Citrus Sinensis ID: 013325
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 445 | 2.2.26 [Sep-21-2011] | |||||||
| O14048 | 427 | UBX domain-containing pro | yes | no | 0.898 | 0.936 | 0.277 | 7e-36 | |
| Q5REY7 | 489 | UBX domain-containing pro | yes | no | 0.514 | 0.468 | 0.338 | 2e-34 | |
| O94888 | 489 | UBX domain-containing pro | yes | no | 0.514 | 0.468 | 0.338 | 2e-34 | |
| Q6P5G6 | 467 | UBX domain-containing pro | yes | no | 0.465 | 0.443 | 0.322 | 5e-31 | |
| Q55BU7 | 503 | UBX domain-containing pro | yes | no | 0.680 | 0.602 | 0.263 | 9e-27 | |
| Q06682 | 500 | UBX domain-containing pro | yes | no | 0.921 | 0.82 | 0.226 | 3e-21 |
| >sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 152 bits (383), Expect = 7e-36, Method: Compositional matrix adjust.
Identities = 128/461 (27%), Positives = 211/461 (45%), Gaps = 61/461 (13%)
Query: 9 DKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA 68
D+ S+V++F I T E A ++L L AI LF+ ESG + S E +
Sbjct: 4 DEASLVANFCAI-TNSTPEKAQEYLSVADGDLSTAITLFF---ESGGVTDVQSSYIEAPS 59
Query: 69 NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDD-AMFYAGSG--------ARYPLHEPSS 119
P E E+RAP+ R+ L D A AG+ +P
Sbjct: 60 QTEPVE-----------EIRAPIAPTREVLVDPLADMSAGTSIMGNNFGFGGFPRMNRRQ 108
Query: 120 LIAFRNFDE---EMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA 176
FD+ ++ P + S + S LA L+RPP+ ++ N S ++A+ A
Sbjct: 109 RRRMGIFDQSPSQIPFPSSNTEDSSEESDSSSRASRLAKLFRPPYDIISNLSLDEARIEA 168
Query: 177 SVQDKWLLVNLQSTKEFSSHMVLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYY 236
S Q +W+LVNLQ++ F VLNRD W +E+V + I +F+F Q+ DD G + +Y
Sbjct: 169 SSQKRWILVNLQTSTSFECQ-VLNRDLWKDESVKEVIRAHFLFLQLLDDEEPGMEFKRFY 227
Query: 237 KLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSST 296
+ S P + ++DP TG++++ W P + L F++G ++ + K P G+ +
Sbjct: 228 PVRSTPHIAILDPRTGERVKEWSKSFTPADFVIALNDFLEGCTLDETS--GRKNPLGAKS 285
Query: 297 TPQQKNKDKPDIENEELLQALAASM---ETIKDASGVSSS---------DTDVASTDKDE 344
QK + E+E++ +A+AAS+ + ++ G SSS D V D E
Sbjct: 286 ---QKPVEAMS-EDEQMHKAIAASLGNGNSTTESQGESSSQQAESHGVADDTVHKIDSAE 341
Query: 345 ASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGS 404
A E P + R+ +R+P+G R R F TDP+ +++Y EG+
Sbjct: 342 CDAEEPSPGPN-----------VTRIQIRMPNGARFIRRFSLTDPVSKVYAYVKGVAEGA 390
Query: 405 EMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE 445
+ +PF LT SLD T +++G+ N + ++
Sbjct: 391 DKQPFSLTFQRKSLWTSLDS----TIKEAGIQNTALQFEFQ 427
|
Involved in CDC48-dependent protein degradation through the ubiquitin/proteasome pathway. Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812) |
| >sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q55BU7|UBXN7_DICDI UBX domain-containing protein 7 homolog OS=Dictyostelium discoideum GN=ubxd7 PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 445 | ||||||
| 224111366 | 444 | predicted protein [Populus trichocarpa] | 0.979 | 0.981 | 0.730 | 0.0 | |
| 255561727 | 452 | UBX domain-containing protein, putative | 0.991 | 0.975 | 0.719 | 0.0 | |
| 359473684 | 456 | PREDICTED: UBX domain-containing protein | 0.995 | 0.971 | 0.716 | 0.0 | |
| 359473686 | 447 | PREDICTED: UBX domain-containing protein | 0.995 | 0.991 | 0.726 | 0.0 | |
| 356526695 | 468 | PREDICTED: UBX domain-containing protein | 0.995 | 0.946 | 0.659 | 1e-176 | |
| 356559124 | 456 | PREDICTED: UBX domain-containing protein | 0.993 | 0.969 | 0.671 | 1e-175 | |
| 356559122 | 467 | PREDICTED: UBX domain-containing protein | 0.984 | 0.937 | 0.649 | 1e-175 | |
| 356526697 | 476 | PREDICTED: UBX domain-containing protein | 0.995 | 0.930 | 0.648 | 1e-173 | |
| 357517375 | 461 | UBX domain-containing protein [Medicago | 0.997 | 0.963 | 0.640 | 1e-169 | |
| 449445306 | 450 | PREDICTED: UBX domain-containing protein | 0.984 | 0.973 | 0.667 | 1e-167 |
| >gi|224111366|ref|XP_002315828.1| predicted protein [Populus trichocarpa] gi|222864868|gb|EEF01999.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 662 bits (1709), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 331/453 (73%), Positives = 373/453 (82%), Gaps = 17/453 (3%)
Query: 1 MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS 60
M+ +LS ND+QSMVSSFLEIAVGQTAETA QFLQATSWKL++AIQLFYVGNE GA+ASAS
Sbjct: 1 MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS 60
Query: 61 RSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSL 120
P E E V G G+EVRAPLPVVRDTLYDDAM Y S YP HE SSL
Sbjct: 61 HPPPTETWPEDLENEKV--GHSDGEEVRAPLPVVRDTLYDDAMLYGASRTGYPPHEASSL 118
Query: 121 IAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQD 180
IAFRNFDEEMK PGVWES+QG+ ST D+SRDNLASLYRPPFHLMF+GSFEKAK AASVQD
Sbjct: 119 IAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAKGAASVQD 178
Query: 181 KWLLVNLQSTKEFSSHMVLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDS 240
KWLLVNLQSTKEFSSHM LNRDTWANEAV+QTISTNFIFWQVYDDTSEG+KVCTYYKLDS
Sbjct: 179 KWLLVNLQSTKEFSSHM-LNRDTWANEAVAQTISTNFIFWQVYDDTSEGQKVCTYYKLDS 237
Query: 241 IPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQ 300
IPVVL++DPITGQKM SW GMVQPESLLEDLVPFMDGGPR+ H +SHKR RGSS TP +
Sbjct: 238 IPVVLIIDPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRQRGSSLTPPK 297
Query: 301 KNKDKPDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEAS--------ATEKPA 352
+ E+EE+L+ALAASME++KD+S ++S+ D+AS DKD+AS +T+
Sbjct: 298 SKE-----EDEEVLRALAASMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCSTKTLT 352
Query: 353 YPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLT 412
YP LPEEP D+SLLCRVG+RLPDGRR+QRNFL+TDPI+LLWS+CYSQLE + K F L
Sbjct: 353 YPPLPEEPSGDKSLLCRVGIRLPDGRRVQRNFLKTDPIRLLWSFCYSQLEEAGTKLFCLK 412
Query: 413 HAIPGATKSLDYDSKLTFEDSGLANAMISVTWE 445
AIPGA K LDYDS +TF +SGLAN+MISV WE
Sbjct: 413 EAIPGA-KRLDYDSTMTFGESGLANSMISVAWE 444
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255561727|ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis] gi|223538911|gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359473684|ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2-like isoform 2 [Vitis vinifera] gi|297738308|emb|CBI27509.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473686|ref|XP_002274120.2| PREDICTED: UBX domain-containing protein 2-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356526695|ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356559124|ref|XP_003547851.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356559122|ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356526697|ref|XP_003531953.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357517375|ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula] gi|358345084|ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula] gi|355502548|gb|AES83751.1| UBX domain-containing protein [Medicago truncatula] gi|355522998|gb|AET03452.1| UBX domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449445306|ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 445 | ||||||
| TAIR|locus:2204497 | 468 | AT1G14570 "AT1G14570" [Arabido | 0.808 | 0.769 | 0.634 | 4.1e-120 | |
| TAIR|locus:2202872 | 307 | AT1G59550 "AT1G59550" [Arabido | 0.395 | 0.573 | 0.338 | 2.9e-53 | |
| ZFIN|ZDB-GENE-040704-8 | 505 | ubxn7 "UBX domain protein 7" [ | 0.613 | 0.540 | 0.328 | 1.1e-40 | |
| UNIPROTKB|E1BTX4 | 492 | UBXN7 "Uncharacterized protein | 0.539 | 0.487 | 0.349 | 2.2e-38 | |
| UNIPROTKB|E2R9U7 | 489 | UBXN7 "Uncharacterized protein | 0.539 | 0.490 | 0.338 | 1.9e-37 | |
| UNIPROTKB|O94888 | 489 | UBXN7 "UBX domain-containing p | 0.539 | 0.490 | 0.338 | 1.9e-37 | |
| UNIPROTKB|I3LQY9 | 476 | UBXN7 "Uncharacterized protein | 0.539 | 0.504 | 0.338 | 1.9e-37 | |
| MGI|MGI:2146388 | 467 | Ubxn7 "UBX domain protein 7" [ | 0.391 | 0.372 | 0.363 | 3.5e-37 | |
| POMBASE|SPAC2C4.15c | 427 | ubx2 "UBX domain protein Ubx2" | 0.921 | 0.960 | 0.272 | 4.9e-37 | |
| UNIPROTKB|F1MUA8 | 474 | UBXN7 "Uncharacterized protein | 0.539 | 0.506 | 0.334 | 5.1e-37 |
| TAIR|locus:2204497 AT1G14570 "AT1G14570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1182 (421.1 bits), Expect = 4.1e-120, P = 4.1e-120
Identities = 240/378 (63%), Positives = 282/378 (74%)
Query: 85 DEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQG--- 141
DEVRAPLPVVR+TLY ++M+Y EP+SLIAFRNF EE K PG+WE ++G
Sbjct: 92 DEVRAPLPVVRETLYGESMYYGAMRVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSS 151
Query: 142 -----AASTADSS---RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEF 193
+AS ++S+ RD+LASLYRPPFHLMF GSFE+AK +S QDKWLLVNLQST EF
Sbjct: 152 ASASASASASESASAPRDSLASLYRPPFHLMFQGSFEQAKTTSSSQDKWLLVNLQSTTEF 211
Query: 194 SSHMVLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQ 253
SSHM LNRDTWAN+AVSQTI NFIFWQVYDDT+EG+KVCTYYKL+SIPVVLV+DP TGQ
Sbjct: 212 SSHM-LNRDTWANDAVSQTIKANFIFWQVYDDTTEGRKVCTYYKLESIPVVLVIDPTTGQ 270
Query: 254 KMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGS-STTPQQKNKDK--PDIEN 310
+MR W GMV PE+LLEDLVPFMDGGPRE A +S KRPRGS S TP K K+ D E
Sbjct: 271 RMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDVAKDEEE 330
Query: 311 EELLQALAASMETIKXXXXXXXXXXXXXXXXXXEA-SATEKPAYPILPEEPKV-DRSLLC 368
EEL +ALAAS+E EA ++ P +P LPEEPK DRSL C
Sbjct: 331 EELQRALAASLEDNNMKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLPEEPKGGDRSLQC 390
Query: 369 RVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMK-PFRLTHAIPGATKSLDYDSK 427
RVG+RLP+G+R+QRNFL+TD IQLLWS+CYSQLE SE K P +LT AIPG +K+L+Y+S
Sbjct: 391 RVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESKTLEYESN 450
Query: 428 LTFEDSGLANAMISVTWE 445
LT E SG+AN+MIS TWE
Sbjct: 451 LTLEQSGVANSMISATWE 468
|
|
| TAIR|locus:2202872 AT1G59550 "AT1G59550" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040704-8 ubxn7 "UBX domain protein 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTX4 UBXN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R9U7 UBXN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O94888 UBXN7 "UBX domain-containing protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LQY9 UBXN7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2146388 Ubxn7 "UBX domain protein 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC2C4.15c ubx2 "UBX domain protein Ubx2" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MUA8 UBXN7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | fgenesh4_pm.C_LG_X000378 | hypothetical protein (444 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 445 | |||
| cd02958 | 114 | cd02958, UAS, UAS family; UAS is a domain of unkno | 5e-51 | |
| smart00594 | 122 | smart00594, UAS, UAS domain | 2e-43 | |
| pfam00789 | 78 | pfam00789, UBX, UBX domain | 1e-15 | |
| pfam13899 | 81 | pfam13899, Thioredoxin_7, Thioredoxin-like | 3e-08 | |
| cd01767 | 77 | cd01767, UBX, UBX (ubiquitin regulatory X) domain | 2e-06 | |
| smart00166 | 77 | smart00166, UBX, Domain present in ubiquitin-regul | 6e-04 | |
| cd02991 | 116 | cd02991, UAS_ETEA, UAS family, ETEA subfamily; com | 0.003 |
| >gnl|CDD|239256 cd02958, UAS, UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
Score = 167 bits (426), Expect = 5e-51
Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 1/114 (0%)
Query: 164 MFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMVLNRDTWANEAVSQTISTNFIFWQVY 223
F GSFE AK A + KWLLV LQS EF S + LNRD W+NE+V + I NFIFWQ
Sbjct: 1 FFQGSFEDAKQEAKSEKKWLLVYLQSEDEFDSQV-LNRDLWSNESVKEFIRENFIFWQCD 59
Query: 224 DDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDG 277
D+SEG++ YK+D P + ++DP TG+ ++ W G + PE LL L+ F++
Sbjct: 60 IDSSEGQRFLQSYKVDKYPHIAIIDPRTGEVLKVWSGNITPEDLLSQLIEFLEE 113
|
Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), which is involved in the ubiquitin-proteosome pathway. Some members of this family are uncharacterized proteins containing only a UAS domain. Length = 114 |
| >gnl|CDD|214737 smart00594, UAS, UAS domain | Back alignment and domain information |
|---|
| >gnl|CDD|216120 pfam00789, UBX, UBX domain | Back alignment and domain information |
|---|
| >gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like | Back alignment and domain information |
|---|
| >gnl|CDD|176362 cd01767, UBX, UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >gnl|CDD|197552 smart00166, UBX, Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239289 cd02991, UAS_ETEA, UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 445 | |||
| KOG1364 | 356 | consensus Predicted ubiquitin regulatory protein, | 100.0 | |
| KOG1363 | 460 | consensus Predicted regulator of the ubiquitin pat | 99.97 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 99.94 | |
| smart00594 | 122 | UAS UAS domain. | 99.93 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 99.92 | |
| cd02990 | 136 | UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 | 99.91 | |
| KOG2507 | 506 | consensus Ubiquitin regulatory protein UBXD2, cont | 99.9 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 99.85 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 99.81 | |
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 99.81 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 99.81 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 99.8 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 99.74 | |
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 99.74 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 99.73 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 99.48 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 99.36 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 99.33 | |
| KOG2086 | 380 | consensus Protein tyrosine phosphatase SHP1/Cofact | 99.33 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 99.33 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 99.31 | |
| KOG2689 | 290 | consensus Predicted ubiquitin regulatory protein [ | 99.28 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.17 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 99.05 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 98.97 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 98.96 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 98.83 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 98.8 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 98.66 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 98.37 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 98.36 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 98.32 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 98.3 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 98.29 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 98.28 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 98.26 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 98.19 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 98.15 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 98.14 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 98.11 | |
| COG1331 | 667 | Highly conserved protein containing a thioredoxin | 98.1 | |
| PHA02278 | 103 | thioredoxin-like protein | 98.05 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 98.05 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 98.02 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 98.02 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 97.98 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 97.94 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 97.93 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 97.89 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 97.88 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 97.87 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 97.86 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 97.85 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 97.85 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 97.84 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 97.79 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 97.78 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 97.78 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 97.73 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 97.72 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 97.7 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 97.67 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 97.66 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 97.66 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 97.61 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 97.6 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 97.6 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 97.59 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 97.58 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 97.51 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 97.48 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 97.48 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 97.46 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 97.44 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 97.43 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 97.41 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 97.41 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 97.34 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 97.33 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 97.27 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 97.23 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 97.23 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 97.15 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 97.12 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 97.07 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 97.05 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 97.0 | |
| PF03943 | 51 | TAP_C: TAP C-terminal domain; InterPro: IPR005637 | 97.0 | |
| smart00804 | 63 | TAP_C C-terminal domain of vertebrate Tap protein. | 96.99 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 96.99 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 96.99 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 96.91 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 96.89 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 96.86 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 96.85 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 96.83 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 96.81 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 96.74 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 96.64 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 96.64 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 96.63 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 96.59 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 96.57 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 96.56 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.55 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 96.55 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 96.52 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 96.48 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 96.47 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 96.45 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 96.45 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 96.44 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 96.4 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 96.36 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 96.3 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 96.27 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 96.26 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 96.22 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 96.19 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 96.15 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 96.1 | |
| PHA02125 | 75 | thioredoxin-like protein | 96.05 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 95.98 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 95.93 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 95.87 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 95.86 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 95.81 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 95.78 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 95.75 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 95.74 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 95.58 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 95.54 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 95.54 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 95.5 | |
| KOG2244 | 786 | consensus Highly conserved protein containing a th | 95.33 | |
| PLN02412 | 167 | probable glutathione peroxidase | 95.32 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 95.24 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 95.22 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 95.18 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 95.1 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 95.03 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 94.97 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 94.96 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 94.83 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 94.67 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 94.65 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 94.61 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 94.44 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 94.37 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 94.33 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 94.3 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 94.29 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 94.27 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 94.25 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 94.21 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 94.2 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 94.1 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 93.86 | |
| PRK15000 | 200 | peroxidase; Provisional | 93.8 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 93.27 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 92.93 | |
| PF14836 | 88 | Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A | 92.84 | |
| KOG4351 | 244 | consensus Uncharacterized conserved protein [Funct | 92.55 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 92.27 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 92.25 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 92.15 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 92.14 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 92.08 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 92.08 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 91.99 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 91.92 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 91.69 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 91.57 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 91.32 | |
| KOG2086 | 380 | consensus Protein tyrosine phosphatase SHP1/Cofact | 91.23 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 91.09 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 90.95 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 90.9 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 89.81 | |
| PRK06369 | 115 | nac nascent polypeptide-associated complex protein | 89.64 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 89.29 | |
| TIGR00264 | 116 | alpha-NAC-related protein. This hypothetical prote | 89.02 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 88.87 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 88.73 | |
| PRK13191 | 215 | putative peroxiredoxin; Provisional | 88.51 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 87.6 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 87.43 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 87.31 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 86.92 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 86.89 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 86.52 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 86.41 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 86.38 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 86.34 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 85.94 | |
| COG1308 | 122 | EGD2 Transcription factor homologous to NACalpha-B | 85.57 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 84.75 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 84.75 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 83.69 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 82.75 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 82.68 | |
| COG1225 | 157 | Bcp Peroxiredoxin [Posttranslational modification, | 82.55 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 82.13 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 81.73 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 81.65 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 81.48 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 81.43 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 80.03 |
| >KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-43 Score=339.32 Aligned_cols=345 Identities=37% Similarity=0.687 Sum_probs=242.9
Q ss_pred hhHHHHHHhhhccccCCCHHHHHHHHHHcCCCHHHHHHHHhcCCCCCCCCCCCCCCCccCCCCCCCCCccccCCCCCCCC
Q 013325 8 NDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEV 87 (445)
Q Consensus 8 ~~~~~~v~~F~~iTt~~~~~~A~~~L~~~~w~le~Av~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~V 87 (445)
.+...+|++||+||..++.+.|++||.+++|||+.||++||+........+ ....+
T Consensus 4 ~~~~~lv~~fl~It~~~t~e~A~q~L~~~~~~le~ai~Lffe~~~~~~~~s------------------------~~~~a 59 (356)
T KOG1364|consen 4 GAQRALVSKFLAITVQQTVEIATQYLSAADWDLEAAINLFFEHGGFTQVYS------------------------SSSAA 59 (356)
T ss_pred chHHHHHHHHHHHhccccHHHHHHHHHhcCCcHHHHHHHHHHhcccccccC------------------------CcccC
Confidence 344669999999955589999999999999999999999999765422111 01122
Q ss_pred CCCCcccccccccccccccCCCCCCCCCCCCccc-ccccchhhhcCCCcccCcCCCCCCCcchHHHHHhhcCCCCcCccc
Q 013325 88 RAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLI-AFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFN 166 (445)
Q Consensus 88 raP~~~~~~~Lv~~~~~~~~~~~~~~~~~~~~~~-~~~~f~~e~~~~~~~~~~~~~~~~~~~~~~~l~~~f~pp~~~~~~ 166 (445)
..|+++++++|+.+. |-+ . . .+.++. +-. +|++. +...+++.+|+++|+||+.|++.
T Consensus 60 ~sp~~~~re~l~~~~---~~~--d--~-~~~s~~~p~~----------~~~~~----s~~~~~~srL~slfrpp~~i~~~ 117 (356)
T KOG1364|consen 60 PSPIEPQREVLFDPL---GIM--D--Q-STSSILDPSE----------NQDDE----SEHASSQSRLASLFRPPTDILSH 117 (356)
T ss_pred CCcccccceeeeccc---ccc--c--c-CcccccCccc----------ccchh----hhhccccchhhhhcCCCcchhhc
Confidence 348888999997642 100 0 0 001110 111 11111 11234567899999999999999
Q ss_pred CcHHHHHHHHHHcCCeEEEEEeCCCCcchhhhhhhcccCChhHHHHhhccEEEEEeecCChhHHHHHHHcCCCCCcEEEE
Q 013325 167 GSFEKAKDAASVQDKWLLVNLQSTKEFSSHMVLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLV 246 (445)
Q Consensus 167 gs~~eA~~~Ak~~~K~LlV~l~~~~~f~~~~~~~rdv~~~~~V~~~l~~~FV~~~~~~~s~eg~~~~~~y~v~~~P~l~i 246 (445)
|++++|+..|.++.+||||+ .++.+|.++..+|++...|+|+|
T Consensus 118 gsld~ak~~a~sk~~wllV~-------------------------------------~Dtseg~~~~~Fy~~~~~P~i~i 160 (356)
T KOG1364|consen 118 GSLDAAKSTASSKQRWLLVL-------------------------------------DDTSEGQPFSAFYHISSLPHIAI 160 (356)
T ss_pred CChhhhhhcccccceEEEEe-------------------------------------eccCCCCchhhheeccCCceEEE
Confidence 99999999999999999993 45567777888999999999999
Q ss_pred EeCCCCceeEEEecCCChHHHHHHHHhhhhcCCccccccccCCCCCCCCCCccccCCCCCc-chHHHHHHHHHHhHHHhc
Q 013325 247 VDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD-IENEELLQALAASMETIK 325 (445)
Q Consensus 247 i~p~tg~~~~~~~G~~~~~~~l~~L~~~~~~~~~~~~~~~~~~r~~~e~~~~~~~~~~~r~-~ede~~~~al~~sl~~~~ 325 (445)
|||+||+.+++|.|.+.+..|++.|..|++.+++++-+.+...|++... ...-.. +|+.+++.|+.+++-.-.
T Consensus 161 iDp~Tge~v~~ws~vi~~~~fl~~l~~Fi~~~~~d~vas~t~n~~~p~~------e~~~~ss~e~~~~elai~~sv~~~~ 234 (356)
T KOG1364|consen 161 IDPITGERVKRWSGVIEPEQFLSDLNEFIDSCPHDEVASLTRNRKRPKT------EPTCLSSEEDMQMELAIKNSVVNPS 234 (356)
T ss_pred ECCchhhhhhhhccccCHHHHHHHHHHHHhcCCccccccccccccCCCC------CccccccccchhhhcccccccccCC
Confidence 9999999999999999999999999999999998854444333322211 001112 367766777777765432
Q ss_pred ccCCCCCCcccccCc-chhhhhh-hcCCCCCCCCCCCCC--CCCCceEEEEECCCCceEEEeeCCCCchHHHHHHHHhhc
Q 013325 326 DASGVSSSDTDVAST-DKDEASA-TEKPAYPILPEEPKV--DRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQL 401 (445)
Q Consensus 326 ~~~~~~ee~~~~~~~-e~~e~~~-~~~~~~~~lp~EP~~--~~~~~~~I~iRlP~G~r~~rrF~~~d~l~~l~~fv~~~~ 401 (445)
-... .++ +-... ++.|... ...-..+.+..||.. ..+-+|+|+||||||+|.+|||.++++++.||.||.++.
T Consensus 235 ~~~e--~e~-~~~s~~ee~e~~~e~~~~~~~~a~~ep~~~~~~svvt~i~vR~pdG~R~qrkf~~sepv~ll~~~~~s~~ 311 (356)
T KOG1364|consen 235 SGTE--FEG-QGASDEEELETVLEEDLFVFPVATVEPKGDCDRSVVTSIQVRFPDGRRKQRKFLKSEPVQLLWSFCYSHM 311 (356)
T ss_pred Cccc--ccC-CCCcccchhhccccccccccceeeecCCCCCCccceeEEEEecCCccHHHHhhccccHHHHHHHHHHHhh
Confidence 1101 000 00000 0001000 001122333344433 335588899999999999999999999999999999999
Q ss_pred CCCCCcCeEEEcCCCCCcccCCCCcCCchhhcCCcCc--eEEEEeC
Q 013325 402 EGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANA--MISVTWE 445 (445)
Q Consensus 402 ~~~~~~~f~L~~~fPr~~~~l~~~~~~Tl~e~gL~~~--~v~v~~~ 445 (445)
+++....|+|++.||++ +++.++.+.||+|+||.|+ .+.++|+
T Consensus 312 dg~~k~~FkLv~a~P~~-k~l~~~~daT~~eaGL~nS~~~~~~e~e 356 (356)
T KOG1364|consen 312 DGSDKKRFKLVQAIPAS-KTLDYGADATFKEAGLANSETLLSVEWE 356 (356)
T ss_pred cccccccceeeecccch-hhhhccccchHHHhccCccccccccccC
Confidence 99999999999999976 6888889999999999998 5666664
|
|
| >KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain | Back alignment and domain information |
|---|
| >KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) | Back alignment and domain information |
|---|
| >smart00804 TAP_C C-terminal domain of vertebrate Tap protein | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A | Back alignment and domain information |
|---|
| >KOG4351 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK06369 nac nascent polypeptide-associated complex protein; Reviewed | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >TIGR00264 alpha-NAC-related protein | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13191 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 445 | ||||
| 2dlx_A | 153 | Solution Structure Of The Uas Domain Of Human Ubx D | 2e-29 |
| >pdb|2DLX|A Chain A, Solution Structure Of The Uas Domain Of Human Ubx Domain- Containing Protein 7 Length = 153 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 | Back alignment and structure |
|---|
Score = 168 bits (427), Expect = 6e-51
Identities = 58/136 (42%), Positives = 83/136 (61%), Gaps = 2/136 (1%)
Query: 141 GAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMVLN 200
+S D LA L+RPP LM GSFE AK+ +Q+KWL++N+Q+ ++F+ LN
Sbjct: 3 SGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQC-LN 61
Query: 201 RDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCG 260
RD W+NEAV I +FIFWQVY D+ EG++ +YKL P V ++DP TGQK+ W
Sbjct: 62 RDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQ 121
Query: 261 MVQPESLLEDLVPFMD 276
+ S L+ + F+
Sbjct: 122 L-DVSSFLDQVTGFLG 136
|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Length = 109 | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Length = 127 | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Length = 124 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Length = 84 | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 178 | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Length = 109 | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Length = 46 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 445 | |||
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 99.95 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 99.94 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 99.86 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 99.77 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 99.76 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 99.76 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 99.71 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.28 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.26 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 99.22 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 99.21 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 99.2 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 99.19 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 99.18 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 99.17 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 98.79 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 99.14 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.01 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 98.98 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 98.97 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 98.68 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 98.65 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 98.62 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 98.61 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 98.59 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 98.59 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 98.55 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 98.55 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 98.54 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 98.54 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 98.54 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 98.53 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 98.53 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 98.53 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 98.52 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 98.52 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 98.51 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 98.51 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 98.51 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 98.5 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 98.49 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 98.46 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 98.45 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 98.45 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 98.43 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 98.43 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 98.42 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 98.41 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 98.41 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 98.41 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 98.41 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 98.41 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 98.41 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 98.4 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 98.4 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 98.37 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 98.37 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 98.36 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 98.36 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 98.36 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 98.35 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 98.35 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 98.33 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 98.33 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 98.32 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 98.32 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 98.31 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 98.31 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 98.29 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 98.27 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 98.26 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 98.25 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 98.24 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 98.24 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 98.24 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 98.23 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.23 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 98.23 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 98.22 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 98.22 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.22 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 98.21 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 98.2 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 98.18 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 98.18 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 98.18 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 98.17 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 98.16 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 98.16 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 98.15 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 98.13 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 98.12 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 98.1 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 98.1 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 98.1 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 98.09 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 98.06 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 98.05 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 98.05 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 97.29 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 98.02 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 98.01 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 98.01 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 98.01 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 97.98 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 97.97 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 97.97 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 97.97 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 97.96 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 97.96 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 97.96 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 97.96 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 97.93 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 97.92 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 97.89 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 97.88 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 97.88 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 97.87 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 97.87 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 97.87 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 97.86 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 97.85 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 97.85 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 97.85 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 97.85 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 97.78 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 97.78 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 97.76 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 97.75 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 97.74 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 97.74 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 97.74 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 97.73 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 97.73 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 97.73 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 97.7 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 97.66 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 97.64 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 97.64 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 97.62 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 97.62 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 97.58 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 97.56 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 97.56 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 97.56 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 97.52 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 97.51 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 97.49 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 97.48 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 97.47 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 97.45 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 97.42 | |
| 1oai_A | 59 | Nuclear RNA export factor; nuclear transport, nucl | 97.41 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 97.37 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 97.37 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 97.36 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 97.33 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 97.33 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 97.33 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 97.31 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 97.3 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 97.3 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 97.29 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 97.28 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 97.27 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 97.27 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 97.27 | |
| 2jp7_A | 57 | MRNA export factor MEX67; solution MEX67, UBA, tra | 97.23 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 97.22 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 97.22 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 97.22 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 97.2 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 97.19 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 97.17 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 97.14 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 97.12 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 97.09 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 96.98 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 96.98 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 96.98 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 96.97 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 96.96 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 96.95 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 96.94 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 96.94 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 96.91 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 96.88 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 96.87 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 96.86 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 96.85 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 96.85 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 96.84 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 96.84 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 96.84 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 96.8 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 96.79 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 96.76 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 96.74 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 96.73 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 96.72 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 96.68 | |
| 4gew_A | 362 | 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy | 96.67 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 96.58 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 96.58 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 96.57 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 96.56 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 96.54 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 96.53 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 96.51 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 96.5 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 96.48 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 96.47 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 96.46 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 96.41 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 96.41 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 96.4 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 96.4 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 96.38 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 96.35 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 96.35 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 96.34 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 95.34 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 96.3 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 96.26 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 96.26 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 96.25 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 96.24 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 96.22 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 96.22 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 96.2 | |
| 2l2d_A | 73 | OTU domain-containing protein 7A; UBA fold, struct | 96.19 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 96.12 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 96.11 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 96.09 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 95.08 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 96.09 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 96.08 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 96.06 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 96.06 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 96.05 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 96.01 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 95.96 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 95.96 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 95.96 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 95.9 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 95.9 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 95.88 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 95.88 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 95.88 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 95.87 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 95.85 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 95.8 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 95.78 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 95.76 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 95.74 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 95.74 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 95.71 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 95.68 | |
| 3keb_A | 224 | Probable thiol peroxidase; structural genomics, AP | 95.67 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 95.62 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 95.59 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 95.58 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 95.54 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 95.52 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 95.47 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 95.44 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 95.4 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 95.4 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 95.38 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 95.33 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 95.3 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 95.28 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 95.25 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 95.22 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 95.16 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 95.14 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 95.13 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 95.1 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 95.1 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 95.08 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 95.02 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 95.0 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 95.0 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 94.99 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 94.99 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 94.97 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 94.96 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 94.93 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 94.93 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 94.9 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 94.88 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 94.87 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 94.85 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 94.8 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 94.78 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 94.75 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 94.68 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 94.67 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 94.65 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 94.61 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 94.59 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 94.53 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 94.51 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 94.5 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 94.48 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 94.39 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 94.27 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 94.17 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 94.16 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 94.13 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 94.08 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 94.05 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 93.99 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 93.96 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 93.96 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 93.95 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 93.88 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 93.85 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 93.8 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 93.79 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 93.77 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 93.75 | |
| 4eo3_A | 322 | Bacterioferritin comigratory protein/NADH dehydro; | 93.68 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 93.65 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 93.63 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 93.62 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 93.57 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 93.55 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 93.55 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 93.4 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 93.33 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 93.33 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 93.29 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 93.24 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 93.15 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 93.09 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 92.92 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 92.8 | |
| 1jkg_B | 250 | TAP; NTF2-like domain, transport protein; 1.90A {H | 92.79 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 92.74 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 92.71 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 92.5 | |
| 3sbc_A | 216 | Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c | 92.5 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 92.21 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 92.2 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 92.04 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 91.98 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 91.95 | |
| 1vdl_A | 80 | Ubiquitin carboxyl-terminal hydrolase 25; UBA doma | 91.83 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 91.08 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 91.79 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 91.74 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 91.42 | |
| 3tue_A | 219 | Tryparedoxin peroxidase; thioredoxin fold, peroxir | 91.11 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 91.03 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 90.99 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 90.65 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 90.64 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 90.44 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 90.41 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 90.34 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 90.27 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 90.27 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 90.11 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 89.85 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 89.75 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 89.71 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 89.58 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 89.5 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 89.48 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 89.34 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 89.2 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 89.1 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 89.0 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 88.97 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 88.71 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 88.67 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 88.49 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 88.19 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 88.19 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 88.04 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 87.74 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 87.66 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 87.65 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 87.59 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 86.71 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 86.18 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 85.91 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 85.41 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 85.29 | |
| 2lva_A | 129 | Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi | 85.42 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 84.73 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 84.5 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 84.45 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 83.85 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 83.13 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 82.97 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 82.45 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 81.6 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 81.09 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 80.25 |
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=9.3e-28 Score=218.88 Aligned_cols=129 Identities=21% Similarity=0.280 Sum_probs=120.0
Q ss_pred HHHHHhhcCCCCcCcccCcHHHHHHHH----HHcCCeEEEEEeCCCCcchhhhhhhcccCChhHHHHhhccEEEEEeecC
Q 013325 150 RDNLASLYRPPFHLMFNGSFEKAKDAA----SVQDKWLLVNLQSTKEFSSHMVLNRDTWANEAVSQTISTNFIFWQVYDD 225 (445)
Q Consensus 150 ~~~l~~~f~pp~~~~~~gs~~eA~~~A----k~~~K~LlV~l~~~~~f~~~~~~~rdv~~~~~V~~~l~~~FV~~~~~~~ 225 (445)
.+.|+++|+++||.||.|+|++|++.| ++++||||||||+++|++|+. ||++||||++|+++|++|||+|++|++
T Consensus 21 ~~~f~~~yg~~~p~F~~gs~~~Al~~A~~~~k~e~K~LlVyLhs~~~~~~~~-f~~~~L~~~~V~~~l~~nfV~w~~dv~ 99 (178)
T 2ec4_A 21 TAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNV-FCSQMLCAESIVSYLSQNFITWAWDLT 99 (178)
T ss_dssp HHHHHHHHCSCCCCCCCSCHHHHHHTTTSSCTTTCCEEEEEEECSSCSHHHH-HHHHTTTCHHHHHHHHHTEEEEEEECC
T ss_pred HHHHHHHhCCCCCCeeeCCHHHHHHHHHhhhhhhCcEEEEEEeCCCCccHHH-HHHHhcCCHHHHHHHHcCEEEEEEeCC
Confidence 456889999999999999999999999 999999999999999999999 999999999999999999999999999
Q ss_pred Chh-------------HHHHHHH---cCCCCCcEEEEEeCCCC--ceeEEEecCCChHHHHHHHHhhhhcCC
Q 013325 226 TSE-------------GKKVCTY---YKLDSIPVVLVVDPITG--QKMRSWCGMVQPESLLEDLVPFMDGGP 279 (445)
Q Consensus 226 s~e-------------g~~~~~~---y~v~~~P~l~ii~p~tg--~~~~~~~G~~~~~~~l~~L~~~~~~~~ 279 (445)
++| |+.++.. |++..||+++||+++.+ +++.++.|.+++++|++.|+.+++.+.
T Consensus 100 ~~e~~~~~~~~~~~~~g~~~a~~~~~~~~~~~P~l~ii~~~~~~~~vl~~~~G~~~~~~ll~~L~~~~e~~~ 171 (178)
T 2ec4_A 100 KDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFT 171 (178)
T ss_dssp SHHHHHHHHHHHHHHTCHHHHHHHHHSCSTTCSEEEEECCCSSCCCEEEEECSCCCHHHHHHHHHHHHHHHH
T ss_pred CchhhhhhhhhhhhhhHHHHHHHHhhcCCCCCCeEEEEEcCCCceEEEEEEeCCCCHHHHHHHHHHHHHHhh
Confidence 999 5567665 89999999999998744 578999999999999999999999773
|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 445 | ||||
| d2dlxa1 | 147 | c.47.1.24 (A:1-147) UBX domain-containing protein | 3e-31 | |
| d2cr5a1 | 96 | d.15.1.2 (A:8-103) UBX domain-containing protein 6 | 7e-13 | |
| d1i42a_ | 89 | d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: | 1e-12 | |
| d1wj4a_ | 124 | d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human | 2e-10 | |
| d1h8ca_ | 82 | d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human | 3e-09 | |
| d1v92a_ | 46 | a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- | 2e-08 |
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: UAS domain domain: UBX domain-containing protein 7 species: Human (Homo sapiens) [TaxId: 9606]
Score = 114 bits (287), Expect = 3e-31
Identities = 60/157 (38%), Positives = 89/157 (56%), Gaps = 12/157 (7%)
Query: 141 GAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMVLN 200
+S D LA L+RPP LM GSFE AK+ +Q+KWL++N+Q+ ++F+ + N
Sbjct: 3 SGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCL-N 61
Query: 201 RDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCG 260
RD W+NEAV I +FIFWQVY D+ EG++ +YKL P V ++DP TGQK+ W
Sbjct: 62 RDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEW-H 120
Query: 261 MVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTT 297
+ S L+ + F+ H + G S++
Sbjct: 121 QLDVSSFLDQVTGFLG----------EHGQLDGLSSS 147
|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 445 | |||
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 99.96 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 99.84 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.81 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 99.75 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 99.71 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 99.46 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 99.14 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.11 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 98.8 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 98.78 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 98.69 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 98.66 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 98.65 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 98.63 | |
| d1s3si_ | 50 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.62 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 98.6 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 98.46 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 98.46 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 98.45 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 98.44 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 98.43 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 98.42 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 98.36 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 98.27 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 98.16 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 98.14 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 98.11 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 97.93 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.93 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 97.87 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 97.86 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 97.85 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 97.83 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 97.81 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 97.79 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 97.69 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 97.65 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 97.56 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 97.52 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 97.49 | |
| d1oaia_ | 59 | FG-binding, C-terminal domain of TAP {Human (Homo | 97.46 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 97.4 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 97.39 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 97.38 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 97.37 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 97.35 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 97.27 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.18 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 97.14 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 97.04 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.87 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 96.82 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 96.7 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 96.68 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 96.59 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 96.52 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 96.39 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 96.29 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 96.26 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 96.19 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 96.16 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 96.12 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 96.07 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 96.03 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 95.76 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 95.75 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 95.73 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 95.71 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 95.66 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 95.58 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 95.48 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 95.37 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 95.35 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 95.14 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 95.05 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 94.95 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.92 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 94.9 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 94.86 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 94.76 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 94.74 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 94.6 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 94.55 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 94.53 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 94.52 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 94.51 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 94.5 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 94.47 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 94.41 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.3 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 94.21 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 94.18 | |
| d1vdla_ | 80 | Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M | 94.11 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.03 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 93.9 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 93.77 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 93.68 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 93.64 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 93.6 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 93.52 | |
| d2b7ka1 | 169 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 93.37 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 93.33 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 93.02 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 92.78 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 92.72 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 92.7 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 92.5 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 92.46 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 92.41 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 92.36 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 92.06 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 92.04 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 91.69 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 91.23 | |
| d1qmva_ | 197 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 90.78 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 90.27 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 90.17 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 90.15 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 89.87 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 89.87 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 89.41 | |
| d1prxa_ | 220 | 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: | 89.29 | |
| d1mn3a_ | 54 | Vacuolar protein sorting-associated protein vps9 { | 89.2 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 89.14 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 88.33 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 88.18 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 86.21 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 85.83 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 85.53 | |
| d3e46a1 | 42 | Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal | 85.47 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 85.06 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 84.96 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 84.67 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 84.09 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 83.57 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 83.4 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 82.5 | |
| d1xcca_ | 219 | 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax | 82.3 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 81.06 | |
| d1xvqa_ | 166 | Thiol peroxidase Tpx {Mycobacterium tuberculosis [ | 80.99 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 80.48 |
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: UAS domain domain: UBX domain-containing protein 7 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=4.4e-30 Score=225.35 Aligned_cols=130 Identities=43% Similarity=0.865 Sum_probs=123.1
Q ss_pred chHHHHHhhcCCCCcCcccCcHHHHHHHHHHcCCeEEEEEeCCCCcchhhhhhhcccCChhHHHHhhccEEEEEeecCCh
Q 013325 148 SSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMVLNRDTWANEAVSQTISTNFIFWQVYDDTS 227 (445)
Q Consensus 148 ~~~~~l~~~f~pp~~~~~~gs~~eA~~~Ak~~~K~LlV~l~~~~~f~~~~~~~rdv~~~~~V~~~l~~~FV~~~~~~~s~ 227 (445)
.+..+|+++|+||++++|.|+|++|++.|++++||||||||++||++|+. |+++||+|++|++++++|||+|+++.+++
T Consensus 10 ~~~~~~a~~~~pp~~i~~~~~~~~A~~~Ak~~~K~llV~~~~~~C~~C~~-m~~~v~~d~~V~~~l~~~fV~~~v~~~~~ 88 (147)
T d2dlxa1 10 KKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQC-LNRDVWSNEAVKNIIREHFIFWQVYHDSE 88 (147)
T ss_dssp CCCCCCCCTTSCCTTTSCCSCHHHHHHHHHHHTCEEEEEEECSCTTTHHH-HHHHTTTCHHHHHHHHHTEEEEEEESSSH
T ss_pred cchHHHHHhhCCCccccccCCHHHHHHHHHHcCCcEEEEEecCCCCchHH-HHHhccCCHHHHHHHhhheeEeeecccch
Confidence 34445899999999999999999999999999999999999999999999 99999999999999999999999999999
Q ss_pred hHHHHHHHcCCCCCcEEEEEeCCCCceeEEEecCCChHHHHHHHHhhhhcCC
Q 013325 228 EGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGP 279 (445)
Q Consensus 228 eg~~~~~~y~v~~~P~l~ii~p~tg~~~~~~~G~~~~~~~l~~L~~~~~~~~ 279 (445)
+|..+++.|++..||+++||+|++|++++.| |.+++++|+..|..|++.++
T Consensus 89 e~~~~~~~y~v~~~Pti~~idp~~ge~v~~~-~~~~~~~fl~~L~~fl~~~~ 139 (147)
T d2dlxa1 89 EGQRYIQFYKLGDFPYVSILDPRTGQKLVEW-HQLDVSSFLDQVTGFLGEHG 139 (147)
T ss_dssp HHHHHHHHHTCCSSSEEEEECTTTCCCCEEE-SSCCHHHHHHHHHHHHHHTC
T ss_pred hhhhhhhheecCceeEEEEEeCCCCeEeccc-CCCCHHHHHHHHHHHHhhCC
Confidence 9999999999999999999999999998777 55899999999999999774
|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|