQGGPTRPRGASS-GDAT-SGKTPQESSVVVYFSPPVRDSDTEHNLSFELGENGSDGSNTKTLSA 114 (447)
T ss_pred cchhhccCCCCCCccccCCCccCccccC-cccc-CCcchhhccceecccCcccccccccccccccccccchhhhhHHHHH
Confidence 6789999998865 99999999988877 5555 8888899999988776665554444444444433455667888999
Q ss_pred hHHHHHHHHHhhcCCcccCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCCHHHHHHHHHHHHHHHH
Q 013164 80 TITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEER 159 (448)
Q Consensus 80 ~i~~l~~lFdIlS~~s~iDhPLC~eC~d~Lle~Ld~qle~~~~E~~~Y~~fL~~L~~~~~~~~~ee~l~~e~~~Le~EE~ 159 (448)
++++++++|+|+|+|++||||+|.||++.|++.|+++++.+++|+++|++|+++|+++..+ .+++++.+|++.++.||+
T Consensus 115 ~~~~~~~~f~i~~~qt~~d~PlC~eC~d~l~~~ld~e~~~~~~e~~~Y~~~l~~Le~~~~~-~~~~~~~~e~~~l~~eE~ 193 (447)
T KOG2751|consen 115 TINVLTRLFDILSSQTQVDHPLCEECMDVLLNKLDKEVEDAEDEVDTYKACLQRLEQQNQD-VSEEDLLKELKNLKEEEE 193 (447)
T ss_pred HHHHHHHHHHHhhccCCcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCcc-cchHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999987643 478899999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCC
Q 013164 160 KLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 239 (448)
Q Consensus 160 ~L~~eL~~lE~e~~~l~~el~~le~e~~~l~~eE~~~w~e~n~~q~ql~~~~~e~~sl~~q~~~~~~~Ld~L~ktNv~nd 239 (448)
+|.++|++++++.++++.++.+++.+..++.++|.+||++||.+++++.++++++++|++++++++.||++|++|||||.
T Consensus 194 ~L~q~lk~le~~~~~l~~~l~e~~~~~~~~~e~~~~~~~ey~~~~~q~~~~~del~Sle~q~~~s~~qldkL~ktNv~n~ 273 (447)
T KOG2751|consen 194 RLLQQLEELEKEEAELDHQLKELEFKAERLNEEEDQYWREYNNFQRQLIEHQDELDSLEAQIEYSQAQLDKLRKTNVFNA 273 (447)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccchHHHHHHHHHHHHHHHHHHHhhhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeeeecCCeeeeccccCCCCCCCCCChHHHHHHHHHHHHHHHHHHhhcCCCCCCceeeeecCCCceEEecCC---ceee
Q 013164 240 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNN---NTYE 316 (448)
Q Consensus 240 ~F~I~hdG~fGTINGlRLGrlp~~~V~W~EINAAwGQ~~LLL~tla~~l~~~f~~~y~LvPmGS~SkI~~~~~---~~~~ 316 (448)
+|||||+|+|||||||||||+|.+||+|+||||||||+||||++|++++|++|. +|+||||||+|+|+.... ..++
T Consensus 274 ~F~I~~~G~fgtIN~FRLG~lp~~pVew~EINAA~GQ~vLLL~~l~~kig~~~~-~y~lvp~GshSyI~~~~~~~~~el~ 352 (447)
T KOG2751|consen 274 TFHIWHDGEFGTINNFRLGRLPSVPVEWDEINAAWGQTVLLLHTLANKIGLNFV-RYRLVPMGSHSYIKKRMVNLPYELP 352 (447)
T ss_pred eeeEeecccccccccceeccccCCCcCHHHHHHHhhhHHHHHHHHHHhcCcccc-eeeeecccchhHHHHhccCCCccch
Confidence 999999999999999999999999999999999999999999999999999999 999999999999986543 4567
Q ss_pred cc--cCCCCcccccchHHHHHHHHHHHHHHHHHhccCCCCCCCCCCCCCCceeeeCCcccee----eEEecCCCCchhhH
Q 013164 317 LF--GPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKLPYKIENDKVENY----SITQSFNKQENWTK 390 (448)
Q Consensus 317 Ly--g~~~lf~~~kFD~AM~afL~cl~q~~~~~~~~d~~~~~~~~~~~~LPY~I~~dkI~g~----SI~l~~n~~e~WTk 390 (448)
+| |+.+|||++|||+||+|||+||+||++++++++ +.+.+||.|++|+|+|. +|++.||++++||+
T Consensus 353 l~~sgg~~~f~~tkfD~amvafLd~L~qf~~e~~~k~--------~~~~lPy~ie~d~i~d~~~~y~i~~~fN~De~WTr 424 (447)
T KOG2751|consen 353 LFQSGGLKFFWSTKFDKAMVAFLDCLKQFADELEKKD--------TSFNLPYDIEKDKLNDPSSSYSIKVQFNSDENWTR 424 (447)
T ss_pred hhcCCCceeeeccccCHHHHHHHHHHHHHHHHHHhcC--------cccCCcchhhcccccCCccceeEEeeecchHHHHH
Confidence 77 455899999999999999999999999999886 46999999999999986 69999999999999
Q ss_pred HHHHHHhhHHHHHHHHhh
Q 013164 391 ALKYTLCNLKWALFWFVG 408 (448)
Q Consensus 391 AlK~lLtNlKwllaw~~~ 408 (448)
||||||||+||++|||+.
T Consensus 425 ALkFmLTnlK~~~A~vss 442 (447)
T KOG2751|consen 425 ALKFMLTNLKWLLAWVSS 442 (447)
T ss_pred HHHHHHhccHHHHHHHhh
Confidence 999999999999999985
|
|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2896 consensus UV radiation resistance associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4985 ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15285 BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: 3BL2_C 2P1L_H 3DVU_C 2PON_A | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF11414 Suppressor_APC: Adenomatous polyposis coli tumour suppressor protein; PDB: 1M5I_A | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >cd07674 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 448 | ||||
| 4ddp_A | 210 | Crystal Structure Of Beclin 1 Evolutionarily Conser | 3e-42 | ||
| 3vp7_A | 220 | Crystal Structure Of The Beta-Alpha Repeated, Autop | 4e-15 |
| >pdb|4DDP|A Chain A, Crystal Structure Of Beclin 1 Evolutionarily Conserved Domain(Ecd) Length = 210 | Back alignment and structure |
|
| >pdb|3VP7|A Chain A, Crystal Structure Of The Beta-Alpha Repeated, Autophagy-Specific (Bara) Domain Of Vps30ATG6 Length = 220 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 448 | |||
| 4ddp_A | 210 | Beclin-1; ECD, autophagy, membrane binding, membra | 2e-81 | |
| 3vp7_A | 220 | Vacuolar protein sorting-associated protein 30; ta | 2e-73 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 4e-21 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 6e-04 |
| >4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
Score = 249 bits (637), Expect = 2e-81
Identities = 85/211 (40%), Positives = 120/211 (56%), Gaps = 22/211 (10%)
Query: 208 IAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEW 267
+ +E ++ +++ +Q L+ LK+TNV N F IWH G+FGTINNFRLGRLP +PVEW
Sbjct: 1 LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW 60
Query: 268 DEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL----FGPVNL 323
+EINAAWGQ LLLH + KF R +++P G++ + + + EL G +
Sbjct: 61 NEINAAWGQTVLLLHALANKMGLKFQ-RYRLVPYGNHSYLESLTDKSKELPLYCSGGLRF 119
Query: 324 FWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKLPYKIENDK---------VE 374
FW ++D AM FL C++ F E + F LPY+++ +K
Sbjct: 120 FWDNKFDHAMVAFLDCVQQFKEEVEKG--------ETRFCLPYRMDVEKGKIEDTGGSGG 171
Query: 375 NYSITQSFNKQENWTKALKYTLCNLKWALFW 405
+YSI FN +E WTKALK+ L NLKW L W
Sbjct: 172 SYSIKTQFNSEEQWTKALKFMLTNLKWGLAW 202
|
| >3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} Length = 220 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Length = 96 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| 4ddp_A | 210 | Beclin-1; ECD, autophagy, membrane binding, membra | 100.0 | |
| 3vp7_A | 220 | Vacuolar protein sorting-associated protein 30; ta | 100.0 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 99.72 | |
| 2p1l_B | 31 | Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2 | 98.33 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.36 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.29 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 95.96 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 95.58 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.53 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.21 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.09 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.02 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.84 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.28 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.2 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 94.17 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.1 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 93.03 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 90.79 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 90.68 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 90.66 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 90.4 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 89.32 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 88.49 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.25 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.2 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 87.86 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 87.28 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 86.82 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 86.37 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 85.82 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 85.23 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 83.41 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 83.03 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 82.99 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 82.79 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 81.86 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 81.34 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 81.27 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 80.88 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 80.57 |
| >4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.5e-80 Score=584.09 Aligned_cols=192 Identities=44% Similarity=0.900 Sum_probs=172.3
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhcccCCCceeeeecCCeeeeccccCCCCCCCCCChHHHHHHHHHHHHHHHHHHhhc
Q 013164 209 AHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYF 288 (448)
Q Consensus 209 ~~~~e~~sl~~q~~~~~~~Ld~L~ktNv~nd~F~I~hdG~fGTINGlRLGrlp~~~V~W~EINAAwGQ~~LLL~tla~~l 288 (448)
++++|++|+++|++++++||++|+||||||++|||||||+|||||||||||+|++||+|+||||||||+||||++||+++
T Consensus 2 ~~~~e~~sl~~q~~~~~~~L~~L~~tNv~n~~F~I~hdG~fgtINglRLGrlp~~~V~W~EINAAwGq~~LLL~tla~~l 81 (210)
T 4ddp_A 2 ELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKM 81 (210)
T ss_dssp ------CCHHHHHHHHHHHHHTC----CCSSCCCEEEETTEEEETTEECCCBTTBCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred chHHHHHHHHHHHHHHHHHHHHHHhcccccceeEEEecCCceeEcccccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHc
Confidence 67899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCceeeeecCCCceEEecCC--ceeecccCC--CCcccccchHHHHHHHHHHHHHHHHHhccCCCCCCCCCCCCCC
Q 013164 289 RPKFPYRIKIIPMGSYPRIMDSNN--NTYELFGPV--NLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKL 364 (448)
Q Consensus 289 ~~~f~~~y~LvPmGS~SkI~~~~~--~~~~Lyg~~--~lf~~~kFD~AM~afL~cl~q~~~~~~~~d~~~~~~~~~~~~L 364 (448)
+++|+ +|+|+||||+|+|++..+ .+|+|||++ ++|++++||.||+|||+||+||++++++.+ ++++|
T Consensus 82 ~~~f~-~y~L~P~GS~S~I~~~~~~~~~l~Ly~sg~~~~f~~~kFD~Am~afL~cl~q~~~~~~~~~--------~~~~l 152 (210)
T 4ddp_A 82 GLKFQ-RYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGE--------TRFCL 152 (210)
T ss_dssp TCCCS-SEEEECCGGGCEEEESSCTTCCEESCCCSSCGGGCCSHHHHHHHHHHHHHHHHHHHHHCC---------CCCCC
T ss_pred CCCcc-ceeEEecCCcceeeEecCCCeEEeceeCCCccccccccccHHHHHHHHHHHHHHHHHhcCC--------CCCCC
Confidence 99999 999999999999998654 589999754 789999999999999999999999998753 57999
Q ss_pred ceee--eCCccc-------eeeEEecCCCCchhhHHHHHHHhhHHHHHHHHhhC
Q 013164 365 PYKI--ENDKVE-------NYSITQSFNKQENWTKALKYTLCNLKWALFWFVGN 409 (448)
Q Consensus 365 PY~I--~~dkI~-------g~SI~l~~n~~e~WTkAlK~lLtNlKwllaw~~~~ 409 (448)
||+| ++|||+ |+|||+++|++|+||+||||||||+||+|||++..
T Consensus 153 PY~I~~~~dkI~D~~~~~~~~SIrl~~n~~e~WTkAlK~mLtnlKw~La~~s~~ 206 (210)
T 4ddp_A 153 PYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQ 206 (210)
T ss_dssp SSCEETTTTEEECTTTTCCEEESCSTTCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CeEEecCCCEecCccCCCCceEEEecCCCccHHHHHHHHHHHHHHHHHHHHHHh
Confidence 9999 799996 79999999999999999999999999999999863
|
| >3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2p1l_B Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2.50A {Homo sapiens} PDB: 3dvu_C 2pon_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 448 | ||||
| d2ooca1 | 104 | a.24.10.6 (A:8-111) Histidine phosphotransferase S | 0.004 |
| >d2ooca1 a.24.10.6 (A:8-111) Histidine phosphotransferase ShpA {Caulobacter crescentus [TaxId: 155892]} Length = 104 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: Histidine-containing phosphotransfer domain, HPT domain family: SphA-like domain: Histidine phosphotransferase ShpA species: Caulobacter crescentus [TaxId: 155892]
Score = 34.6 bits (79), Expect = 0.004
Identities = 16/102 (15%), Positives = 35/102 (34%), Gaps = 3/102 (2%)
Query: 88 FEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADF 147
F + + E + + ++ + ++ + ++G AR V A
Sbjct: 5 FAYLEGFAAGDFAVVDEVLALFREQAALWAPMLDPTHPGWKDAVHTVKGAARGV--GAFN 62
Query: 148 LKEKLK-IEEEERKLEAAIEETEKQNAEVNAELKELELKSKR 188
L E + E + LE + ++ A E L+S +
Sbjct: 63 LGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLK 104
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00