Citrus Sinensis ID: 013264

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MGKAEKKQQQQEVQNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSAAKITSTKKDQQQDDDDHELHQQRQEVHRTPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
cccHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccEEEEEEcccccEEEccccccccccccEEEEEEcccEEEEEEcccccccccccEEEEEEcccccccEEEcccccccccccEEEEEccEEEEEEcccccccccccEEEEEEcccccEEEcccccccccccEEEEEEccEEEEEEccccccccccccEEEEEEcccccEEEcccccccccccccccEEEEEEEcccccEEEEEcccEEEEcccEEccEEEEEEEEcccccccccccccEEEEEEEEEEcccEEEEEEcccccccccccEEEcccccccccccEEEEEEEcccccccEEEEEcccccccccEEEEEEEc
cccccHcccccccccccccccHHHHHHHHHHccHHHcHHHHHHHHHHHHHHccccHHHHcccccccccEEEEEccccccccccccHHHccccccccccccccccccccccccccccEEEEEccccccccccEEEEEccccccEEEcccccccccccEEEEEEEEccEEEEEEcccccccccccEEEEEccccccccEEEccccccccccEEEEEEccEEEEEEEccccccccccEEEEEccccccEEEEccccccccccEEEEEEccEEEEEEcccccccccccccEEEEcccccccEEcccccccccccccccEEEEEEEEEcccccccccccEEEEccccccEEEEEccccccccccEEEEEccccccEEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccccEEEEccEEEEEccccccccccEEEEc
MGKAEKKQQQQEVQNlipglpdeiAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRsgkaehlvcqvqplplsppnpkdsssatthlvSDSAAKitstkkdqqqddddhELHQQRQEVhrtplqygltifnasngtwerirphvgripmfcqcvavpasrkllliggwdpitlepvpdvyvldmvnnssrwrrvkpmsVARSFFACAVVGASTvcvagghdgqknalksaevydveadewrmlpemdeerdecqgvclegdrffvvsgygtesqgrfkpdaecydpktgswskfdhvwpfpslsprgstatITSYRLQQHQWLWFLGkeqqqngevvkgkivssivplpksvtegssspcvsvttlhnsqQQQKVFVMtgnggrgcssssALSSFICNECEGEGAFIMERdmsngnikwdhvhlpvgfsgfpcsasflli
mgkaekkqqQQEVQNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSAAKITSTKKDQQQDDDDHELHQQRQEvhrtplqyglTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVagghdgqknalksaevYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGygtesqgrfkpdaECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
MGKAekkqqqqevqNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSAAKITSTKKdqqqddddhelhqqrqeVHRTPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCssssalssFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
***************LIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQV*****************************************************TPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLP*****RDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVP***************************VFVMTG**********ALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFL**
*******************LPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSA***********QDDDDHELHQQRQEVHRTPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
************VQNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLS********************************************VHRTPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLP*************VTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
***********EVQNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSAAKITSTKKDQQQDDDDHELHQQRQEVHRTPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKAEKKQQQQEVQNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSAAKITSTKKDQQQDDDDHELHQQRQEVHRTPLQYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query446 2.2.26 [Sep-21-2011]
Q9M1Y1418 F-box/kelch-repeat protei yes no 0.905 0.966 0.432 4e-88
O80582409 F-box/kelch-repeat protei no no 0.636 0.694 0.509 3e-81
Q9M8L2354 F-box/kelch-repeat protei no no 0.531 0.669 0.349 1e-35
Q9LMR5359 F-box/kelch-repeat protei no no 0.542 0.674 0.355 1e-34
Q93W93434 F-box/kelch-repeat protei no no 0.533 0.548 0.260 4e-17
Q0WW40383 F-box/kelch-repeat protei no no 0.531 0.618 0.249 3e-14
P57790624 Kelch-like ECH-associated yes no 0.304 0.217 0.315 1e-11
Q684M4624 Kelch-like ECH-associated yes no 0.304 0.217 0.308 4e-11
Q0V7S6442 F-box/kelch-repeat protei no no 0.464 0.468 0.253 5e-11
Q9C6Z0398 F-box/kelch-repeat protei no no 0.515 0.577 0.254 5e-11
>sp|Q9M1Y1|SKI20_ARATH F-box/kelch-repeat protein SKIP20 OS=Arabidopsis thaliana GN=SKIP20 PE=1 SV=1 Back     alignment and function desciption
 Score =  325 bits (833), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 199/460 (43%), Positives = 263/460 (57%), Gaps = 56/460 (12%)

Query: 1   MGKAEKKQQQQEVQNLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRER 60
           MG ++KK  +    +LIPGLP+E+A+ECL+RVP++FH+ +KSVC+ W  +ISS SF +ER
Sbjct: 1   MGVSKKKSGEIR-GDLIPGLPEELAIECLVRVPFQFHSSIKSVCRSWKCVISSRSFIKER 59

Query: 61  IRSGKAEHLVCQVQPLPLSPPNPKDSSSATTHLVSDSAAKITSTKKDQQQDDDDHELHQQ 120
           I  GKAE L+C VQPL  SPP+P                +  S    Q        L Q 
Sbjct: 60  IGFGKAESLLCLVQPL-TSPPSPAMMEGGEMSQKKKEEEEGESQMTQQ--------LLQP 110

Query: 121 RQEVHRTPLQYGLTIFNASNGTWERIR-PHVGRIPMFCQCVAVPASRKLLLIGGWDPITL 179
           R  +  TPL YGL+++NA+  TW R+  P   RIP+FC+CVA+  + K+LLIGGWDP TL
Sbjct: 111 R--ITGTPL-YGLSVYNATLDTWHRVAIPE--RIPLFCECVAIQDAGKVLLIGGWDPETL 165

Query: 180 EPVPDVYVLDMV---NNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSA 236
           +PV DV+VLD      +  R+RR +PMS ARSFFACA VG++ V VAGGHD QKNAL+SA
Sbjct: 166 QPVRDVFVLDFFAGEGSGRRFRRGRPMSAARSFFACASVGSTKVYVAGGHDDQKNALRSA 225

Query: 237 EVYDVEADEWRMLPEMDEERDECQGVCLEGD-RFFVVSGYGTESQGRFKPDAECYDPKTG 295
           EVYDVE DEW MLP M E RDEC G  +  D  F V+SGYGTE+QG+F+ D E YDP T 
Sbjct: 226 EVYDVEKDEWSMLPPMTEGRDECHGFSMATDPGFCVLSGYGTETQGQFRSDGEIYDPITN 285

Query: 296 SWSKFDHVWPFPSLSPRGSTATITSYRLQQHQW--LW-FLGKEQQQ------NGEVVKGK 346
           SWS  ++VWPFP LSPRG TA   +      +   LW F+  E+Q         + +K K
Sbjct: 286 SWSTIENVWPFPDLSPRGRTAAAAAEFPGDFRGCRLWCFIDSERQSQPHWEVEDDSMKWK 345

Query: 347 IVSSIVPLPKSVTEGSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNEC 406
           ++   + L          P  ++T++       +   M G GG                 
Sbjct: 346 VIMDTIRL----------PVTTMTSVFAGSLSGQAVAMIGGGG----------------- 378

Query: 407 EGEGAFIMERDMSNGNIKWDHVHLPVGFSGFPCSASFLLI 446
           E  G  +++        KW HV+ P GFS  P S S + +
Sbjct: 379 EESGTMMVKTTAEKNGGKWSHVNTPSGFSSLPFSCSSIYV 418
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|O80582|FBK46_ARATH F-box/kelch-repeat protein At2g44130 OS=Arabidopsis thaliana GN=At2g44130 PE=2 SV=2 Back     alignment and function description
>sp|Q9M8L2|FBK30_ARATH F-box/kelch-repeat protein At1g80440 OS=Arabidopsis thaliana GN=At1g80440 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMR5|FK126_ARATH F-box/kelch-repeat protein At1g15670 OS=Arabidopsis thaliana GN=At1g15670 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|P57790|KEAP1_RAT Kelch-like ECH-associated protein 1 OS=Rattus norvegicus GN=Keap1 PE=2 SV=1 Back     alignment and function description
>sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 Back     alignment and function description
>sp|Q0V7S6|FK125_ARATH F-box/kelch-repeat protein OR23 OS=Arabidopsis thaliana GN=OR23 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6Z0|FBK17_ARATH F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
255576673446 conserved hypothetical protein [Ricinus 0.921 0.921 0.548 1e-124
224117810453 predicted protein [Populus trichocarpa] 0.961 0.947 0.536 1e-123
224095264454 predicted protein [Populus trichocarpa] 0.941 0.925 0.509 1e-119
225434265435 PREDICTED: F-box/kelch-repeat protein SK 0.881 0.903 0.489 1e-104
297817292416 kelch repeat-containing F-box family pro 0.901 0.966 0.428 6e-89
15232212418 F-box/kelch-repeat protein SKIP20 [Arabi 0.905 0.966 0.432 3e-86
21595493418 unknown [Arabidopsis thaliana] 0.905 0.966 0.426 8e-86
297824405405 hypothetical protein ARALYDRAFT_483537 [ 0.867 0.955 0.417 6e-84
296084385365 unnamed protein product [Vitis vinifera] 0.665 0.813 0.508 9e-82
21594431409 unknown [Arabidopsis thaliana] 0.636 0.694 0.509 6e-80
>gi|255576673|ref|XP_002529226.1| conserved hypothetical protein [Ricinus communis] gi|223531344|gb|EEF33182.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 244/445 (54%), Positives = 319/445 (71%), Gaps = 34/445 (7%)

Query: 16  LIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQP 75
           LIPGLPDEIAMECL++VPY+FH ++KSVC  W +LIS  SFY++R +SG +EHLVC VQP
Sbjct: 22  LIPGLPDEIAMECLVKVPYQFHCNMKSVCHTWQDLISDPSFYQQRRKSGTSEHLVCLVQP 81

Query: 76  LPLSPPNPKDSSSATTHLVSDSAAKITSTKKDQQQDDDDHELHQQRQEVHRTPLQYGLTI 135
           L   P    DS+   T  ++D    +T  +  Q+Q+    ++H        +P Q+ ++I
Sbjct: 82  L---PQQQHDSALDVTPDMADPTT-VTKKEDKQEQEQQQQQIH--------SPPQFAISI 129

Query: 136 FNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSS 195
           +N +   W+R RP  G IPMFCQC+A+P+S K+LL+GGWD  TLEPVPDV++LD+     
Sbjct: 130 YNLNFNIWQRTRPQ-GGIPMFCQCLAIPSSGKILLLGGWDSNTLEPVPDVHILDLT-GGC 187

Query: 196 RWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEE 255
           RWRR   MSV+RSFFACAVVG S V VAGGHDGQKNAL+SAEVYDV+ DEWRMLP+M EE
Sbjct: 188 RWRRGASMSVSRSFFACAVVGPSMVYVAGGHDGQKNALRSAEVYDVDRDEWRMLPDMIEE 247

Query: 256 RDECQGVCLEGD-RFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSLSPRGS 314
           RDECQG+  +GD +F+VVSGYGT+SQG+F+ DAECYDP TGSWSKFD VWPF S+SPRG+
Sbjct: 248 RDECQGLAWDGDSKFWVVSGYGTDSQGQFRSDAECYDPTTGSWSKFDGVWPFSSISPRGA 307

Query: 315 TATITSYRLQQHQWLWFLG-------------KEQQQNGEVVKGKIVSSIVPLPKSVTEG 361
           TAT++  R  Q+QW WFLG              E+ +  E ++ +IV+SI P+P  VT  
Sbjct: 308 TATVSVNR-DQNQWWWFLGGEQQQQQLQLQTSGEEVKENENMRLEIVTSI-PVPACVT-- 363

Query: 362 SSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNG 421
            S+PCV ++  +++ +  +VFVM+GN G G    ++ SS  C+EC+ EGAFI++RD +NG
Sbjct: 364 GSNPCV-ISLGYDANKHHQVFVMSGN-GNGNGRRTSSSSLSCSECDCEGAFILDRDCNNG 421

Query: 422 NIKWDHVHLPVGFSGFPCSASFLLI 446
           + KW+HVH PVGFSGFP SAS L I
Sbjct: 422 STKWNHVHTPVGFSGFPFSASHLTI 446

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224117810|ref|XP_002331637.1| predicted protein [Populus trichocarpa] gi|118487232|gb|ABK95444.1| unknown [Populus trichocarpa] gi|222874033|gb|EEF11164.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224095264|ref|XP_002310368.1| predicted protein [Populus trichocarpa] gi|222853271|gb|EEE90818.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434265|ref|XP_002280719.1| PREDICTED: F-box/kelch-repeat protein SKIP20-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297817292|ref|XP_002876529.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297322367|gb|EFH52788.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15232212|ref|NP_191553.1| F-box/kelch-repeat protein SKIP20 [Arabidopsis thaliana] gi|75182340|sp|Q9M1Y1.1|SKI20_ARATH RecName: Full=F-box/kelch-repeat protein SKIP20; AltName: Full=SKP1-interacting partner 20 gi|7019688|emb|CAB75813.1| putative protein [Arabidopsis thaliana] gi|18389270|gb|AAL67078.1| unknown protein [Arabidopsis thaliana] gi|19698957|gb|AAL91214.1| putative protein [Arabidopsis thaliana] gi|20258927|gb|AAM14179.1| unknown protein [Arabidopsis thaliana] gi|332646466|gb|AEE79987.1| F-box/kelch-repeat protein SKIP20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21595493|gb|AAM66106.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297824405|ref|XP_002880085.1| hypothetical protein ARALYDRAFT_483537 [Arabidopsis lyrata subsp. lyrata] gi|297325924|gb|EFH56344.1| hypothetical protein ARALYDRAFT_483537 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296084385|emb|CBI24773.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|21594431|gb|AAM66007.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
TAIR|locus:2080432418 AT3G59940 "AT3G59940" [Arabido 0.753 0.803 0.491 3.9e-87
TAIR|locus:2051879409 AT2G44130 "AT2G44130" [Arabido 0.419 0.457 0.583 7.4e-84
TAIR|locus:2198958354 AT1G80440 "AT1G80440" [Arabido 0.369 0.466 0.428 8.4e-41
TAIR|locus:2036119359 AT1G15670 "AT1G15670" [Arabido 0.372 0.462 0.409 2.5e-39
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.286 0.294 0.309 1.9e-17
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.313 0.365 0.339 1.3e-16
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.282 0.335 0.360 1.4e-15
TAIR|locus:2202765421 AT1G26930 "AT1G26930" [Arabido 0.313 0.332 0.313 1.3e-14
TAIR|locus:2198304398 AT1G30090 "AT1G30090" [Arabido 0.109 0.123 0.48 3e-13
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.235 0.267 0.330 9.7e-13
TAIR|locus:2080432 AT3G59940 "AT3G59940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 821 (294.1 bits), Expect = 3.9e-87, Sum P(2) = 3.9e-87
 Identities = 181/368 (49%), Positives = 233/368 (63%)

Query:    15 NLIPGLPDEIAMECLIRVPYKFHNDLKSVCQRWLNLISSHSFYRERIRSGKAEHLVCQVQ 74
             +LIPGLP+E+A+ECL+RVP++FH+ +KSVC+ W  +ISS SF +ERI  GKAE L+C VQ
Sbjct:    14 DLIPGLPEELAIECLVRVPFQFHSSIKSVCRSWKCVISSRSFIKERIGFGKAESLLCLVQ 73

Query:    75 PLPLSPPNPKDSSSATTHLVSDSAAKITSTKKXXXXXXXXXXXXXXXXXVHRTPLQYGLT 134
             PL  SPP+P                +++  KK                 +  TPL YGL+
Sbjct:    74 PLT-SPPSP----------AMMEGGEMSQKKKEEEEGESQMTQQLLQPRITGTPL-YGLS 121

Query:   135 IFNASNGTWERIR-PHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMV-- 191
             ++NA+  TW R+  P   RIP+FC+CVA+  + K+LLIGGWDP TL+PV DV+VLD    
Sbjct:   122 VYNATLDTWHRVAIPE--RIPLFCECVAIQDAGKVLLIGGWDPETLQPVRDVFVLDFFAG 179

Query:   192 -NNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLP 250
               +  R+RR +PMS ARSFFACA VG++ V VAGGHD QKNAL+SAEVYDVE DEW MLP
Sbjct:   180 EGSGRRFRRGRPMSAARSFFACASVGSTKVYVAGGHDDQKNALRSAEVYDVEKDEWSMLP 239

Query:   251 EMDEERDECQGVCLEGDR-FFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSL 309
              M E RDEC G  +  D  F V+SGYGTE+QG+F+ D E YDP T SWS  ++VWPFP L
Sbjct:   240 PMTEGRDECHGFSMATDPGFCVLSGYGTETQGQFRSDGEIYDPITNSWSTIENVWPFPDL 299

Query:   310 SPRGSTATITSYRLQQHQW--LW-FLGKEQQQ--NGEV----VKGKIVSSIVPLP----K 356
             SPRG TA   +      +   LW F+  E+Q   + EV    +K K++   + LP     
Sbjct:   300 SPRGRTAAAAAEFPGDFRGCRLWCFIDSERQSQPHWEVEDDSMKWKVIMDTIRLPVTTMT 359

Query:   357 SVTEGSSS 364
             SV  GS S
Sbjct:   360 SVFAGSLS 367
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2051879 AT2G44130 "AT2G44130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198958 AT1G80440 "AT1G80440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036119 AT1G15670 "AT1G15670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202765 AT1G26930 "AT1G26930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198304 AT1G30090 "AT1G30090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M1Y1SKI20_ARATHNo assigned EC number0.43260.90580.9665yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034781001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence; (429 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
smart0061247 smart00612, Kelch, Kelch domain 5e-07
pfam0134446 pfam01344, Kelch_1, Kelch motif 9e-07
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 8e-06
pfam0064648 pfam00646, F-box, F-box domain 3e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-05
smart0061247 smart00612, Kelch, Kelch domain 6e-05
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 8e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.001
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 0.004
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information 
 Score = 45.6 bits (109), Expect = 5e-07
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 222 VAGGHDGQKNALKSAEVYDVEADEWRMLPEM 252
           V GG DG    LKS EVYD E ++W  LP M
Sbjct: 4   VVGGFDGG-QRLKSVEVYDPETNKWTPLPSM 33

Length = 47
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 446
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.98
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
PHA02790480 Kelch-like protein; Provisional 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
PHA03098534 kelch-like protein; Provisional 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.96
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.94
KOG1230 521 consensus Protein containing repeated kelch motifs 99.94
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.91
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.91
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.89
KOG1230521 consensus Protein containing repeated kelch motifs 99.88
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.58
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.53
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.3
PF1396450 Kelch_6: Kelch motif 99.28
PF1396450 Kelch_6: Kelch motif 99.15
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.09
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.99
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.95
PF1341549 Kelch_3: Galactose oxidase, central domain 98.91
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.9
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.83
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.81
PF1341549 Kelch_3: Galactose oxidase, central domain 98.79
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.76
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.73
smart0061247 Kelch Kelch domain. 98.7
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.66
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.58
smart0061247 Kelch Kelch domain. 98.57
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.56
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.56
PLN02772398 guanylate kinase 98.37
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.36
PLN02772 398 guanylate kinase 98.32
PF1385442 Kelch_5: Kelch motif 98.29
PF1385442 Kelch_5: Kelch motif 98.15
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.86
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.48
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.04
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.01
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.98
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 96.84
KOG2997366 consensus F-box protein FBX9 [General function pre 96.35
PF12768281 Rax2: Cortical protein marker for cell polarity 96.25
PF12768281 Rax2: Cortical protein marker for cell polarity 95.81
PRK13684334 Ycf48-like protein; Provisional 95.52
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.25
PLN00033398 photosystem II stability/assembly factor; Provisio 95.05
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.49
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.47
PRK13684334 Ycf48-like protein; Provisional 94.36
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.1
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.98
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.64
PRK04792448 tolB translocation protein TolB; Provisional 92.36
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.26
KOG0310 487 consensus Conserved WD40 repeat-containing protein 91.73
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.49
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 91.42
PRK00178430 tolB translocation protein TolB; Provisional 91.22
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 90.86
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 90.81
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.81
PRK04922433 tolB translocation protein TolB; Provisional 90.23
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 90.08
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 90.01
KOG2055514 consensus WD40 repeat protein [General function pr 89.72
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.4
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.98
PRK03629429 tolB translocation protein TolB; Provisional 88.83
KOG2055514 consensus WD40 repeat protein [General function pr 88.26
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 88.16
KOG0310487 consensus Conserved WD40 repeat-containing protein 87.42
PRK11028330 6-phosphogluconolactonase; Provisional 87.37
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 86.51
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 85.73
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 84.98
PRK05137435 tolB translocation protein TolB; Provisional 84.84
smart00284255 OLF Olfactomedin-like domains. 83.91
PRK04792448 tolB translocation protein TolB; Provisional 83.61
PRK04043419 tolB translocation protein TolB; Provisional 82.58
PF12217367 End_beta_propel: Catalytic beta propeller domain o 81.16
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 80.69
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 80.61
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 80.2
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-41  Score=344.34  Aligned_cols=255  Identities=25%  Similarity=0.450  Sum_probs=219.8

Q ss_pred             ceeEEEEECCCCcEEecCCCCCCCCccceEEEEeeCCEEEEEeCcCCCCCCccCeEEEEeCcCCCCcEEEccCCccCccc
Q 013264          130 QYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSF  209 (446)
Q Consensus       130 ~~~~~~ydp~~~~W~~l~~~~~~~p~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~v~~~d~~~~t~~W~~~~~~p~~r~~  209 (446)
                      ...+.+|||.++.|..+++|+  .+|..+++++ ++|+||++||.+. ....++++++|||  .+++|..+|+|+.+|..
T Consensus       300 ~~~ve~yd~~~~~w~~~a~m~--~~r~~~~~~~-~~~~lYv~GG~~~-~~~~l~~ve~YD~--~~~~W~~~a~M~~~R~~  373 (571)
T KOG4441|consen  300 LRSVECYDPKTNEWSSLAPMP--SPRCRVGVAV-LNGKLYVVGGYDS-GSDRLSSVERYDP--RTNQWTPVAPMNTKRSD  373 (571)
T ss_pred             cceeEEecCCcCcEeecCCCC--cccccccEEE-ECCEEEEEccccC-CCcccceEEEecC--CCCceeccCCccCcccc
Confidence            456899999999999999999  5777666665 8999999999984 2236899999999  89999999999999999


Q ss_pred             eEEEEECCcEEEEEeccCCCCCCCCeEEEEECCCCcEEecCCCCccCCcceEEEEECCEEEEEeCCCCCCCCcccCcEEE
Q 013264          210 FACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAEC  289 (446)
Q Consensus       210 ~~~~~~~d~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~~lyv~GG~~~~~~~~~~~~v~~  289 (446)
                      +++++++ |+||++||.++.. .++++|+|||.+++|+.+++|+.+|++ +++++.+++||++||.++..  ..++++++
T Consensus       374 ~~v~~l~-g~iYavGG~dg~~-~l~svE~YDp~~~~W~~va~m~~~r~~-~gv~~~~g~iYi~GG~~~~~--~~l~sve~  448 (571)
T KOG4441|consen  374 FGVAVLD-GKLYAVGGFDGEK-SLNSVECYDPVTNKWTPVAPMLTRRSG-HGVAVLGGKLYIIGGGDGSS--NCLNSVEC  448 (571)
T ss_pred             ceeEEEC-CEEEEEecccccc-ccccEEEecCCCCcccccCCCCcceee-eEEEEECCEEEEEcCcCCCc--cccceEEE
Confidence            9999999 8999999999664 789999999999999999999998887 89999999999999987653  27899999


Q ss_pred             EeCCCCceEEcccCCCCCCCCCCCceEEEEecCCCcccEEEEEcCCCCC---------CceeEeceEEeeccCCCCcCCC
Q 013264          290 YDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQ---------NGEVVKGKIVSSIVPLPKSVTE  360 (446)
Q Consensus       290 yd~~~~~W~~~~~~~p~~~~~~r~~~~~~~~~~~~~~~~lyv~GG~~~~---------~~~~~~W~~~~~~~~~p~~~~~  360 (446)
                      |||.+++|+.++     +|+.+|.+++++++++     +||++||+++.         ++++++|+.+..+       ..
T Consensus       449 YDP~t~~W~~~~-----~M~~~R~~~g~a~~~~-----~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m-------~~  511 (571)
T KOG4441|consen  449 YDPETNTWTLIA-----PMNTRRSGFGVAVLNG-----KIYVVGGFDGTSALSSVERYDPETNQWTMVAPM-------TS  511 (571)
T ss_pred             EcCCCCceeecC-----CcccccccceEEEECC-----EEEEECCccCCCccceEEEEcCCCCceeEcccC-------cc
Confidence            999999999999     8999999999999998     99999999874         6678889988644       56


Q ss_pred             CCCCCeEEEeeccccCCCceEEEEeccCCCCCCCCCccccccccccCCcceEEEEEeccCCCcCeeeecCCCCccccc
Q 013264          361 GSSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHVHLPVGFSGFP  438 (446)
Q Consensus       361 ~R~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~d~~~~~W~~~~~p~~~~~~~  438 (446)
                      +|.++++++++       ++||++||..+..     +++             .++.| ||++++|+....|...++.+
T Consensus       512 ~rs~~g~~~~~-------~~ly~vGG~~~~~-----~l~-------------~ve~y-dp~~d~W~~~~~~~~~~~~~  563 (571)
T KOG4441|consen  512 PRSAVGVVVLG-------GKLYAVGGFDGNN-----NLN-------------TVECY-DPETDTWTEVTEPESGRGGA  563 (571)
T ss_pred             ccccccEEEEC-------CEEEEEecccCcc-----ccc-------------eeEEc-CCCCCceeeCCCccccccCc
Confidence            78888999998       9999999976553     333             35669 99999999765554444433

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-11
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-11
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 3e-11
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 3e-11
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-09
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-08
2eid_A 639 Galactose Oxidase W290g Mutant Length = 639 4e-07
2eib_A 639 Crystal Structure Of Galactose Oxidase, W290h Mutan 7e-07
2eic_A 639 Crystal Structure Of Galactose Oxidase Mutant W290f 2e-06
1k3i_A 656 Crystal Structure Of The Precursor Of Galactose Oxi 2e-06
1t2x_A 639 Glactose Oxidase C383s Mutant Identified By Directe 2e-06
2eie_A 639 Crystal Structure Of Galactose Oxidase Complexed Wi 2e-06
2wq8_A 661 Glycan Labelling Using Engineered Variants Of Galac 2e-06
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 9e-06
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-05
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 9e-04
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure 
Iteration: 1

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 69/149 (46%), Gaps = 13/149 (8%)
Query: 154 PMFCQCVAVPAS---RKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFF 210
           PM  + + V  +   R L  +GG+D        + Y  +     + WR +  M+  RS  
Sbjct: 155 PMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPE----RNEWRMITAMNTIRSGA 210
Query: 211 ACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFF 270
              V+  + +  AGG+DGQ + L S E YDVE + W  +  M   R    G+ +   R +
Sbjct: 211 GVCVL-HNCIYAAGGYDGQ-DQLNSVERYDVETETWTFVAPMKHRR-SALGITVHQGRIY 267
Query: 271 VVSGYGTESQGRFKPDAECYDPKTGSWSK 299
           V+ GY   +   F    ECYDP T +WS+
Sbjct: 268 VLGGYDGHT---FLDSVECYDPDTDTWSE 293
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2EID|A Chain A, Galactose Oxidase W290g Mutant Length = 639 Back     alignment and structure
>pdb|2EIB|A Chain A, Crystal Structure Of Galactose Oxidase, W290h Mutant Length = 639 Back     alignment and structure
>pdb|2EIC|A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f Length = 639 Back     alignment and structure
>pdb|1K3I|A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase Length = 656 Back     alignment and structure
>pdb|1T2X|A Chain A, Glactose Oxidase C383s Mutant Identified By Directed Evolution Length = 639 Back     alignment and structure
>pdb|2EIE|A Chain A, Crystal Structure Of Galactose Oxidase Complexed With Azide Length = 639 Back     alignment and structure
>pdb|2WQ8|A Chain A, Glycan Labelling Using Engineered Variants Of Galactose Oxidase Obtained By Directed Evolution Length = 661 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 6e-29
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-27
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 9e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-15
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-14
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-17
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-14
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-26
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 9e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-23
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-05
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-25
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-24
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 8e-16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-24
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 9e-13
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-08
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-10
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-04
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 7e-16
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-13
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-12
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-10
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
 Score =  114 bits (287), Expect = 6e-29
 Identities = 38/166 (22%), Positives = 58/166 (34%), Gaps = 13/166 (7%)

Query: 135 IFNASNGTWERIRP-HVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNN 193
            FN  + +W  IR     R               + ++GG     L P+  +   ++V +
Sbjct: 28  YFNPKDYSWTDIRCPFEKR---RDAACVF-WDNVVYILGGSQ---LFPIKRMDCYNVVKD 80

Query: 194 SSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMD 253
           S  W         R   A        +  +GG +   +AL   E YD   + W   P M 
Sbjct: 81  S--WYSKLGPPTPRDSLAACAAE-GKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSML 137

Query: 254 EERDECQGVCLEGDRFFVVSGY-GTESQGRFKPDAECYDPKTGSWS 298
            +R    G+       +V  G  G    GR     E YDP T +W+
Sbjct: 138 TQRC-SHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWT 182
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.98
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.96
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.95
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.79
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.73
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.61
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.59
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.57
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.4
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.24
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.14
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.07
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.91
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.88
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.55
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.34
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.24
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.19
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.97
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.83
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.79
3jrp_A379 Fusion protein of protein transport protein SEC13 95.41
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.41
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.29
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.18
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.0
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.99
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.96
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 94.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.87
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 94.85
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.8
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 94.66
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.64
3jrp_A379 Fusion protein of protein transport protein SEC13 94.57
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.3
3jro_A 753 Fusion protein of protein transport protein SEC13 94.26
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.24
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.07
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.8
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.79
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.75
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 93.7
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 93.22
3v9f_A781 Two-component system sensor histidine kinase/RESP 93.18
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 93.09
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.08
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.91
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 92.74
4a2l_A 795 BT_4663, two-component system sensor histidine kin 92.69
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.69
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.68
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.58
3jro_A 753 Fusion protein of protein transport protein SEC13 92.56
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 92.45
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.2
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 92.11
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 91.8
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.6
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 91.59
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.53
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.34
4a2l_A 795 BT_4663, two-component system sensor histidine kin 91.16
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 90.87
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.78
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 90.73
4e54_B435 DNA damage-binding protein 2; beta barrel, double 90.71
3ow8_A321 WD repeat-containing protein 61; structural genomi 90.7
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 90.57
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 90.51
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 90.27
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 90.11
3ow8_A321 WD repeat-containing protein 61; structural genomi 90.0
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 89.86
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 89.71
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 89.62
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.43
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 89.31
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 89.31
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 89.1
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 89.09
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 88.85
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 88.8
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 88.74
2pm7_B297 Protein transport protein SEC13, protein transport 88.73
3ott_A758 Two-component system sensor histidine kinase; beta 88.52
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 88.45
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.43
4g56_B357 MGC81050 protein; protein arginine methyltransfera 88.21
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 88.19
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 88.03
4g56_B357 MGC81050 protein; protein arginine methyltransfera 87.91
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 87.86
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 87.38
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 87.27
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 87.19
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 87.11
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 87.11
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 87.04
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 86.97
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 86.81
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 86.78
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 86.62
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.47
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 86.4
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 86.06
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 85.82
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 85.03
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 84.9
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 84.86
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 84.65
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 84.48
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 84.42
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 83.98
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 83.49
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 83.45
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 83.43
2p4o_A306 Hypothetical protein; putative lactonase, structur 83.42
2p4o_A306 Hypothetical protein; putative lactonase, structur 83.26
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 83.14
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 82.89
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 82.22
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 81.7
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 81.32
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 81.16
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 81.15
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 80.88
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 80.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 80.66
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 80.62
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 80.49
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 80.35
2pm7_B297 Protein transport protein SEC13, protein transport 80.32
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.1e-39  Score=310.15  Aligned_cols=254  Identities=19%  Similarity=0.295  Sum_probs=211.9

Q ss_pred             eEEEEECCCCcEEecCCCCCCCCccceEEEEeeCCEEEEEeCcCCCCCCccCeEEEEeCcCCCCcEEEccCCccCccceE
Q 013264          132 GLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPDVYVLDMVNNSSRWRRVKPMSVARSFFA  211 (446)
Q Consensus       132 ~~~~ydp~~~~W~~l~~~~~~~p~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~v~~~d~~~~t~~W~~~~~~p~~r~~~~  211 (446)
                      .+++||+.+++|..++++|  .+|..|++++ .+++|||+||..   ....+++++||+  .+++|+++++||.+|..|+
T Consensus        25 ~~~~~d~~~~~W~~~~~~p--~~r~~~~~~~-~~~~lyv~GG~~---~~~~~~~~~~d~--~~~~W~~~~~~p~~r~~~~   96 (306)
T 3ii7_A           25 SCRYFNPKDYSWTDIRCPF--EKRRDAACVF-WDNVVYILGGSQ---LFPIKRMDCYNV--VKDSWYSKLGPPTPRDSLA   96 (306)
T ss_dssp             SEEEEETTTTEEEECCCCS--CCCBSCEEEE-ETTEEEEECCBS---SSBCCEEEEEET--TTTEEEEEECCSSCCBSCE
T ss_pred             eEEEecCCCCCEecCCCCC--cccceeEEEE-ECCEEEEEeCCC---CCCcceEEEEeC--CCCeEEECCCCCcccccee
Confidence            4889999999999999999  6888888776 799999999987   336889999999  8999999999999999999


Q ss_pred             EEEECCcEEEEEeccCCCCCCCCeEEEEECCCCcEEecCCCCccCCcceEEEEECCEEEEEeCCCCCCC-CcccCcEEEE
Q 013264          212 CAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQ-GRFKPDAECY  290 (446)
Q Consensus       212 ~~~~~d~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~~lyv~GG~~~~~~-~~~~~~v~~y  290 (446)
                      +++++ ++|||+||.+.....++++++||+.+++|+.++++|.+|.. +++++.+++||++||...... +...+++++|
T Consensus        97 ~~~~~-~~iyv~GG~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~-~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~y  174 (306)
T 3ii7_A           97 ACAAE-GKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCS-HGMVEANGLIYVCGGSLGNNVSGRVLNSCEVY  174 (306)
T ss_dssp             EEEET-TEEEEECCBBTTBSCCCCEEEEETTTTEEEEECCCSSCCBS-CEEEEETTEEEEECCEESCTTTCEECCCEEEE
T ss_pred             EEEEC-CEEEEECCCCCCCcEeeeEEEEeCCCCceEeCCCCcCCcce-eEEEEECCEEEEECCCCCCCCcccccceEEEe
Confidence            99998 89999999874445689999999999999999999999987 788889999999999865431 1237899999


Q ss_pred             eCCCCceEEcccCCCCCCCCCCCceEEEEecCCCcccEEEEEcCCCCC---------CceeEeceEEeeccCCCCcCCCC
Q 013264          291 DPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQ---------NGEVVKGKIVSSIVPLPKSVTEG  361 (446)
Q Consensus       291 d~~~~~W~~~~~~~p~~~~~~r~~~~~~~~~~~~~~~~lyv~GG~~~~---------~~~~~~W~~~~~~~~~p~~~~~~  361 (446)
                      |+++++|+.++     ++|.+|..|+++++++     +|||+||.+..         ++++++|+.+.   ++|    .+
T Consensus       175 d~~~~~W~~~~-----~~p~~r~~~~~~~~~~-----~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~~---~~p----~~  237 (306)
T 3ii7_A          175 DPATETWTELC-----PMIEARKNHGLVFVKD-----KIFAVGGQNGLGGLDNVEYYDIKLNEWKMVS---PMP----WK  237 (306)
T ss_dssp             ETTTTEEEEEC-----CCSSCCBSCEEEEETT-----EEEEECCEETTEEBCCEEEEETTTTEEEECC---CCS----CC
T ss_pred             CCCCCeEEECC-----CccchhhcceEEEECC-----EEEEEeCCCCCCCCceEEEeeCCCCcEEECC---CCC----CC
Confidence            99999999998     6889999999999987     99999998654         34556677664   443    46


Q ss_pred             CCCCeEEEeeccccCCCceEEEEeccCCCCCCCCCccccccccccCCcceEEEEEeccCCCcCeeee-cCCCCccccc
Q 013264          362 SSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHV-HLPVGFSGFP  438 (446)
Q Consensus       362 R~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~d~~~~~W~~~-~~p~~~~~~~  438 (446)
                      |..+++++++       ++|||+||.+..+               .   ...+++| |+++++|+.+ ++|..+.++.
T Consensus       238 r~~~~~~~~~-------~~i~v~GG~~~~~---------------~---~~~~~~y-d~~~~~W~~~~~~~~~r~~~~  289 (306)
T 3ii7_A          238 GVTVKCAAVG-------SIVYVLAGFQGVG---------------R---LGHILEY-NTETDKWVANSKVRAFPVTSC  289 (306)
T ss_dssp             BSCCEEEEET-------TEEEEEECBCSSS---------------B---CCEEEEE-ETTTTEEEEEEEEECCSCTTC
T ss_pred             ccceeEEEEC-------CEEEEEeCcCCCe---------------e---eeeEEEE-cCCCCeEEeCCCcccccceeE
Confidence            7788888888       9999999986553               0   1134558 9999999954 4555555444
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 446
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-12
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-10
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-04
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-06
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 2e-05
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 66.0 bits (159), Expect = 2e-12
 Identities = 40/309 (12%), Positives = 77/309 (24%), Gaps = 19/309 (6%)

Query: 134 TIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPITLEPVPD----VYVLD 189
           T      G W      +  +P        P S ++L+   +        P         D
Sbjct: 2   TAPQPGLGRWGPTID-LPIVPAAAAIE--PTSGRVLMWSSYRNDAFGGSPGGITLTSSWD 58

Query: 190 MVNNSSRWRRVKPMSVARSFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRML 249
                               F   +       +        N  K   +YD  +D W   
Sbjct: 59  PSTG--IVSDRTVTVTKHDMFCPGISMDGNGQIVVTGG---NDAKKTSLYDSSSDSWIPG 113

Query: 250 PEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDAECYDPKTGSWSKFDHVWPFPSL 309
           P+M   R       +   R F +   G+ S G F+ + E Y P + +W+   +    P L
Sbjct: 114 PDMQVARGYQSSATMSDGRVFTI--GGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPML 171

Query: 310 SPRGSTA-----TITSYRLQQHQWLWFLGKEQQQNGEVVKGKIVSSIVPLPKSVTEGSSS 364
           +               +  ++                      V S      +      +
Sbjct: 172 TADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYYTSGSGDVKSAGKRQSNRGVAPDA 231

Query: 365 PCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIK 424
            C +       + +   F  + +     ++++A    +               +      
Sbjct: 232 MCGNAVMYDAVKGKILTFGGSPDYQDSDATTNAHIITLGEPGTSPNTVFASNGLYFARTF 291

Query: 425 WDHVHLPVG 433
              V LP G
Sbjct: 292 HTSVVLPDG 300
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.94
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.9
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.37
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.26
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.96
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.51
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.41
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.78
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.27
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.12
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.09
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.59
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.19
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.56
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.42
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 88.84
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 88.43
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.27
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 87.72
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 85.4
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.94
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 84.35
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 83.13
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 82.61
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 81.81
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 81.36
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 80.15
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1e-34  Score=272.11  Aligned_cols=258  Identities=22%  Similarity=0.367  Sum_probs=209.6

Q ss_pred             ceeEEEEECCCCcEEecCCCCCCCCccceEEEEeeCCEEEEEeCcCCC--CCCccCeEEEEeCcCCCCcEEEccCCccCc
Q 013264          130 QYGLTIFNASNGTWERIRPHVGRIPMFCQCVAVPASRKLLLIGGWDPI--TLEPVPDVYVLDMVNNSSRWRRVKPMSVAR  207 (446)
Q Consensus       130 ~~~~~~ydp~~~~W~~l~~~~~~~p~~~~~~~~~~~~~lyv~GG~~~~--~~~~~~~v~~~d~~~~t~~W~~~~~~p~~r  207 (446)
                      ...+++||+.+++|..++++|  .||..|++++ ++++|||+||....  .....+++++||+  .+++|+++++||.+|
T Consensus        18 ~~~~~~yd~~t~~W~~~~~~p--~~R~~~~~~~-~~~~iyv~GG~~~~~~~~~~~~~~~~yd~--~~~~w~~~~~~p~~r   92 (288)
T d1zgka1          18 LSYLEAYNPSNGTWLRLADLQ--VPRSGLAGCV-VGGLLYAVGGRNNSPDGNTDSSALDCYNP--MTNQWSPCAPMSVPR   92 (288)
T ss_dssp             CCCEEEEETTTTEEEECCCCS--SCCBSCEEEE-ETTEEEEECCEEEETTEEEECCCEEEEET--TTTEEEECCCCSSCC
T ss_pred             CceEEEEECCCCeEEECCCCC--CccceeEEEE-ECCEEEEEeCcccCCCCccccchhhhccc--cccccccccccccee
Confidence            346889999999999999999  6898888776 79999999997421  2235789999999  899999999999999


Q ss_pred             cceEEEEECCcEEEEEeccCCCCCCCCeEEEEECCCCcEEecCCCCccCCcceEEEEECCEEEEEeCCCCCCCCcccCcE
Q 013264          208 SFFACAVVGASTVCVAGGHDGQKNALKSAEVYDVEADEWRMLPEMDEERDECQGVCLEGDRFFVVSGYGTESQGRFKPDA  287 (446)
Q Consensus       208 ~~~~~~~~~d~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~~lyv~GG~~~~~~~~~~~~v  287 (446)
                      ..|++++++ ++||++||..... .++.+++||+.+++|...+.++..|.. +++++.++++|++||.....   ....+
T Consensus        93 ~~~~~~~~~-~~i~~~gg~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~r~~-~~~~~~~~~~~~~GG~~~~~---~~~~~  166 (288)
T d1zgka1          93 NRIGVGVID-GHIYAVGGSHGCI-HHNSVERYEPERDEWHLVAPMLTRRIG-VGVAVLNRLLYAVGGFDGTN---RLNSA  166 (288)
T ss_dssp             BTCEEEEET-TEEEEECCEETTE-ECCCEEEEETTTTEEEECCCCSSCCBS-CEEEEETTEEEEECCBCSSC---BCCCE
T ss_pred             cceeccccc-eeeEEecceeccc-ccceeeeeccccCcccccccccccccc-ceeeeeeecceEecCccccc---ccceE
Confidence            999999998 8999999987554 578899999999999999999999987 78888999999999986543   56789


Q ss_pred             EEEeCCCCceEEcccCCCCCCCCCCCceEEEEecCCCcccEEEEEcCCCCCCc----eeEe--ceEEeeccCCCCcCCCC
Q 013264          288 ECYDPKTGSWSKFDHVWPFPSLSPRGSTATITSYRLQQHQWLWFLGKEQQQNG----EVVK--GKIVSSIVPLPKSVTEG  361 (446)
Q Consensus       288 ~~yd~~~~~W~~~~~~~p~~~~~~r~~~~~~~~~~~~~~~~lyv~GG~~~~~~----~~~~--W~~~~~~~~~p~~~~~~  361 (446)
                      +.||+.+++|....     ..+.++..++++..++     +||++||.+....    ....  +.+|...+++    +.+
T Consensus       167 ~~~d~~~~~~~~~~-----~~~~~~~~~~~~~~~~-----~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~----p~~  232 (288)
T d1zgka1         167 ECYYPERNEWRMIT-----AMNTIRSGAGVCVLHN-----CIYAAGGYDGQDQLNSVERYDVETETWTFVAPM----KHR  232 (288)
T ss_dssp             EEEETTTTEEEECC-----CCSSCCBSCEEEEETT-----EEEEECCBCSSSBCCCEEEEETTTTEEEECCCC----SSC
T ss_pred             EEeecccccccccc-----ccccccccccccceee-----eEEEecCccccccccceeeeeecceeeecccCc----cCc
Confidence            99999999999988     5667888899888888     9999999876622    1111  1333333343    457


Q ss_pred             CCCCeEEEeeccccCCCceEEEEeccCCCCCCCCCccccccccccCCcceEEEEEeccCCCcCeeee-cCCCCccccc
Q 013264          362 SSSPCVSVTTLHNSQQQQKVFVMTGNGGRGCSSSSALSSFICNECEGEGAFIMERDMSNGNIKWDHV-HLPVGFSGFP  438 (446)
Q Consensus       362 R~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~d~~~~~W~~~-~~p~~~~~~~  438 (446)
                      |.++++++++       ++|||+||.+...     .             .-.+++| |+++++|+.+ ++|..++++.
T Consensus       233 r~~~~~~~~~-------~~l~v~GG~~~~~-----~-------------~~~v~~y-d~~~~~W~~~~~~p~~R~~~~  284 (288)
T d1zgka1         233 RSALGITVHQ-------GRIYVLGGYDGHT-----F-------------LDSVECY-DPDTDTWSEVTRMTSGRSGVG  284 (288)
T ss_dssp             CBSCEEEEET-------TEEEEECCBCSSC-----B-------------CCEEEEE-ETTTTEEEEEEECSSCCBSCE
T ss_pred             ccceEEEEEC-------CEEEEEecCCCCe-----e-------------cceEEEE-ECCCCEEEECCCCCCCcEeEE
Confidence            8889999988       9999999986543     1             1124568 9999999966 5788887764
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure