Citrus Sinensis ID: 013172
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 448 | 2.2.26 [Sep-21-2011] | |||||||
| Q9C5D2 | 610 | F-box/LRR-repeat protein | yes | no | 0.975 | 0.716 | 0.739 | 0.0 | |
| Q9SKK0 | 628 | EIN3-binding F-box protei | no | no | 0.879 | 0.627 | 0.304 | 5e-38 | |
| Q708Y0 | 623 | EIN3-binding F-box protei | no | no | 0.883 | 0.635 | 0.302 | 8e-36 | |
| Q8RWU5 | 665 | F-box/LRR-repeat protein | no | no | 0.892 | 0.601 | 0.282 | 2e-34 | |
| Q9CZV8 | 436 | F-box/LRR-repeat protein | yes | no | 0.654 | 0.672 | 0.313 | 2e-33 | |
| Q96IG2 | 436 | F-box/LRR-repeat protein | yes | no | 0.654 | 0.672 | 0.313 | 3e-33 | |
| Q58DG6 | 436 | F-box/LRR-repeat protein | yes | no | 0.654 | 0.672 | 0.313 | 3e-33 | |
| Q8BH16 | 423 | F-box/LRR-repeat protein | no | no | 0.761 | 0.806 | 0.277 | 4e-33 | |
| Q9UKC9 | 423 | F-box/LRR-repeat protein | no | no | 0.723 | 0.765 | 0.273 | 9e-33 | |
| Q5R3Z8 | 423 | F-box/LRR-repeat protein | yes | no | 0.723 | 0.765 | 0.273 | 9e-33 |
| >sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 667 bits (1721), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 323/437 (73%), Positives = 381/437 (87%)
Query: 12 KGCYVGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITD 71
+GCYVGDQGLAAVGK C QLE+LNLRFCEGLTD G++DL GC KSLKS+G+AA KITD
Sbjct: 174 QGCYVGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITD 233
Query: 72 VSLEAVGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQC 131
+SLEAVGSHCK LE L LDSE+IH+KG+ AVAQGC L+ LKLQC++VTD A AVG C
Sbjct: 234 LSLEAVGSHCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKLQCVSVTDVAFAAVGELC 293
Query: 132 LSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEI 191
SLE LALYSFQ FTDKG+ A+GKG KKLK+LTLSDCYF+S GLEAIA GCKEL +EI
Sbjct: 294 TSLERLALYSFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEI 353
Query: 192 NGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGD 251
NGCHNIGT G+E+IGK C L ELALLYCQRIGN AL E+G+GCKSL+ LHLVDCS IGD
Sbjct: 354 NGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGD 413
Query: 252 DAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQ 311
A+CSIA+GC+NLKKLHIRRCY+IGN GI+++G+HC SLTELSLRFCD+VG++ALI+IG+
Sbjct: 414 IAMCSIAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAIGK 473
Query: 312 GCSLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVV 371
GCSLQ LNVSGC+QI DAGI AIA+GCP+L +LD+SVLQN+GD + ELG+GCP+LKD+V
Sbjct: 474 GCSLQQLNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLV 533
Query: 372 LSHCRQITDVGLSHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSE 431
LSHC ITD GL+HLV+ C++LE+CHMVYCPGIT+AGVATVVS C +IKKV++EKWKV+E
Sbjct: 534 LSHCHHITDNGLNHLVQKCKLLETCHMVYCPGITSAGVATVVSSCPHIKKVLIEKWKVTE 593
Query: 432 RTKRRAGTVISYLCVDL 448
RT RRAG+VISYLC+DL
Sbjct: 594 RTTRRAGSVISYLCMDL 610
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 448 | ||||||
| 255551539 | 601 | TRANSPORT INHIBITOR RESPONSE 1 protein, | 0.895 | 0.667 | 0.835 | 0.0 | |
| 359477463 | 611 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.910 | 0.667 | 0.826 | 0.0 | |
| 147803605 | 672 | hypothetical protein VITISV_030455 [Viti | 0.910 | 0.607 | 0.826 | 0.0 | |
| 357447595 | 610 | F-box/LRR-repeat protein [Medicago trunc | 0.852 | 0.626 | 0.798 | 0.0 | |
| 356563680 | 584 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.904 | 0.693 | 0.798 | 0.0 | |
| 449454438 | 602 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.857 | 0.637 | 0.794 | 0.0 | |
| 449525383 | 513 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.857 | 0.748 | 0.794 | 0.0 | |
| 356549027 | 620 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.975 | 0.704 | 0.771 | 0.0 | |
| 356549029 | 607 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.975 | 0.719 | 0.771 | 0.0 | |
| 297804702 | 610 | F-box family protein [Arabidopsis lyrata | 0.906 | 0.665 | 0.736 | 0.0 |
| >gi|255551539|ref|XP_002516815.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223543903|gb|EEF45429.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 743 bits (1917), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 365/437 (83%), Positives = 403/437 (92%)
Query: 12 KGCYVGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITD 71
+GCYVGD+GLA VGK C QLEDLNLRFCE LTDTGL++LA GCGKSLKSLG+AACVKITD
Sbjct: 165 QGCYVGDRGLAVVGKCCKQLEDLNLRFCESLTDTGLIELAQGCGKSLKSLGVAACVKITD 224
Query: 72 VSLEAVGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQC 131
+SLEAVGS+CKSLETLSLDSE IH GV ++AQGCP L+VLKLQC NVTDEAL+AVG C
Sbjct: 225 ISLEAVGSYCKSLETLSLDSESIHTSGVLSIAQGCPSLKVLKLQCTNVTDEALIAVGTCC 284
Query: 132 LSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEI 191
LSLELLAL SFQ+FTDKGL ++G GCKKLKNLTLSDCYFLSD GLEAIA+GC+ELTHLE+
Sbjct: 285 LSLELLALCSFQRFTDKGLRSIGDGCKKLKNLTLSDCYFLSDKGLEAIASGCRELTHLEV 344
Query: 192 NGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGD 251
NGCH IGT+GLE+IG+ C +LTELALLYCQRI N ALLE+G+GCK LQALHLVDCSSIGD
Sbjct: 345 NGCHIIGTLGLEAIGRSCSHLTELALLYCQRISNHALLEIGKGCKFLQALHLVDCSSIGD 404
Query: 252 DAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQ 311
DAICSIA+GC+NLKKLHIRRCY+IGN GIVA+GEHC L +LSLRFCDRVGDEALI+IGQ
Sbjct: 405 DAICSIAKGCRNLKKLHIRRCYEIGNKGIVAIGEHCKFLMDLSLRFCDRVGDEALIAIGQ 464
Query: 312 GCSLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVV 371
GCSL HLNVSGCH IGDAGI+AIA+GCPEL+YLDVSVLQNLGD AM ELG+GCPLLKDVV
Sbjct: 465 GCSLHHLNVSGCHLIGDAGIIAIARGCPELSYLDVSVLQNLGDMAMAELGEGCPLLKDVV 524
Query: 372 LSHCRQITDVGLSHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSE 431
LSHCRQITDVGL+HLVKNC MLESCH+VYCPGITAAG+ATVVS C NIKKV+VEKWKVSE
Sbjct: 525 LSHCRQITDVGLAHLVKNCSMLESCHLVYCPGITAAGIATVVSSCTNIKKVLVEKWKVSE 584
Query: 432 RTKRRAGTVISYLCVDL 448
RTKRRAG+VISYLCVDL
Sbjct: 585 RTKRRAGSVISYLCVDL 601
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359477463|ref|XP_002279087.2| PREDICTED: F-box/LRR-repeat protein 4-like [Vitis vinifera] gi|297736957|emb|CBI26158.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147803605|emb|CAN75354.1| hypothetical protein VITISV_030455 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357447595|ref|XP_003594073.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355483121|gb|AES64324.1| F-box/LRR-repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356563680|ref|XP_003550089.1| PREDICTED: F-box/LRR-repeat protein 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449454438|ref|XP_004144962.1| PREDICTED: F-box/LRR-repeat protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449525383|ref|XP_004169697.1| PREDICTED: F-box/LRR-repeat protein 4-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356549027|ref|XP_003542900.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356549029|ref|XP_003542901.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297804702|ref|XP_002870235.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297316071|gb|EFH46494.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 448 | ||||||
| TAIR|locus:505006471 | 610 | AT4G15475 "AT4G15475" [Arabido | 0.975 | 0.716 | 0.739 | 4.2e-182 | |
| TAIR|locus:2040105 | 628 | EBF1 "AT2G25490" [Arabidopsis | 0.879 | 0.627 | 0.304 | 3.1e-44 | |
| TAIR|locus:2149805 | 665 | AT5G01720 "AT5G01720" [Arabido | 0.895 | 0.603 | 0.298 | 1.6e-43 | |
| TAIR|locus:2143320 | 642 | AT5G27920 "AT5G27920" [Arabido | 0.870 | 0.607 | 0.286 | 7.3e-43 | |
| TAIR|locus:2145512 | 623 | EBF2 "EIN3-binding F box prote | 0.879 | 0.632 | 0.3 | 1.9e-42 | |
| TAIR|locus:2166978 | 405 | AT5G23340 [Arabidopsis thalian | 0.640 | 0.708 | 0.329 | 5.9e-41 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.794 | 0.841 | 0.273 | 8.7e-40 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.761 | 0.782 | 0.295 | 1.1e-39 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.794 | 0.843 | 0.273 | 1.1e-39 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.794 | 0.841 | 0.275 | 1.4e-39 |
| TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1767 (627.1 bits), Expect = 4.2e-182, P = 4.2e-182
Identities = 323/437 (73%), Positives = 381/437 (87%)
Query: 12 KGCYVGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITD 71
+GCYVGDQGLAAVGK C QLE+LNLRFCEGLTD G++DL GC KSLKS+G+AA KITD
Sbjct: 174 QGCYVGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITD 233
Query: 72 VSLEAVGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQC 131
+SLEAVGSHCK LE L LDSE+IH+KG+ AVAQGC L+ LKLQC++VTD A AVG C
Sbjct: 234 LSLEAVGSHCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKLQCVSVTDVAFAAVGELC 293
Query: 132 LSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEI 191
SLE LALYSFQ FTDKG+ A+GKG KKLK+LTLSDCYF+S GLEAIA GCKEL +EI
Sbjct: 294 TSLERLALYSFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEI 353
Query: 192 NGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGD 251
NGCHNIGT G+E+IGK C L ELALLYCQRIGN AL E+G+GCKSL+ LHLVDCS IGD
Sbjct: 354 NGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGD 413
Query: 252 DAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQ 311
A+CSIA+GC+NLKKLHIRRCY+IGN GI+++G+HC SLTELSLRFCD+VG++ALI+IG+
Sbjct: 414 IAMCSIAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAIGK 473
Query: 312 GCSLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVV 371
GCSLQ LNVSGC+QI DAGI AIA+GCP+L +LD+SVLQN+GD + ELG+GCP+LKD+V
Sbjct: 474 GCSLQQLNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLV 533
Query: 372 LSHCRQITDVGLSHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSE 431
LSHC ITD GL+HLV+ C++LE+CHMVYCPGIT+AGVATVVS C +IKKV++EKWKV+E
Sbjct: 534 LSHCHHITDNGLNHLVQKCKLLETCHMVYCPGITSAGVATVVSSCPHIKKVLIEKWKVTE 593
Query: 432 RTKRRAGTVISYLCVDL 448
RT RRAG+VISYLC+DL
Sbjct: 594 RTTRRAGSVISYLCMDL 610
|
|
| TAIR|locus:2040105 EBF1 "AT2G25490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149805 AT5G01720 "AT5G01720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145512 EBF2 "EIN3-binding F box protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9C5D2 | FBL4_ARATH | No assigned EC number | 0.7391 | 0.9754 | 0.7163 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 448 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-19 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-18 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 2e-17 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-15 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-14 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 2e-13 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-13 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 2e-06 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 0.003 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 85.5 bits (212), Expect = 4e-19
Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 10/167 (5%)
Query: 261 CQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGC-SLQHLN 319
L+ L + C + + +CN L +L L + DE LI++ Q C +LQ L+
Sbjct: 27 HSGLEWLELYMCPIS--DPPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLD 84
Query: 320 VSGCHQIGDAGIMAIAKGCPELNYLDVSVLQN---LGDQAMVELGKGCPLLKDVVLSHCR 376
+ C I D+GI+A+A CP+L +++ +N + D ++ LGK C L+ V + C
Sbjct: 85 LRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC- 143
Query: 377 QITDVGLSHLVKNC-RMLESCHMVYCPGITAAGVATVV--SGCANIK 420
+TD G+ L C + LE + C +T + ++ + N+
Sbjct: 144 DVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLS 190
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 448 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.96 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.96 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.89 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.89 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.83 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.82 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.74 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.72 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.69 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.68 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.65 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.62 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.61 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.6 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.52 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.52 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.36 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.29 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.28 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.28 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.28 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.21 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.95 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.94 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.91 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.9 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.89 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.89 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.81 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.68 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.67 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.66 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.64 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.55 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.46 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.43 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.38 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.38 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.28 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.28 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.27 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.14 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.01 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.96 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.63 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.44 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.29 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.26 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.2 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.14 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.03 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.01 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.0 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.89 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.89 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.86 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.84 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.71 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.6 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.58 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.58 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.43 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.37 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.09 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.05 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.64 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.57 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.9 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 94.53 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.39 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.35 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 92.83 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 89.69 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 88.43 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 88.16 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 87.77 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 87.73 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 85.93 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 85.09 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.96 E-value=7.5e-30 Score=217.19 Aligned_cols=321 Identities=30% Similarity=0.561 Sum_probs=205.1
Q ss_pred CCceeeccccc-cchhhHHHHhhcCCcccEEEee-ccCCCcHHHHHHHhhccccccccccccccCChhHHHHHhhcCCCC
Q 013172 83 SLETLSLDSEF-IHNKGVHAVAQGCPLLRVLKLQ-CINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKL 160 (448)
Q Consensus 83 ~L~~L~l~~~~-~~~~~~~~~~~~~~~L~~L~l~-~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L 160 (448)
.|+.|++.++. +....+..+..++|++++|.+. +..+++.....+++.|++|++|++..|..+++..+..+..+|++|
T Consensus 139 ~lk~LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL 218 (483)
T KOG4341|consen 139 FLKELSLRGCRAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKL 218 (483)
T ss_pred ccccccccccccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhH
Confidence 45555555543 2233344444455555555553 334666777777777788888888877777777777777788888
Q ss_pred CEEeecCCccCChhhHHHHHhcCCCCcEEEecCCCCCChhhHHHHhhcCCCcceEecccccccCchhHHHHhccCcCCce
Q 013172 161 KNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQA 240 (448)
Q Consensus 161 ~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~ 240 (448)
+++++++|+.+...++..+.+++..++.+...||.......+......++.+.++++..|..+++.....+...+..|+.
T Consensus 219 ~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~ 298 (483)
T KOG4341|consen 219 KYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQV 298 (483)
T ss_pred HHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhh
Confidence 88888888877777777777777777777777777777777777777777777777777777777776666666777777
Q ss_pred EeccCCcCcChHHHHHHHHhCCCCcEEEccccccccCchHhHhhhcCCCCcEEeccccCCcCchHHHhhccCCC-ccEEe
Q 013172 241 LHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGCS-LQHLN 319 (448)
Q Consensus 241 L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~-L~~L~ 319 (448)
+..++|..+++..+..+.+++++|+.+.+.+|..+++.++..+..+++.|+.+++..|..+.+..+..++..++ |+.+.
T Consensus 299 l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~ls 378 (483)
T KOG4341|consen 299 LCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLS 378 (483)
T ss_pred hcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCC
Confidence 77777777777777777777777777777777777777777777777777777776665555444444444332 55555
Q ss_pred eeCccccChHHHHHHHhhCCCCCEEeccCcCCCCHHHHHHHhcCCCCCcEEeccCCCCCChHHHHHHHHcCccCceEecc
Q 013172 320 VSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITDVGLSHLVKNCRMLESCHMV 399 (448)
Q Consensus 320 l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~L~~L~l~ 399 (448)
++.|..++++++..+... ......|+.+.+++|+.+++..++++. .|++|+.+++.
T Consensus 379 lshce~itD~gi~~l~~~-----------------------~c~~~~l~~lEL~n~p~i~d~~Le~l~-~c~~Leri~l~ 434 (483)
T KOG4341|consen 379 LSHCELITDEGIRHLSSS-----------------------SCSLEGLEVLELDNCPLITDATLEHLS-ICRNLERIELI 434 (483)
T ss_pred hhhhhhhhhhhhhhhhhc-----------------------cccccccceeeecCCCCchHHHHHHHh-hCcccceeeee
Confidence 555555554443333210 012345555555555555555555443 45556666655
Q ss_pred CCCCCCHHHHHHHHhcCccceEEEEeee
Q 013172 400 YCPGITAAGVATVVSGCANIKKVMVEKW 427 (448)
Q Consensus 400 ~c~~~~~~~~~~~~~~~~~L~~L~l~~~ 427 (448)
+|..++..++..+..++|+++...+..-
T Consensus 435 ~~q~vtk~~i~~~~~~lp~i~v~a~~a~ 462 (483)
T KOG4341|consen 435 DCQDVTKEAISRFATHLPNIKVHAYFAP 462 (483)
T ss_pred chhhhhhhhhHHHHhhCccceehhhccC
Confidence 6655555555555555555555544433
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 448 | ||||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 9e-12 | ||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 9e-10 |
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
|
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
Score = 251 bits (641), Expect = 2e-77
Identities = 82/440 (18%), Positives = 175/440 (39%), Gaps = 37/440 (8%)
Query: 16 VGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLE 75
+ + QL+ ++ R ++D L LA L++L + C T L
Sbjct: 99 YVTPWVTEISNNLRQLKSVHFRRMI-VSDLDLDRLAKARADDLETLKLDKCSGFTTDGLL 157
Query: 76 AVGSHCKSLETLSLDSEFIHNKG---VHAVAQGCPLLRVLKL---QCINVTDEALVAVGN 129
++ +HC+ ++TL ++ K +H +AQ L VL + ++ + L +
Sbjct: 158 SIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIAR 217
Query: 130 QCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHL 189
C SL + + F+ G ++ +L++ + + + L
Sbjct: 218 NCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMN-----LVFPRKL 272
Query: 190 EINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSI 249
G +G + + F + +L LLY + + C +L+ L + I
Sbjct: 273 CRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETE-DHCTLIQKCPNLEVLETRNV--I 329
Query: 250 GDDAICSIAEGCQNLKKLHIRRCYK----------IGNNGIVAVGEHCNSLTELSLRFCD 299
GD + +A+ C+ LK+L I R + G++A+ + C L +++ +
Sbjct: 330 GDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAV-YVS 388
Query: 300 RVGDEALISIGQGC----SLQHLNVSGCHQI----GDAGIMAIAKGCPELNYLDVSVL-Q 350
+ +E+L SIG + + + +I D G+ ++ GC +L +
Sbjct: 389 DITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQG 448
Query: 351 NLGDQAMVELGKGCPLLKDVVLSHCRQITDVGLSHLVKNCRMLESCHMVYCPGITAAGVA 410
L D + +G+ P ++ ++L + +D GL + C L+ M C + +A
Sbjct: 449 GLTDLGLSYIGQYSPNVRWMLLGYV-GESDEGLMEFSRGCPNLQKLEMRGCC-FSERAIA 506
Query: 411 TVVSGCANIKKVMVEKWKVS 430
V+ +++ + V+ ++ S
Sbjct: 507 AAVTKLPSLRYLWVQGYRAS 526
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 448 | |||
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 100.0 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 100.0 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 100.0 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 100.0 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 100.0 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.97 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.93 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.92 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.92 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.91 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.91 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.91 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.9 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.9 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.9 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.89 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.89 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.88 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.87 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.87 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.87 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.87 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.87 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.86 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.86 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.85 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.85 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.83 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.83 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.83 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.82 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.82 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.81 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.8 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.8 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.79 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.79 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.79 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.78 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.77 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.76 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.75 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.75 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.72 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.67 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.67 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.64 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.64 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.64 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.63 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.59 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.58 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.57 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.56 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.55 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.54 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.52 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.52 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.5 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.49 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.48 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.48 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.47 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.46 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.45 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.45 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.45 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.45 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.45 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.44 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.44 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.44 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.42 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.42 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.42 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.41 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.41 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.4 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.39 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.39 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.37 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.31 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.26 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.23 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.21 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.21 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.21 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.14 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.14 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.12 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.11 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.1 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.1 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.09 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.06 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.01 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.01 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.98 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.94 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.94 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.93 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.92 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.92 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.9 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.82 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.81 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.79 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.77 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.73 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.72 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.71 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.69 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.69 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.67 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.66 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.64 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.63 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.63 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.62 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.61 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.61 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.6 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.58 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.57 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.56 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.55 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.5 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.5 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.44 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.4 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.39 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.33 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.33 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.26 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.18 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.1 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.93 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.92 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.89 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.79 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.75 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.69 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.66 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.55 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.54 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.22 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.2 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.13 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 96.99 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.72 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.64 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 96.54 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 84.31 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 80.12 |
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-36 Score=296.76 Aligned_cols=403 Identities=21% Similarity=0.325 Sum_probs=306.5
Q ss_pred ccchhccccCCcceeeeccccccChhHHHHHHhhhCCCccEEEeccCCccChhhHHHHHhcCCCCceeeccccccchhh-
Q 013172 20 GLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLETLSLDSEFIHNKG- 98 (448)
Q Consensus 20 ~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~- 98 (448)
++..+...+++|++|+|+++ .+++..+..+...+..+|++|++++|..++...+..+...|++|++|++++|.++..+
T Consensus 103 ~l~~l~~~~~~L~~L~L~~~-~i~~~~~~~l~~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~~~~ 181 (592)
T 3ogk_B 103 WVTEISNNLRQLKSVHFRRM-IVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDG 181 (592)
T ss_dssp HHHHHHHHCTTCCEEEEESC-BCCHHHHHHHHHHHGGGCCEEEEESCEEEEHHHHHHHHHHCTTCSEEECTTCEEECCCS
T ss_pred HHHHHHhhCCCCCeEEeecc-EecHHHHHHHHHhccccCcEEECcCCCCcCHHHHHHHHhhCCCCCEEECccccccCcch
Confidence 45555667788888888887 6777666666655533488888888876677777777778888888888888765544
Q ss_pred --HHHHhhcCCcccEEEeeccCCC---cHHHHHHHhhccccccccccccccCChhHHHHHhhcCCCCCEEeecCCccC-C
Q 013172 99 --VHAVAQGCPLLRVLKLQCINVT---DEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFL-S 172 (448)
Q Consensus 99 --~~~~~~~~~~L~~L~l~~~~~~---~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~-~ 172 (448)
+..+...+++|++|+++++.++ ...+..+...+++|++|+++++. + .+++.....+++|++|+++..... .
T Consensus 182 ~~l~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-~--~~l~~~~~~~~~L~~L~l~~~~~~~~ 258 (592)
T 3ogk_B 182 KWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFE-I--LELVGFFKAAANLEEFCGGSLNEDIG 258 (592)
T ss_dssp HHHHHHHHHCCCCCEEECTTCCCSSCCHHHHHHHHHHCTTCCEEECSSCB-G--GGGHHHHHHCTTCCEEEECBCCCCTT
T ss_pred hHHHHHHhcCCCccEEEeeccCCCccCHHHHHHHHhhCCCCcEEeccCcc-H--HHHHHHHhhhhHHHhhcccccccccc
Confidence 4556667888888888777665 45566666668888888888753 2 234556667788888888753211 1
Q ss_pred hhhHHHHHhcCCCCcEEEecCCCCCChhhHHHHhhcCCCcceEecccccccCchhHHHHhccCcCCceEeccCCcCcChH
Q 013172 173 DMGLEAIATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDD 252 (448)
Q Consensus 173 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~ 252 (448)
..........+++|+.|.+.+. ....+..+...+++|++|++++|. +.+..+..+...+++|+.|++.+ .+.+.
T Consensus 259 ~~~~~~~l~~~~~L~~L~l~~~---~~~~l~~~~~~~~~L~~L~Ls~~~-l~~~~~~~~~~~~~~L~~L~L~~--~~~~~ 332 (592)
T 3ogk_B 259 MPEKYMNLVFPRKLCRLGLSYM---GPNEMPILFPFAAQIRKLDLLYAL-LETEDHCTLIQKCPNLEVLETRN--VIGDR 332 (592)
T ss_dssp CTTSSSCCCCCTTCCEEEETTC---CTTTGGGGGGGGGGCCEEEETTCC-CCHHHHHHHHTTCTTCCEEEEEG--GGHHH
T ss_pred hHHHHHHhhccccccccCcccc---chhHHHHHHhhcCCCcEEecCCCc-CCHHHHHHHHHhCcCCCEEeccC--ccCHH
Confidence 0111112234677888877663 233344555667899999999866 77777767778899999999984 46777
Q ss_pred HHHHHHHhCCCCcEEEccc----------cccccCchHhHhhhcCCCCcEEeccccCCcCchHHHhhcc-CCCccEEeee
Q 013172 253 AICSIAEGCQNLKKLHIRR----------CYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQ-GCSLQHLNVS 321 (448)
Q Consensus 253 ~~~~~~~~~~~L~~L~l~~----------~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~-~~~L~~L~l~ 321 (448)
++..+...+++|++|++.+ |..+++.++..+...+++|++|++ +++.+++..+..+.. .++|++|++.
T Consensus 333 ~l~~~~~~~~~L~~L~L~~g~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~L~l-~~~~l~~~~~~~l~~~~~~L~~L~l~ 411 (592)
T 3ogk_B 333 GLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAV-YVSDITNESLESIGTYLKNLCDFRLV 411 (592)
T ss_dssp HHHHHHHHCTTCCEEEEECCCCSSTTSSTTCCCCHHHHHHHHHHCTTCSEEEE-EESCCCHHHHHHHHHHCCSCCEEEEE
T ss_pred HHHHHHHhCCCCCEEEeecCccccccccccCccCHHHHHHHHhhCccCeEEEe-ecCCccHHHHHHHHhhCCCCcEEEEe
Confidence 7888888899999999995 677887788887888999999999 556788888888877 6679999997
Q ss_pred C---ccccCh----HHHHHHHhhCCCCCEEeccCcC-CCCHHHHHHHhcCCCCCcEEeccCCCCCChHHHHHHHHcCccC
Q 013172 322 G---CHQIGD----AGIMAIAKGCPELNYLDVSVLQ-NLGDQAMVELGKGCPLLKDVVLSHCRQITDVGLSHLVKNCRML 393 (448)
Q Consensus 322 ~---~~~~~~----~~~~~~~~~~~~L~~L~l~~~~-~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~L 393 (448)
+ |+.+++ .++..+...+++|++|+++.|. .+++..+..+...+++|++|++++| .+++.++..+...+++|
T Consensus 412 ~~~~~n~l~~~p~~~~~~~~~~~~~~L~~L~L~~~~~~l~~~~~~~~~~~~~~L~~L~L~~n-~l~~~~~~~~~~~~~~L 490 (592)
T 3ogk_B 412 LLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYV-GESDEGLMEFSRGCPNL 490 (592)
T ss_dssp ECSCCSCCSSCCCHHHHHHHHHHCTTCCEEEEECCGGGCCHHHHHHHHHSCTTCCEEEECSC-CSSHHHHHHHHTCCTTC
T ss_pred ecCCCccccCchHHHHHHHHHHhCCCCCEEEEecCCCCccHHHHHHHHHhCccceEeeccCC-CCCHHHHHHHHhcCccc
Confidence 3 556765 4677778889999999998754 3788888888888999999999985 59988888888889999
Q ss_pred ceEeccCCCCCCHHHHHHHHhcCccceEEEEeeeeecccccc
Q 013172 394 ESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSERTKR 435 (448)
Q Consensus 394 ~~L~l~~c~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~ 435 (448)
++|++++|+ +++.++..+...+++|+.|++++|++++.+..
T Consensus 491 ~~L~l~~n~-l~~~~~~~~~~~l~~L~~L~ls~n~it~~~~~ 531 (592)
T 3ogk_B 491 QKLEMRGCC-FSERAIAAAVTKLPSLRYLWVQGYRASMTGQD 531 (592)
T ss_dssp CEEEEESCC-CBHHHHHHHHHHCSSCCEEEEESCBCCTTCTT
T ss_pred CeeeccCCC-CcHHHHHHHHHhcCccCeeECcCCcCCHHHHH
Confidence 999999998 88888888888899999999999999887653
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 448 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 5e-16 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-10 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-08 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 5e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1io0a_ | 166 | c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic | 5e-04 | |
| d1io0a_ | 166 | c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic | 0.004 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.002 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 75.9 bits (185), Expect = 5e-16
Identities = 47/235 (20%), Positives = 81/235 (34%), Gaps = 6/235 (2%)
Query: 109 LRVLKLQCINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDC 168
V+ +C + +A ++ + L S LH + C KL+NL+L
Sbjct: 23 QGVIAFRCPRSFMDQPLAEHFSPFRVQHMDL-SNSVIEVSTLHGILSQCSKLQNLSLEGL 81
Query: 169 YFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTEL-ALLYCQRIGNLA 227
LSD + +A L L ++GC L+++ C L EL
Sbjct: 82 R-LSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV 139
Query: 228 LLEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHC 287
+ V +++ L+L + S + N
Sbjct: 140 QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQL 199
Query: 288 NSLTELSLRFCDRVGDEALISIGQGCSLQHLNVSGCHQIGDAGIMAIAKGCPELN 342
N L LSL C + E L+ +G+ +L+ L V G + D + + + P L
Sbjct: 200 NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ 252
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 448 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.91 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.91 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.9 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.9 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.65 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.59 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.58 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.56 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.13 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.12 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.12 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.11 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.06 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.01 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.01 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.99 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.98 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.97 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.9 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.87 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.85 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.81 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.81 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.79 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.74 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.71 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.71 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.62 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.6 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.58 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.48 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.48 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.47 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.47 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.39 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.38 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.27 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.18 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.6 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.51 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.13 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.93 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91 E-value=8.5e-24 Score=182.88 Aligned_cols=250 Identities=19% Similarity=0.265 Sum_probs=180.2
Q ss_pred cceeeeccccccChhHHHHHHhhhCCCccEEEeccCCccChhhHHHHHhcCCCCceeeccccccchhhHHHHhhcCCccc
Q 013172 31 LEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLR 110 (448)
Q Consensus 31 L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~ 110 (448)
+++||+++. .+....+..+.. .....+.+.... +...... .....+|++|+++++.++...+..++..+++|+
T Consensus 2 W~~lDLs~~-~l~~~~l~~l~~---~~~~~lrl~~~~-~~~~~~~--~~~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~ 74 (284)
T d2astb2 2 WQTLDLTGK-NLHPDVTGRLLS---QGVIAFRCPRSF-MDQPLAE--HFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQ 74 (284)
T ss_dssp SSEEECTTC-BCCHHHHHHHHH---TTCSEEECTTCE-ECSCCCS--CCCCBCCCEEECTTCEECHHHHHHHHTTBCCCS
T ss_pred cCEEECCCC-CCCchHHHHHHh---ccceEeeccccc-cccchhh--hccCCCCCEEECCCCccCHHHHHHHHHhCCCcc
Confidence 467788776 455555555543 345566665432 1111111 112467888888888888877877788888888
Q ss_pred EEEeeccCCCcHHHHHHHhhccccccccccccccCChhHHHHHhhcCCCCCEEeecCCccCChhhHHHHH-hcCCCCcEE
Q 013172 111 VLKLQCINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIA-TGCKELTHL 189 (448)
Q Consensus 111 ~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~-~~~~~L~~L 189 (448)
+|+++++.+++..+..++. +++|++|++++|..+++.++..+...+++|++|++++|..+++.++.... ..+++|+.|
T Consensus 75 ~L~L~~~~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L 153 (284)
T d2astb2 75 NLSLEGLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQL 153 (284)
T ss_dssp EEECTTCBCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEE
T ss_pred cccccccCCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcccccccchh
Confidence 8888888888777777765 78888888888888888888888888888888888888777777665433 345788888
Q ss_pred EecCC-CCCChhhHHHHhhcCCCcceEecccccccCchhHHHHhccCcCCceEeccCCcCcChHHHHHHHHhCCCCcEEE
Q 013172 190 EINGC-HNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLH 268 (448)
Q Consensus 190 ~l~~~-~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~ 268 (448)
++.++ ..+.+.++..+...||+|++|++++|..+++..+..+ .++++|++|++++|..+++.++..+. .+|+|+.|+
T Consensus 154 ~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l-~~~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~ 231 (284)
T d2astb2 154 NLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF-FQLNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQ 231 (284)
T ss_dssp ECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG-GGCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEE
T ss_pred hhcccccccccccccccccccccccccccccccCCCchhhhhh-cccCcCCEEECCCCCCCChHHHHHHh-cCCCCCEEe
Confidence 88876 3567777777777788888888888777776665444 45788888888888778777666654 478888888
Q ss_pred ccccccccCchHhHhhhcCCCCcE
Q 013172 269 IRRCYKIGNNGIVAVGEHCNSLTE 292 (448)
Q Consensus 269 l~~~~~~~~~~~~~~~~~~~~L~~ 292 (448)
+.+| +++.++..+...+|+|+.
T Consensus 232 l~~~--~~d~~l~~l~~~lp~L~i 253 (284)
T d2astb2 232 VFGI--VPDGTLQLLKEALPHLQI 253 (284)
T ss_dssp CTTS--SCTTCHHHHHHHSTTSEE
T ss_pred eeCC--CCHHHHHHHHHhCccccc
Confidence 8876 667777777777787763
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|