Citrus Sinensis ID: 013384

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLRDTTVSQPQTDTVSNGSYRPSSAVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISSAMKEKEEHRGSNASSGSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHccccccEEEEccccccHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEcccccccHHHHHHHcccEEEEcccccHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccEEEEEEcccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHcccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHcccccEEEcccHHHHHHHHHccccccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHcHHccHHHHHHHHHcEEEEEEcccccHHHHHHHHHccccEEEEEEcccEEcccccHccccEEEEEEcccccHHHHHHHHHcccEEEEccccccHHHHHHHHHHHcccccEEEEEEEEccEEEEEEcccccccccccccccccccccccccccEEcHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEEEcccccccccccccccccccHHHHccHHHHcccccccccHHHHHccccccccHHHHHHHHHccccEEEEEcccccEEEEEEccccEEccHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccccEccHHHHHHHHHHcccccccc
METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLrdttvsqpqtdtvsngsyrpssavdyglspdMIYRYSRHlllpsfgvegqsnlLKSSILVIgagglgspALLYLAACGvgrlgivdhdvvelnnmhriNSTVHIIEHREALRTSNALEILSQYEIVVDatdnapsrymISDCCVvlgkplvsgaalglegqltvynynggpcyrclfptpppttacqrcadsgvlgvvpGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIrgrssqceacgenstftqdhfrnfdyekftqsplstlplkLNLLsadsrisskeykekvvngeahilvdvrpahhfrivslpnsiniplsdlesrlPEISSAMKEkeehrgsnassgsnLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGleswandvdpsfpvy
metnggstdvarVLGEIETLKAAKSDIDYRISALEaqlrdttvsqpqtdtvsngsyrpssaVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIrgrssqceacgenSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSlpnsiniplsdLESRLPEISSAMKekeehrgsnassgsnlYVVCRRGNDSQRAVQALHKLGFTSARDIIGGleswandvdpsfpvy
METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLRDTTVSQPQTDTVSNGSYRPSSAVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQsplstlplklnllsADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISSAMKEKEEHRGSNASSGSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY
************VLGEIETLKAAKSDIDYRISAL***************************VDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFT****************************VVNGEAHILVDVRPAHHFRIVSLPNSINIP*******************************LYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWAN*********
*************LGEIETLKAAKSDIDYRIS*********************************LSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLP*******ADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLP****************ASSGSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY
METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLR*******************SSAVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISS***************GSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY
**********ARVLGEIETLKAAKSDIDYRISALEAQLRDT*****************S*AVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISSAMKEKEEHRGSNASSGSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLRDTTVSQPQTDTVSNGSYRPSSAVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHRINSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISSAMKEKEEHRGSNASSGSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query444 2.2.26 [Sep-21-2011]
Q9ZNW0464 Adenylyltransferase and s yes no 0.988 0.946 0.671 0.0
B6TNK6468 Adenylyltransferase and s N/A no 0.948 0.899 0.592 1e-153
B4FAT0482 Adenylyltransferase and s N/A no 0.948 0.873 0.590 1e-152
A3ACF3445 Adenylyltransferase and s yes no 0.957 0.955 0.534 1e-129
Q17CA7437 Adenylyltransferase and s N/A no 0.819 0.832 0.455 3e-99
B0W377438 Adenylyltransferase and s N/A no 0.921 0.933 0.407 1e-97
Q8AWD2459 Adenylyltransferase and s yes no 0.921 0.891 0.422 4e-97
B4NXF7453 Adenylyltransferase and s N/A no 0.945 0.927 0.421 4e-97
Q9VLJ8453 Adenylyltransferase and s yes no 0.927 0.909 0.419 1e-95
Q58E95451 Adenylyltransferase and s N/A no 0.840 0.827 0.463 2e-95
>sp|Q9ZNW0|MOCS3_ARATH Adenylyltransferase and sulfurtransferase MOCS3 OS=Arabidopsis thaliana GN=MOCS3 PE=2 SV=1 Back     alignment and function desciption
 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/469 (67%), Positives = 380/469 (81%), Gaps = 30/469 (6%)

Query: 1   METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLRDTTVSQPQTDTVSNG-SYRPS 59
           M +NGG  D + ++ E+E LK  K++I++RIS LEA+L+DT   +   D VSNG SY  +
Sbjct: 1   MMSNGG--DSSEIVRELEELKLKKAEIEHRISTLEAKLQDTAAVE-LYDAVSNGDSYLTA 57

Query: 60  SAVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGR 119
             +++GLSPD IYRYSR LLLPSF VEGQSNLLKSS+LVIGAGGLGSPALLYLAACGVG+
Sbjct: 58  PELEHGLSPDQIYRYSRQLLLPSFAVEGQSNLLKSSVLVIGAGGLGSPALLYLAACGVGQ 117

Query: 120 LGIVDHDVVELNNMHR-----------------------INSTVHIIEHREALRTSNALE 156
           LGI+DHDVVELNNMHR                       INST+ + E+ EALRTSNALE
Sbjct: 118 LGIIDHDVVELNNMHRQIIHTEAFIGHPKVKSAAAACRSINSTIKVDEYVEALRTSNALE 177

Query: 157 ILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFP 216
           ILSQY+I+VDATDN PSRYMISDCCV+LGKPLVSGAALG+EGQLTVYN+NGGPCYRCLFP
Sbjct: 178 ILSQYDIIVDATDNPPSRYMISDCCVLLGKPLVSGAALGMEGQLTVYNHNGGPCYRCLFP 237

Query: 217 TPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIV 276
           TPPPT+ACQRC+DSGVLGVVPG+IGCLQALE IK+AS VGEPLS RMLLFDALSAR+RIV
Sbjct: 238 TPPPTSACQRCSDSGVLGVVPGVIGCLQALETIKLASLVGEPLSERMLLFDALSARMRIV 297

Query: 277 KIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEK 336
           KIRGRSSQC  CG+NS+F +  F++FDYE FTQ PL   P  LNLL A+SRISSKE+KE 
Sbjct: 298 KIRGRSSQCTVCGDNSSFNKQTFKDFDYEDFTQFPLFAGP--LNLLPAESRISSKEFKEI 355

Query: 337 VVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISSAMKEK-EEHRGSNASSG 395
           +   E H+L+DVRP+HH++IVSLP+S+NIPL++LE+RL E++SA+KEK   H  + + + 
Sbjct: 356 LQKKEQHVLLDVRPSHHYKIVSLPDSLNIPLANLETRLNELTSALKEKGNGHANTESCTN 415

Query: 396 SNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY 444
            +++VVCRRGNDSQRAVQ L + GF SA+DIIGGLE+WA +V+P+FP Y
Sbjct: 416 PSVFVVCRRGNDSQRAVQYLRESGFDSAKDIIGGLEAWAANVNPNFPTY 464
Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 1EC: 1
>sp|B6TNK6|MOC31_MAIZE Adenylyltransferase and sulfurtransferase MOCS3 1 OS=Zea mays GN=MOCS3-1 PE=2 SV=1 Back     alignment and function description
>sp|B4FAT0|MOC32_MAIZE Adenylyltransferase and sulfurtransferase MOCS3 2 OS=Zea mays GN=MOCS3-2 PE=2 SV=1 Back     alignment and function description
>sp|A3ACF3|MOCS3_ORYSJ Adenylyltransferase and sulfurtransferase MOCS3 OS=Oryza sativa subsp. japonica GN=MOCS3 PE=3 SV=1 Back     alignment and function description
>sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 Back     alignment and function description
>sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 Back     alignment and function description
>sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 Back     alignment and function description
>sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 Back     alignment and function description
>sp|Q9VLJ8|MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster GN=CG13090 PE=1 SV=1 Back     alignment and function description
>sp|Q58E95|MOCS3_XENLA Adenylyltransferase and sulfurtransferase MOCS3 OS=Xenopus laevis GN=mocs3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
225460881465 PREDICTED: adenylyltransferase and sulfu 0.993 0.948 0.75 0.0
255577167467 ubiquitin-activating enzyme E1, putative 0.988 0.940 0.737 0.0
224061037460 predicted protein [Populus trichocarpa] 0.984 0.95 0.751 0.0
449463254460 PREDICTED: adenylyltransferase and sulfu 0.966 0.932 0.713 0.0
356552825457 PREDICTED: adenylyltransferase and sulfu 0.970 0.943 0.695 0.0
297737480397 unnamed protein product [Vitis vinifera] 0.842 0.942 0.788 0.0
356501556474 PREDICTED: LOW QUALITY PROTEIN: adenylyl 0.941 0.881 0.693 0.0
357494663465 Adenylyltransferase and sulfurtransferas 0.984 0.939 0.673 0.0
255638804456 unknown [Glycine max] 0.936 0.912 0.690 0.0
297796385464 hypothetical protein ARALYDRAFT_918653 [ 0.988 0.946 0.678 0.0
>gi|225460881|ref|XP_002278487.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/468 (75%), Positives = 399/468 (85%), Gaps = 27/468 (5%)

Query: 1   METNGGSTDVARVLGEIETLKAAKSDIDYRISALEAQLRDTTVSQPQTDTVSNGSYR-PS 59
           ME+NG   D +R+L EIETLKAAK+DI++RIS LEA+LRD  +       VS  S     
Sbjct: 1   MESNG--EDASRILREIETLKAAKADIEHRISVLEARLRDIPLPNDAISGVSCSSMSIAD 58

Query: 60  SAVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGR 119
           SA  +GLSPDMIYRYSRHLLLPSFGV+GQS+LLKSSILV+GAGGLG+PALLYLAACGVG 
Sbjct: 59  SAAGHGLSPDMIYRYSRHLLLPSFGVQGQSSLLKSSILVVGAGGLGAPALLYLAACGVGC 118

Query: 120 LGIVDHDVVELNNMHR-----------------------INSTVHIIEHREALRTSNALE 156
           +G VDHDVVELNN+HR                       INST+ I+EH+EAL TSNALE
Sbjct: 119 IGTVDHDVVELNNLHRQIIHTEAYVGQPKVQSAAAACRSINSTIQIVEHKEALCTSNALE 178

Query: 157 ILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFP 216
           ILS+Y++V+DATDN PSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNY GGPCYRCLFP
Sbjct: 179 ILSKYDLVIDATDNVPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYKGGPCYRCLFP 238

Query: 217 TPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIV 276
           TPPPTTACQRC+DSGVLGVVPGIIGCLQALEAIK+ASAVGEPLSGRMLLFDALSARIRIV
Sbjct: 239 TPPPTTACQRCSDSGVLGVVPGIIGCLQALEAIKIASAVGEPLSGRMLLFDALSARIRIV 298

Query: 277 KIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEK 336
           KIRGR SQCE CGEN+TFTQ  F++FDYEKFT+SPLST PLKLNLL ADSRI+SKEY ++
Sbjct: 299 KIRGRLSQCEVCGENATFTQQKFQDFDYEKFTRSPLSTTPLKLNLLPADSRITSKEYNDR 358

Query: 337 VVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLPEISSAMKEKEEHRGSNASSGS 396
           +VNGEAH+LVDVRP+HHF IVSLP S+NIPLS LE+R+ EISSA+KE+EE +GSN  SG+
Sbjct: 359 LVNGEAHVLVDVRPSHHFNIVSLPKSLNIPLSSLETRMSEISSALKEEEEQKGSN-HSGT 417

Query: 397 NLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWANDVDPSFPVY 444
           ++YVVCRRGNDSQRAV+ LHK+GFTSA+DIIGGLESWA+DVDP+FP Y
Sbjct: 418 SIYVVCRRGNDSQRAVEYLHKIGFTSAKDIIGGLESWAHDVDPNFPTY 465

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577167|ref|XP_002529467.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] gi|223531083|gb|EEF32933.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224061037|ref|XP_002300327.1| predicted protein [Populus trichocarpa] gi|222847585|gb|EEE85132.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449463254|ref|XP_004149349.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Cucumis sativus] gi|449503207|ref|XP_004161887.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356552825|ref|XP_003544763.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|297737480|emb|CBI26681.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356501556|ref|XP_003519590.1| PREDICTED: LOW QUALITY PROTEIN: adenylyltransferase and sulfurtransferase MOCS3-like [Glycine max] Back     alignment and taxonomy information
>gi|357494663|ref|XP_003617620.1| Adenylyltransferase and sulfurtransferase MOCS3 [Medicago truncatula] gi|355518955|gb|AET00579.1| Adenylyltransferase and sulfurtransferase MOCS3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255638804|gb|ACU19706.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297796385|ref|XP_002866077.1| hypothetical protein ARALYDRAFT_918653 [Arabidopsis lyrata subsp. lyrata] gi|297311912|gb|EFH42336.1| hypothetical protein ARALYDRAFT_918653 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
TAIR|locus:2161635464 CNX5 ""co-factor for nitrate, 0.691 0.661 0.696 5.9e-161
UNIPROTKB|E1C3M4468 MOCS3 "Uncharacterized protein 0.693 0.658 0.442 7.9e-93
UNIPROTKB|B4NXF7453 GE18783 "Adenylyltransferase a 0.695 0.682 0.414 6.2e-91
FB|FBgn0032054453 CG13090 [Drosophila melanogast 0.662 0.649 0.432 3e-89
UNIPROTKB|Q58E95451 mocs3 "Adenylyltransferase and 0.727 0.716 0.435 1e-88
ZFIN|ZDB-GENE-040426-782459 mocs3 "molybdenum cofactor syn 0.684 0.662 0.426 2.1e-88
UNIPROTKB|B4HYP0453 GM17034 "Adenylyltransferase a 0.668 0.655 0.415 2.7e-88
RGD|1307044458 Mocs3 "molybdenum cofactor syn 0.689 0.668 0.419 1.9e-87
UNIPROTKB|Q7PY41441 AGAP001737 "Adenylyltransferas 0.675 0.680 0.433 8.1e-87
UNIPROTKB|B4JBC4449 GH10959 "Adenylyltransferase a 0.700 0.692 0.411 2.2e-84
TAIR|locus:2161635 CNX5 ""co-factor for nitrate, reductase and xanthine dehydrogenase 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1137 (405.3 bits), Expect = 5.9e-161, Sum P(2) = 5.9e-161
 Identities = 216/310 (69%), Positives = 262/310 (84%)

Query:   136 INSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALG 195
             INST+ + E+ EALRTSNALEILSQY+I+VDATDN PSRYMISDCCV+LGKPLVSGAALG
Sbjct:   157 INSTIKVDEYVEALRTSNALEILSQYDIIVDATDNPPSRYMISDCCVLLGKPLVSGAALG 216

Query:   196 LEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAV 255
             +EGQLTVYN+NGGPCYRCLFPTPPPT+ACQRC+DSGVLGVVPG+IGCLQALE IK+AS V
Sbjct:   217 MEGQLTVYNHNGGPCYRCLFPTPPPTSACQRCSDSGVLGVVPGVIGCLQALETIKLASLV 276

Query:   256 GEPLSGRMLLFDALSARIRIVKIRGRSSQCEACGENSTFTQDHFRNFDYEKFTQXXXXXX 315
             GEPLS RMLLFDALSAR+RIVKIRGRSSQC  CG+NS+F +  F++FDYE FTQ      
Sbjct:   277 GEPLSERMLLFDALSARMRIVKIRGRSSQCTVCGDNSSFNKQTFKDFDYEDFTQFPLFAG 336

Query:   316 XXXXXXXXADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIVSLPNSINIPLSDLESRLP 375
                     A+SRISSKE+KE +   E H+L+DVRP+HH++IVSLP+S+NIPL++LE+RL 
Sbjct:   337 PLNLLP--AESRISSKEFKEILQKKEQHVLLDVRPSHHYKIVSLPDSLNIPLANLETRLN 394

Query:   376 EISSAMKEKEE-HRGSNASSGSNLYVVCRRGNDSQRAVQALHKLGFTSARDIIGGLESWA 434
             E++SA+KEK   H  + + +  +++VVCRRGNDSQRAVQ L + GF SA+DIIGGLE+WA
Sbjct:   395 ELTSALKEKGNGHANTESCTNPSVFVVCRRGNDSQRAVQYLRESGFDSAKDIIGGLEAWA 454

Query:   435 NDVDPSFPVY 444
              +V+P+FP Y
Sbjct:   455 ANVNPNFPTY 464
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008265 "Mo-molybdopterin cofactor sulfurase activity" evidence=ISS
UNIPROTKB|E1C3M4 MOCS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4NXF7 GE18783 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0032054 CG13090 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q58E95 mocs3 "Adenylyltransferase and sulfurtransferase MOCS3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-782 mocs3 "molybdenum cofactor synthesis 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4HYP0 GM17034 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
RGD|1307044 Mocs3 "molybdenum cofactor synthesis 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7PY41 AGAP001737 "Adenylyltransferase and sulfurtransferase MOCS3" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|B4JBC4 GH10959 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29PG5MOC32_DROPS2, ., 8, ., 1, ., 1, 10.40080.89180.8780yesno
Q9ZNW0MOCS3_ARATH2, ., 8, ., 1, ., 1, 10.67160.98870.9461yesno
Q6FR35UBA4_CANGA2, ., 8, ., 1, ., -0.36530.83550.8568yesno
O59954UBA4_EMENI2, ., 8, ., 1, ., 1, 10.36410.93010.8568yesno
Q8AWD2MOCS3_DANRE2, ., 8, ., 1, ., 1, 10.42200.92110.8910yesno
B4FAT0MOC32_MAIZE2, ., 8, ., 1, ., 1, 10.59010.94810.8734N/Ano
A3LQF9UBA4_PICST2, ., 8, ., 1, ., -0.35660.83550.8374yesno
Q6BHZ2UBA4_DEBHA2, ., 8, ., 1, ., -0.34570.92110.9129yesno
O95396MOCS3_HUMAN2, ., 8, ., 1, ., 1, 10.41340.95040.9173yesno
Q6CMC2UBA4_KLULA2, ., 8, ., 1, ., -0.35230.84450.8445yesno
Q4WV19UBA4_ASPFU2, ., 8, ., 1, ., 1, 10.35870.95040.8559yesno
A2BDX3MOCS3_MOUSE2, ., 8, ., 1, ., 1, 10.43550.83780.8086yesno
B5DS72MOC31_DROPS2, ., 8, ., 1, ., 1, 10.39860.89180.8780yesno
O44510MOCS3_CAEEL2, ., 8, ., 1, ., 1, 10.40880.82880.9154yesno
Q7PY41MOCS3_ANOGA2, ., 8, ., 1, ., 1, 10.44360.82650.8321yesno
B6TNK6MOC31_MAIZE2, ., 8, ., 1, ., 1, 10.59220.94810.8995N/Ano
Q9VLJ8MOCS3_DROME2, ., 8, ., 1, ., 1, 10.41970.92790.9094yesno
A1A4L8MOCS3_BOVIN2, ., 8, ., 1, ., 1, 10.41480.94810.9252yesno
Q55FS0MOCS3_DICDI2, ., 8, ., 1, ., 1, 10.41740.84900.8870yesno
Q09810UBA4_SCHPO2, ., 8, ., 1, ., -0.38970.80400.8902yesno
P38820UBA4_YEAST2, ., 8, ., 1, ., -0.36250.84900.8568yesno
A5GFZ6MOCS3_PIG2, ., 8, ., 1, ., 1, 10.41570.95040.9274yesno
A3ACF3MOCS3_ORYSJ2, ., 8, ., 1, ., 1, 10.53440.95720.9550yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.n10.991
4th Layer2.7.7.n40.991
3rd Layer2.7.70.976
4th Layer2.8.1.1LOW CONFIDENCE prediction!
3rd Layer2.8.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 1e-107
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 2e-99
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 3e-98
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-96
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 2e-88
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 5e-76
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 2e-67
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 9e-64
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 7e-52
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 2e-50
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 3e-46
pfam00899134 pfam00899, ThiF, ThiF family 3e-39
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 1e-37
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 3e-32
pfam0523777 pfam05237, MoeZ_MoeB, MoeZ/MoeB domain 3e-31
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 1e-29
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 5e-21
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 1e-20
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 4e-18
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 7e-17
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-16
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 1e-15
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 1e-14
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 9e-12
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 1e-11
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 2e-11
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 3e-11
PRK08223287 PRK08223, PRK08223, hypothetical protein; Validate 2e-09
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 1e-08
cd0144496 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and 2e-08
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 3e-08
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 4e-08
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 6e-08
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 5e-07
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-06
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 5e-06
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 5e-06
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 6e-06
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 3e-05
PRK14851 679 PRK14851, PRK14851, hypothetical protein; Provisio 4e-05
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 2e-04
PRK14852 989 PRK14852, PRK14852, hypothetical protein; Provisio 9e-04
cd01520128 cd01520, RHOD_YbbB, Member of the Rhodanese Homolo 0.001
PRK10287104 PRK10287, PRK10287, thiosulfate:cyanide sulfurtran 0.002
cd01521110 cd01521, RHOD_PspE2, Member of the Rhodanese Homol 0.003
COG1748389 COG1748, LYS9, Saccharopine dehydrogenase and rela 0.004
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information 
 Score =  316 bits (812), Expect = e-107
 Identities = 121/229 (52%), Positives = 152/229 (66%), Gaps = 24/229 (10%)

Query: 73  RYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNN 132
           RYSR +LLP  G EGQ  L  + +LV+GAGGLGSPA  YLAA GVG+LG+VD DVVEL+N
Sbjct: 1   RYSRQILLPEIGEEGQEKLKNARVLVVGAGGLGSPAAEYLAAAGVGKLGLVDDDVVELSN 60

Query: 133 MHR-----------------------INSTVHIIEHREALRTSNALEILSQYEIVVDATD 169
           + R                       IN  V I  + E L   NA E+++ Y++V+D TD
Sbjct: 61  LQRQILHTEADVGQPKAEAAAERLRAINPDVEIEAYNERLDAENAEELIAGYDLVLDCTD 120

Query: 170 NAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGGPCYRCLFPTPPPTTACQRCAD 229
           N  +RY+I+D CV LGKPLVSGA LG EGQ+TV+    GPCYRCLFP PPP      CA+
Sbjct: 121 NFATRYLINDACVKLGKPLVSGAVLGFEGQVTVFIPGEGPCYRCLFPEPPP-PGVPSCAE 179

Query: 230 SGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKI 278
           +GVLG + G+IG LQALEA+K+   +GEPL+GR+LLFDALS   R +K+
Sbjct: 180 AGVLGPLVGVIGSLQALEALKILLGIGEPLAGRLLLFDALSMSFRTLKL 228

Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). . Length = 228
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|113988 pfam05237, MoeZ_MoeB, MoeZ/MoeB domain Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>gnl|CDD|238779 cd01521, RHOD_PspE2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|224662 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 444
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 100.0
PRK07411390 hypothetical protein; Validated 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
PRK08223287 hypothetical protein; Validated 100.0
PRK08328231 hypothetical protein; Provisional 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 100.0
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 100.0
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 100.0
PRK14852 989 hypothetical protein; Provisional 100.0
PRK14851 679 hypothetical protein; Provisional 99.98
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 99.98
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.98
PRK07877 722 hypothetical protein; Provisional 99.97
KOG2336422 consensus Molybdopterin biosynthesis-related prote 99.97
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.97
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 99.96
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.96
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.96
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 99.96
KOG2015422 consensus NEDD8-activating complex, catalytic comp 99.95
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.95
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 99.95
KOG2013 603 consensus SMT3/SUMO-activating complex, catalytic 99.95
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.94
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 99.94
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.94
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 99.93
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 99.93
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.92
KOG2014331 consensus SMT3/SUMO-activating complex, AOS1/RAD31 99.92
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.9
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.9
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.88
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.88
PTZ00245287 ubiquitin activating enzyme; Provisional 99.87
PRK06153393 hypothetical protein; Provisional 99.86
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 99.86
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.85
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.83
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.81
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.81
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.8
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.79
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.79
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.79
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.78
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.78
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 99.77
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.76
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.76
KOG2016 523 consensus NEDD8-activating complex, APP-BP1/UBA5 c 99.76
PLN02160136 thiosulfate sulfurtransferase 99.75
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.74
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.74
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.74
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.74
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.74
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.73
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.72
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.72
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.72
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.71
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.71
PRK05320257 rhodanese superfamily protein; Provisional 99.71
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.7
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.7
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.69
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.69
PRK01415247 hypothetical protein; Validated 99.69
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.68
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.67
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.67
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.67
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.65
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.65
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.63
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.63
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.63
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.55
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.55
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.53
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.53
KOG2337669 consensus Ubiquitin activating E1 enzyme-like prot 99.52
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.52
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.5
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.49
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.48
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.48
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.43
COG1054308 Predicted sulfurtransferase [General function pred 99.24
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.23
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.13
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 98.9
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 98.68
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 98.57
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.49
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 97.98
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.98
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 97.9
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.87
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.8
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.76
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.72
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.64
PRK06719157 precorrin-2 dehydrogenase; Validated 97.52
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.39
PRK05562223 precorrin-2 dehydrogenase; Provisional 97.22
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.12
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.08
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.05
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.96
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.95
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.82
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.82
COG2603 334 Predicted ATPase [General function prediction only 96.82
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.81
PRK13940414 glutamyl-tRNA reductase; Provisional 96.79
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 96.74
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.7
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.68
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.66
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.66
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.65
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.59
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.55
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.52
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.42
PLN02928347 oxidoreductase family protein 96.41
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.35
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.35
PRK07574385 formate dehydrogenase; Provisional 96.35
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 96.31
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.31
PLN02494477 adenosylhomocysteinase 96.31
PRK06487317 glycerate dehydrogenase; Provisional 96.3
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 96.27
PRK06932314 glycerate dehydrogenase; Provisional 96.22
PRK06436303 glycerate dehydrogenase; Provisional 96.22
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.22
PRK10637 457 cysG siroheme synthase; Provisional 96.21
PRK00048257 dihydrodipicolinate reductase; Provisional 96.18
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.15
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.09
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.08
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.03
PRK13403335 ketol-acid reductoisomerase; Provisional 96.01
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.99
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 95.94
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.94
PLN00203519 glutamyl-tRNA reductase 95.93
PRK13243333 glyoxylate reductase; Reviewed 95.89
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 95.88
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 95.88
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 95.87
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.85
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 95.83
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 95.8
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.65
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 95.62
PRK04148134 hypothetical protein; Provisional 95.61
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 95.6
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.45
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.44
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.43
PTZ00117319 malate dehydrogenase; Provisional 95.43
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.36
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 95.35
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.34
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 95.33
PRK11908347 NAD-dependent epimerase/dehydratase family protein 95.33
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 95.2
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.19
PRK12480330 D-lactate dehydrogenase; Provisional 95.15
PF1008797 DUF2325: Uncharacterized protein conserved in bact 95.15
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.13
TIGR00036266 dapB dihydrodipicolinate reductase. 95.12
PRK13529563 malate dehydrogenase; Provisional 95.11
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.1
PRK05479330 ketol-acid reductoisomerase; Provisional 95.1
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.09
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 95.08
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 95.05
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 95.04
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.04
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 95.03
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.01
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 94.97
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.97
PRK08229341 2-dehydropantoate 2-reductase; Provisional 94.96
PTZ00075476 Adenosylhomocysteinase; Provisional 94.93
PLN02427386 UDP-apiose/xylose synthase 94.92
PLN03139386 formate dehydrogenase; Provisional 94.92
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 94.91
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 94.88
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 94.78
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 94.77
PRK14982340 acyl-ACP reductase; Provisional 94.75
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.74
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.73
PLN02306386 hydroxypyruvate reductase 94.71
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 94.7
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 94.67
PRK07502307 cyclohexadienyl dehydrogenase; Validated 94.64
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 94.63
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 94.62
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 94.6
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.6
KOG1093725 consensus Predicted protein kinase (contains TBC a 94.59
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 94.57
PRK07680273 late competence protein ComER; Validated 94.54
PLN03129581 NADP-dependent malic enzyme; Provisional 94.53
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.49
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.48
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.46
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.4
PRK12862 763 malic enzyme; Reviewed 94.36
PRK08618325 ornithine cyclodeaminase; Validated 94.32
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.31
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 94.3
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.27
PTZ00325321 malate dehydrogenase; Provisional 94.22
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.22
PLN00106323 malate dehydrogenase 94.21
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 94.19
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 94.17
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 94.16
PRK08374336 homoserine dehydrogenase; Provisional 94.14
PRK09496453 trkA potassium transporter peripheral membrane com 94.1
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 94.09
PLN02712667 arogenate dehydrogenase 94.06
PTZ00317559 NADP-dependent malic enzyme; Provisional 93.97
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 93.96
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.94
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 93.93
PRK03562621 glutathione-regulated potassium-efflux system prot 93.93
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 93.91
PRK06223307 malate dehydrogenase; Reviewed 93.9
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.88
PLN02206442 UDP-glucuronate decarboxylase 93.86
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 93.84
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.82
PRK13304265 L-aspartate dehydrogenase; Reviewed 93.81
PRK06270341 homoserine dehydrogenase; Provisional 93.79
PRK12921305 2-dehydropantoate 2-reductase; Provisional 93.79
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 93.78
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.77
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 93.76
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 93.75
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.7
PRK05225 487 ketol-acid reductoisomerase; Validated 93.69
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 93.67
PLN02166436 dTDP-glucose 4,6-dehydratase 93.63
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.6
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.59
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.57
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 93.54
PLN02602350 lactate dehydrogenase 93.53
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 93.52
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.5
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 93.43
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 93.43
PTZ00082321 L-lactate dehydrogenase; Provisional 93.41
PRK12861 764 malic enzyme; Reviewed 93.41
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 93.36
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.33
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.31
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 93.3
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.29
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 93.28
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 93.27
PRK13302271 putative L-aspartate dehydrogenase; Provisional 93.23
PRK08605332 D-lactate dehydrogenase; Validated 93.23
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.19
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 93.12
PRK06197306 short chain dehydrogenase; Provisional 93.09
PRK06545359 prephenate dehydrogenase; Validated 93.06
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 93.03
PTZ00431260 pyrroline carboxylate reductase; Provisional 93.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 92.98
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 92.97
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 92.96
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 92.92
PRK12367245 short chain dehydrogenase; Provisional 92.89
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.87
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 92.86
PRK13303265 L-aspartate dehydrogenase; Provisional 92.83
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 92.8
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.79
COG0281432 SfcA Malic enzyme [Energy production and conversio 92.67
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.64
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 92.64
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 92.6
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.54
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 92.53
PRK03659601 glutathione-regulated potassium-efflux system prot 92.5
PLN02688266 pyrroline-5-carboxylate reductase 92.47
PRK08818370 prephenate dehydrogenase; Provisional 92.41
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.39
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 92.37
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.36
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 92.36
PLN02572442 UDP-sulfoquinovose synthase 92.34
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 92.32
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 92.3
PRK08264238 short chain dehydrogenase; Validated 92.28
PRK07417279 arogenate dehydrogenase; Reviewed 92.18
PRK09496 453 trkA potassium transporter peripheral membrane com 92.16
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.15
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 92.14
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.13
CHL00194317 ycf39 Ycf39; Provisional 92.12
PRK05875276 short chain dehydrogenase; Provisional 92.08
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.06
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 92.04
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 92.02
PRK09242257 tropinone reductase; Provisional 92.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 92.0
PLN02253280 xanthoxin dehydrogenase 91.99
PRK13301267 putative L-aspartate dehydrogenase; Provisional 91.98
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 91.98
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 91.9
PLN02256304 arogenate dehydrogenase 91.87
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 91.84
PRK08291330 ectoine utilization protein EutC; Validated 91.83
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.8
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 91.77
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 91.75
PRK07774250 short chain dehydrogenase; Provisional 91.72
PRK06194287 hypothetical protein; Provisional 91.67
PRK10669558 putative cation:proton antiport protein; Provision 91.5
PRK07063260 short chain dehydrogenase; Provisional 91.48
PRK06141314 ornithine cyclodeaminase; Validated 91.47
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 91.46
PRK06125259 short chain dehydrogenase; Provisional 91.37
PRK05872296 short chain dehydrogenase; Provisional 91.37
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 91.36
PRK06139330 short chain dehydrogenase; Provisional 91.31
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.25
PLN03209 576 translocon at the inner envelope of chloroplast su 91.2
PRK10537393 voltage-gated potassium channel; Provisional 91.19
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 91.18
PLN02653340 GDP-mannose 4,6-dehydratase 91.16
PRK05866293 short chain dehydrogenase; Provisional 91.16
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 91.15
PRK07523255 gluconate 5-dehydrogenase; Provisional 91.15
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 91.15
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.13
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 91.12
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 91.05
PLN00016378 RNA-binding protein; Provisional 91.05
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 91.04
PRK08277278 D-mannonate oxidoreductase; Provisional 90.98
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 90.96
PRK07340304 ornithine cyclodeaminase; Validated 90.96
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.95
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 90.91
PLN02740381 Alcohol dehydrogenase-like 90.84
PRK08265261 short chain dehydrogenase; Provisional 90.84
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 90.8
PRK06138252 short chain dehydrogenase; Provisional 90.77
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 90.77
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 90.72
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 90.7
PLN02214342 cinnamoyl-CoA reductase 90.66
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 90.66
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.63
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.59
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 90.59
PLN02240352 UDP-glucose 4-epimerase 90.58
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 90.57
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 90.57
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 90.56
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.55
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 90.53
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 90.52
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 90.45
PRK08251248 short chain dehydrogenase; Provisional 90.44
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 90.43
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 90.43
PLN00198338 anthocyanidin reductase; Provisional 90.38
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 90.32
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 90.32
PRK07062265 short chain dehydrogenase; Provisional 90.31
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 90.31
PRK06198260 short chain dehydrogenase; Provisional 90.29
PRK07060245 short chain dehydrogenase; Provisional 90.28
PRK05867253 short chain dehydrogenase; Provisional 90.27
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 90.25
PLN02260 668 probable rhamnose biosynthetic enzyme 90.24
PRK12320 699 hypothetical protein; Provisional 90.23
PF11336514 DUF3138: Protein of unknown function (DUF3138); In 90.2
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.18
PLN02896353 cinnamyl-alcohol dehydrogenase 90.18
PRK08655437 prephenate dehydrogenase; Provisional 90.17
PRK07067257 sorbitol dehydrogenase; Provisional 90.14
PRK06392326 homoserine dehydrogenase; Provisional 90.13
PRK12939250 short chain dehydrogenase; Provisional 90.1
PRK08589272 short chain dehydrogenase; Validated 90.1
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 90.09
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 90.08
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 90.03
PRK06500249 short chain dehydrogenase; Provisional 90.01
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.0
PRK12771564 putative glutamate synthase (NADPH) small subunit; 89.96
PTZ00188506 adrenodoxin reductase; Provisional 89.95
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 89.92
PRK06949258 short chain dehydrogenase; Provisional 89.91
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.88
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 89.86
PRK11259376 solA N-methyltryptophan oxidase; Provisional 89.85
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.81
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 89.79
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 89.79
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 89.77
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 89.76
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 89.72
PRK07814263 short chain dehydrogenase; Provisional 89.72
PRK11730715 fadB multifunctional fatty acid oxidation complex 89.71
KOG0409327 consensus Predicted dehydrogenase [General functio 89.7
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 89.65
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 89.62
PRK08213259 gluconate 5-dehydrogenase; Provisional 89.6
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 89.58
PRK06349426 homoserine dehydrogenase; Provisional 89.56
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.54
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 89.54
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 89.53
PRK12829264 short chain dehydrogenase; Provisional 89.52
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 89.5
PRK15059292 tartronate semialdehyde reductase; Provisional 89.45
PRK05086312 malate dehydrogenase; Provisional 89.41
PRK05854313 short chain dehydrogenase; Provisional 89.41
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 89.4
PRK07109334 short chain dehydrogenase; Provisional 89.39
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 89.37
PRK07035252 short chain dehydrogenase; Provisional 89.36
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 89.36
PRK07478254 short chain dehydrogenase; Provisional 89.35
PRK07326237 short chain dehydrogenase; Provisional 89.32
PRK07576264 short chain dehydrogenase; Provisional 89.24
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 89.2
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 89.12
PRK07856252 short chain dehydrogenase; Provisional 89.11
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 89.11
KOG3636 669 consensus Uncharacterized conserved protein, conta 89.07
PRK12744257 short chain dehydrogenase; Provisional 89.07
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 88.96
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 88.96
PRK12828239 short chain dehydrogenase; Provisional 88.94
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 88.94
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 88.93
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 88.91
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 88.79
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 88.76
PRK06398258 aldose dehydrogenase; Validated 88.76
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 88.73
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 88.71
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.7
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 88.69
PRK11154708 fadJ multifunctional fatty acid oxidation complex 88.68
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 88.66
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 88.62
PRK08226263 short chain dehydrogenase; Provisional 88.62
PRK05717255 oxidoreductase; Validated 88.59
PRK08085254 gluconate 5-dehydrogenase; Provisional 88.56
PRK07831262 short chain dehydrogenase; Provisional 88.53
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 88.53
PLN02702364 L-idonate 5-dehydrogenase 88.52
PLN02353 473 probable UDP-glucose 6-dehydrogenase 88.46
PRK07890258 short chain dehydrogenase; Provisional 88.46
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 88.46
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 88.44
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 88.39
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 88.39
PLN02586360 probable cinnamyl alcohol dehydrogenase 88.35
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 88.34
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 88.33
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 88.29
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.29
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 88.27
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 88.26
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 88.26
PRK10675338 UDP-galactose-4-epimerase; Provisional 88.25
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 88.23
PRK05876275 short chain dehydrogenase; Provisional 88.2
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 88.19
PLN02852 491 ferredoxin-NADP+ reductase 88.17
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.15
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-99  Score=714.57  Aligned_cols=369  Identities=56%  Similarity=0.992  Sum_probs=348.2

Q ss_pred             CCCCCCCHHHHhhhhccccCCCCCHHHHHhhhcCcEEEECCCccHHHHHHHHHHcCCCcEEEeeCCccccccccc-----
Q 013384           61 AVDYGLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHR-----  135 (444)
Q Consensus        61 ~~~~~l~~~~~~ry~Rq~~l~~~g~~~q~~L~~~~VlIvG~GglGs~ia~~La~~Gvg~i~lvD~D~V~~sNl~R-----  135 (444)
                      .+...||.+|+.||+|||++|+||..||.+|++++|+||||||+||+++.||+.+|||+|+|||+|.||.|||||     
T Consensus        34 ~~~~~Ls~dei~RYsRQlilpe~gV~GQ~~Lk~s~VLVVGaGGLGcPa~~YLaaaGvG~lGiVD~DvVe~sNlhRQVlh~  113 (427)
T KOG2017|consen   34 SREAGLSLDEILRYSRQLILPEFGVHGQLSLKNSSVLVVGAGGLGCPAAQYLAAAGVGRLGIVDYDVVELSNLHRQVLHT  113 (427)
T ss_pred             ccccCCCHHHHHhhhheeeccccccccccccCCccEEEEccCCCCCHHHHHHHHcCCCeecccccceeehhhHHHHHhhh
Confidence            446689999999999999999999999999999999999999999999999999999999999999999999999     


Q ss_pred             ------------------ccCcceEEEEeecCCcccHHhhcCCCcEEEEccCChHhHHHHHHHHHHcCCcEEEEcccCCc
Q 013384          136 ------------------INSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLE  197 (444)
Q Consensus       136 ------------------lnp~~~v~~~~~~~~~~~~~~~~~~~DvVi~~~D~~~~r~~i~~~~~~~~~p~i~~~~~g~~  197 (444)
                                        +||+++|..|++.++++|+++++++||+|+|||||+++||+|+|+|+..|+|+|++++++|+
T Consensus       114 ea~vg~~Ka~sA~~~lr~lNs~v~v~~y~~~L~~sNa~~Ii~~YdvVlDCTDN~~TRYLisD~CVlLgkpLVSgSaLr~E  193 (427)
T KOG2017|consen  114 EARVGMHKAESAAAFLRRLNSHVEVQTYNEFLSSSNAFDIIKQYDVVLDCTDNVPTRYLISDVCVLLGKPLVSGSALRWE  193 (427)
T ss_pred             hhhhhhHHHHHHHHHHHhcCCCceeeechhhccchhHHHHhhccceEEEcCCCccchhhhhhHHHHcCCccccccccccc
Confidence                              89999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEEEeCCCCCceeecCCCCCCCccCCcccCCCcccchhHHHHHHHHHHHHHHHhcCCCCCCCceeEeecCCCeEEEEE
Q 013384          198 GQLTVYNYNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVK  277 (444)
Q Consensus       198 G~l~~~~~~~~~C~~C~~~~~~~~~~~~~c~~~~~~~~~~~i~g~l~a~e~lk~l~g~~~~~~~~~~~~d~~~~~~~~~~  277 (444)
                      ||++++++..+|||||+||++|+++++++|.++|++||+++++|+|||+|++|+++|..+++.++++.||+++..|+.++
T Consensus       194 GQLtvYny~~GPCYRClFP~Ppp~~~vt~C~dgGVlGpv~GviG~mQALE~iKli~~~~~~~s~~lllfdg~~~~~r~ir  273 (427)
T KOG2017|consen  194 GQLTVYNYNNGPCYRCLFPNPPPPEAVTNCADGGVLGPVTGVIGCMQALETIKLIAGIGESLSGRLLLFDGLSGHFRTIR  273 (427)
T ss_pred             ceeEEeecCCCceeeecCCCCcChHHhcccccCceeecchhhhhHHHHHHHHHHHHccCccCCcceEEEecccceeEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccCCCCCccCCCCcccccccccccccccccCCCCCcccccccCCCCCccCHHHHHHHHhcCCCcEEEEecCccccccc
Q 013384          278 IRGRSSQCEACGENSTFTQDHFRNFDYEKFTQSPLSTLPLKLNLLSADSRISSKEYKEKVVNGEAHILVDVRPAHHFRIV  357 (444)
Q Consensus       278 ~~~r~~~C~~Cg~~~~~~~~~i~~~dy~~fcg~~~~~~~~~~~~l~~~~~Is~~el~~~l~~~~~~~lIDVR~~~ef~~g  357 (444)
                      +|+|+++|.+||+++++|..    +||+.|||++++..+ ++++|++.+|||+.||++++++++.+++||||++.||+++
T Consensus       274 lR~r~~~C~~Cg~n~tit~~----~dYe~fCg~~~~~~~-~l~lL~~~~Rvsv~d~k~il~~~~~h~llDvRp~~~~eI~  348 (427)
T KOG2017|consen  274 LRSRRPKCAVCGKNPTITSL----IDYELFCGSSATDKC-PLKLLEPDERVSVTDYKRILDSGAKHLLLDVRPSHEYEIC  348 (427)
T ss_pred             eccCCCCCcccCCCCccCcc----cchhcccCCcccccc-chhcCChhhcccHHHHHHHHhcCCCeEEEeccCcceEEEE
Confidence            99999999999999999977    999999999988545 8999999999999999999999888999999999999999


Q ss_pred             CCCCceecCchhhhhhhh-hhHHHhhhhhhhcCCCCCCCCeEEEEcCCChhHHHHHHHHHHcCC-CCEEEccccHHHHhh
Q 013384          358 SLPNSINIPLSDLESRLP-EISSAMKEKEEHRGSNASSGSNLYVVCRRGNDSQRAVQALHKLGF-TSARDIIGGLESWAN  435 (444)
Q Consensus       358 hIpgAiniP~~~l~~~~~-~l~~~~~~~~~~~~~~~~~~~~Ivv~C~~G~~S~~aa~~L~~~G~-~~v~~l~GG~~aW~~  435 (444)
                      |+|+|+|||+.++..... ++.+.          ..+..++|+|+|+.||+||+|++.|++... .+|.++.||+.+|..
T Consensus       349 ~lP~avNIPL~~l~~~~~~~~~~~----------~~~~~~~I~ViCrrGNdSQ~Av~~Lre~~~~~~vrDvigGl~~w~~  418 (427)
T KOG2017|consen  349 RLPEAVNIPLKELRSRSGKKLQGD----------LNTESKDIFVICRRGNDSQRAVRILREKFPDSSVRDVIGGLKAWAA  418 (427)
T ss_pred             ecccccccchhhhhhhhhhhhccc----------ccccCCCEEEEeCCCCchHHHHHHHHhhCCchhhhhhhhHHHHHHH
Confidence            999999999999876543 11111          113347899999999999999999997644 468899999999999


Q ss_pred             CcCCCCCCC
Q 013384          436 DVDPSFPVY  444 (444)
Q Consensus       436 ~~~p~~P~Y  444 (444)
                      +++|+||.|
T Consensus       419 ~vd~~fP~Y  427 (427)
T KOG2017|consen  419 KVDPNFPLY  427 (427)
T ss_pred             hcCcCCCCC
Confidence            999999998

>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PF11336 DUF3138: Protein of unknown function (DUF3138); InterPro: IPR021485 This family of proteins with unknown function appear to be restricted to Proteobacteria Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
1jwb_B249 Structure Of The Covalent Acyl-Adenylate Form Of Th 4e-38
1zud_1251 Structure Of This-Thif Protein Complex Length = 251 1e-31
1zfn_A253 Structural Analysis Of Escherichia Coli Thif Length 1e-31
3i2v_A127 Crystal Structure Of Human Mocs3 Rhodanese-Like Dom 1e-20
1y8q_B 640 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 2e-08
3kyc_B 660 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 2e-08
3kyd_B 551 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 3e-08
3gk5_A108 Crystal Structure Of Rhodanese-Related Protein (Tvg 2e-05
4ii2_A 1001 Crystal Structure Of Ubiquitin Activating Enzyme 1 2e-05
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 7e-05
2nvu_B805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-04
3cmm_A 1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 2e-04
3h5a_A358 Crystal Structure Of E. Coli Mccb Length = 358 2e-04
3h5n_B353 Crystal Structure Of E. Coli Mccb + Atp Length = 35 2e-04
3gzn_B463 Structure Of Nedd8-Activating Enzyme In Complex Wit 2e-04
1tt5_B434 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 2e-04
1yov_B444 Insights Into The Ubiquitin Transfer Cascade From T 2e-04
3dbh_B434 Structural Dissection Of A Gating Mechanism Prevent 4e-04
3dbr_B434 Structural Dissection Of A Gating Mechanism Prevent 4e-04
1r4m_B431 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 5e-04
3dbl_B434 Structural Dissection Of A Gating Mechanism Prevent 5e-04
>pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 Back     alignment and structure 
Iteration: 1

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 141/252 (55%), Gaps = 33/252 (13%)
Query: 66  LSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDH 125
           LS   + RY+R ++L  F  +GQ  L  S +L++G GGLG  A  YLA+ GVG L ++D 
Sbjct: 4   LSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDF 63
Query: 126 DVVELNNMH-----------------------RINSTVHIIEHREALRTSNALEILSQYE 162
           D V L+N+                        RIN  + I      L  +    ++++++
Sbjct: 64  DTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHD 123
Query: 163 IVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNY-NGGPCYRC---LFPTP 218
           +V+D TDN   R  ++  C     PLVSGAA+ +EGQ+TV+ Y +G PCYRC   LF   
Sbjct: 124 LVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEN 183
Query: 219 PPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKI 278
             T     C ++GV+  + G+IG LQA+EAIK+ +  G+P SG+++++DA++ + R +K+
Sbjct: 184 ALT-----CVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKL 238
Query: 279 RGRSSQCEACGE 290
             R+  CE CG+
Sbjct: 239 M-RNPGCEVCGQ 249
>pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 Back     alignment and structure
>pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 Back     alignment and structure
>pdb|3I2V|A Chain A, Crystal Structure Of Human Mocs3 Rhodanese-Like Domain Length = 127 Back     alignment and structure
>pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 Back     alignment and structure
>pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 Back     alignment and structure
>pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 Back     alignment and structure
>pdb|3GK5|A Chain A, Crystal Structure Of Rhodanese-Related Protein (Tvg0868615) From Thermoplasma Volcanium, Northeast Structural Genomics Consortium Target Tvr109a Length = 108 Back     alignment and structure
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 Back     alignment and structure
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure
>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure
>pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 Back     alignment and structure
>pdb|3H5N|B Chain B, Crystal Structure Of E. Coli Mccb + Atp Length = 353 Back     alignment and structure
>pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 Back     alignment and structure
>pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 Back     alignment and structure
>pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 Back     alignment and structure
>pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 Back     alignment and structure
>pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 1e-124
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 1e-120
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 1e-106
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 2e-95
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 1e-85
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 3e-81
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 2e-46
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 8e-46
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 7e-45
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 3e-43
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 1e-24
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 2e-18
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 5e-24
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 4e-22
3foj_A100 Uncharacterized protein; protein SSP1007, structur 3e-21
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 2e-20
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 2e-20
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 2e-19
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 3e-19
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 4e-19
1tq1_A129 AT5G66040, senescence-associated family protein; C 6e-19
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 7e-19
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 2e-17
2jtq_A85 Phage shock protein E; solution structure rhodanes 1e-16
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 2e-16
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 6e-16
1vee_A134 Proline-rich protein family; hypothetical protein, 6e-16
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-15
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-11
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-10
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-06
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 1e-14
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 2e-14
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-14
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 3e-12
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-11
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 3e-11
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 6e-11
3r2u_A466 Metallo-beta-lactamase family protein; structural 8e-11
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 7e-10
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 3e-07
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 2e-04
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 2e-04
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 6e-04
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
 Score =  360 bits (927), Expect = e-124
 Identities = 88/249 (35%), Positives = 139/249 (55%), Gaps = 27/249 (10%)

Query: 66  LSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDH 125
           LS   + RY+R ++L  F  +GQ  L  S +L++G GGLG  A  YLA+ GVG L ++D 
Sbjct: 4   LSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDF 63

Query: 126 DVVELNNMHR-----------------------INSTVHIIEHREALRTSNALEILSQYE 162
           D V L+N+ R                       IN  + I      L  +    ++++++
Sbjct: 64  DTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHD 123

Query: 163 IVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNY-NGGPCYRCLFPTPPPT 221
           +V+D TDN   R  ++  C     PLVSGAA+ +EGQ+TV+ Y +G PCYRCL       
Sbjct: 124 LVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGE- 182

Query: 222 TACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGR 281
                C ++GV+  + G+IG LQA+EAIK+ +  G+P SG+++++DA++ + R +K+  R
Sbjct: 183 -NALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLM-R 240

Query: 282 SSQCEACGE 290
           +  CE CG+
Sbjct: 241 NPGCEVCGQ 249
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 100.0
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 100.0
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 100.0
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 99.97
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.96
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.94
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.89
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.89
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.88
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.87
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.86
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.85
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.85
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.84
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.84
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.83
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.83
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.83
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.82
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.81
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.8
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.8
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.77
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.77
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.77
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.76
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.75
1vee_A134 Proline-rich protein family; hypothetical protein, 99.75
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.75
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.73
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.73
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.73
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.72
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.71
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.7
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.7
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.69
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.69
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.68
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.68
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.67
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.67
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.67
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.66
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.66
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.65
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.64
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.63
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.63
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.62
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.62
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.62
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.61
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.6
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.6
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.6
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.6
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.59
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.58
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.58
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.58
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.56
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.54
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.47
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.47
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.46
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.45
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.32
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.22
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.85
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.82
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.78
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.75
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.56
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.53
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.45
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.37
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 97.29
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.25
2f46_A156 Hypothetical protein; structural genomics, joint c 97.22
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.2
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 97.15
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.13
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.11
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.01
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.92
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.92
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.84
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.81
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.78
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.77
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.74
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.73
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.72
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.7
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.65
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 96.63
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.62
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.6
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.59
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.54
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.48
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.4
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.4
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.39
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.31
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.29
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.29
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.24
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.23
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.2
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.2
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.2
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.18
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.17
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.16
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.15
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.12
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 96.11
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.01
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 96.0
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.99
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 95.96
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.96
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 95.95
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.85
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.84
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 95.82
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.82
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 95.81
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.75
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.71
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.64
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.64
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.62
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.62
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 95.61
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.61
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.6
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 95.57
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 95.56
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.55
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 95.53
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 95.53
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.52
4g65_A 461 TRK system potassium uptake protein TRKA; structur 95.51
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.51
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 95.49
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.49
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 95.48
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 95.47
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.46
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.44
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 95.4
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.39
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.38
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 95.38
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 95.37
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.37
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 95.35
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.35
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 95.33
4ezb_A317 Uncharacterized conserved protein; structural geno 95.27
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.26
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 95.25
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.23
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.22
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 95.22
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 95.19
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.19
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 95.18
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 95.16
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 95.16
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 95.15
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.15
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 95.15
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.11
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.11
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 95.08
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 95.07
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 95.07
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.06
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 95.05
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 95.03
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.01
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 94.99
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 94.99
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.97
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.97
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 94.96
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 94.95
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 94.95
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 94.94
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 94.92
1yb4_A295 Tartronic semialdehyde reductase; structural genom 94.92
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 94.91
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 94.89
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.89
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.88
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 94.87
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 94.87
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 94.87
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 94.85
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.83
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 94.81
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.79
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.74
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 94.72
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 94.72
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 94.71
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 94.7
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.7
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.7
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.69
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 94.67
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.67
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 94.67
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.66
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.66
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.65
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 94.65
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 94.61
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 94.59
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 94.58
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 94.58
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 94.57
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.57
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.56
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.54
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 94.52
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.52
1vpd_A299 Tartronate semialdehyde reductase; structural geno 94.49
3l6d_A306 Putative oxidoreductase; structural genomics, prot 94.49
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 94.47
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.47
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 94.44
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.42
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.41
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.37
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 94.35
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 94.32
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.3
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 94.3
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 94.3
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 94.28
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 94.27
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 94.25
3p2o_A285 Bifunctional protein fold; structural genomics, ce 94.24
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 94.23
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 94.2
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 94.14
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.14
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 94.14
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 94.14
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 94.13
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.09
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.09
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.08
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 94.07
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 94.05
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 94.05
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.05
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 94.04
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 94.04
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 94.0
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 93.96
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 93.93
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 93.92
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 93.9
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 93.89
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 93.88
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 93.87
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 93.87
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 93.84
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 93.83
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.8
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 93.79
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 93.77
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 93.76
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.75
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 93.74
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 93.73
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.72
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.71
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.7
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 93.68
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 93.67
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 93.64
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 93.62
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 93.6
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 93.59
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 93.58
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 93.56
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 93.55
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 93.54
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 93.54
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 93.51
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 93.5
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 92.6
1xq6_A253 Unknown protein; structural genomics, protein stru 93.47
4gx0_A565 TRKA domain protein; membrane protein, ION channel 93.46
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 93.46
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 93.45
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 93.45
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 93.44
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.43
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 93.41
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.41
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 93.39
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 93.38
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 93.36
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 93.33
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.32
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 93.29
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 93.28
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 93.26
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 93.25
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 93.23
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 93.22
3euw_A344 MYO-inositol dehydrogenase; protein structure init 93.18
2wm3_A299 NMRA-like family domain containing protein 1; unkn 93.17
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 93.15
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 93.13
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.13
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.12
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 93.07
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 93.04
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 93.04
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 93.03
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 93.0
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 92.99
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 92.96
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 92.94
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.9
2duw_A145 Putative COA-binding protein; ligand binding prote 92.88
3rih_A293 Short chain dehydrogenase or reductase; structural 92.86
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 92.85
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.84
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 92.83
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 92.81
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 92.8
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 92.79
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 92.78
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 92.78
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 92.76
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 92.76
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 92.75
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.64
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.63
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 92.62
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 92.62
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 92.61
3e03_A274 Short chain dehydrogenase; structural genomics, PS 92.61
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 92.6
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 92.57
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 92.56
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 92.54
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 92.53
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 92.52
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 92.5
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 92.5
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 92.44
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 92.44
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 92.43
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 92.42
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 92.42
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 92.4
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.36
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 92.29
3imf_A257 Short chain dehydrogenase; structural genomics, in 92.24
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 92.23
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 92.23
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 92.23
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.22
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 92.21
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 92.19
1lnq_A336 MTHK channels, potassium channel related protein; 92.18
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 92.16
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 92.16
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 92.1
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 92.08
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 92.06
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 92.05
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 92.05
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.04
4hb9_A412 Similarities with probable monooxygenase; flavin, 92.04
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 92.01
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.01
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 92.01
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 92.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 91.99
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 91.99
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 91.97
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 91.96
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 91.95
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 91.94
1v8c_A168 MOAD related protein; riken structural genomics/pr 91.94
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 91.93
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 91.93
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 91.91
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 91.91
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 91.9
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 91.88
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 91.88
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 91.84
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 91.82
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 91.82
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 91.81
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 91.81
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 91.8
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 91.79
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 91.75
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 91.69
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 91.68
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 91.67
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 91.67
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 91.65
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 91.65
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 91.62
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 91.61
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 91.61
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 91.59
3tox_A280 Short chain dehydrogenase; structural genomics, PS 91.56
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 91.55
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.55
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 91.54
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 91.54
4f6c_A427 AUSA reductase domain protein; thioester reductase 91.53
3tsc_A277 Putative oxidoreductase; structural genomics, seat 91.52
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.51
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 91.48
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 91.46
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 91.44
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 91.42
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 91.41
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 91.41
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 91.39
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 91.38
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 91.36
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 91.36
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 91.3
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 91.29
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 91.28
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 91.27
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 91.26
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 91.23
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 91.22
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 91.2
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 91.2
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 91.19
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 91.17
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 91.16
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 91.15
3tjr_A301 Short chain dehydrogenase; structural genomics, se 91.13
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 91.12
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 91.11
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 91.1
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 91.09
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 91.08
4eso_A255 Putative oxidoreductase; NADP, structural genomics 91.04
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 91.04
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 91.03
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 91.01
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 90.96
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 90.96
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 90.95
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 90.95
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.94
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 90.89
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.89
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 90.89
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 90.88
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 90.86
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 90.86
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 90.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 90.82
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 90.82
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 90.81
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 90.79
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 90.79
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 90.79
2ywl_A180 Thioredoxin reductase related protein; uncharacter 90.75
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 90.75
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 90.69
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.64
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 90.61
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 90.61
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 90.6
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 90.59
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 90.58
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 90.53
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
Probab=100.00  E-value=5.2e-49  Score=382.48  Aligned_cols=217  Identities=23%  Similarity=0.423  Sum_probs=173.0

Q ss_pred             hhhhccccCCCCCH-HHHHhhhcCcEEEECCCccHHHHHHHHHHcCCCcEEEeeCCccccccccc---------------
Q 013384           72 YRYSRHLLLPSFGV-EGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHR---------------  135 (444)
Q Consensus        72 ~ry~Rq~~l~~~g~-~~q~~L~~~~VlIvG~GglGs~ia~~La~~Gvg~i~lvD~D~V~~sNl~R---------------  135 (444)
                      --|+|||.|++||. ++|++|++++|+|||+||+||+++++|+++|||+|+|+|.|.|+.|||+|               
T Consensus        14 ~~y~r~i~L~~~G~~~~q~kL~~~~VlVvGaGGlGs~va~~La~aGVG~i~lvD~D~Ve~sNL~Rq~~~~~diG~~Ka~a   93 (292)
T 3h8v_A           14 LVPRGSMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQA   93 (292)
T ss_dssp             ------------------CGGGGCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBC------------CCTTSBHHHH
T ss_pred             CCchHhhcccccChHHHHHHHhCCeEEEECcCHHHHHHHHHHHHcCCCEEEEECCCccChhhcccccCChhhcCchHHHH
Confidence            57999999999998 99999999999999999999999999999999999999999999999999               


Q ss_pred             -------ccCcceEEEEeecCCc-ccHHhhc-----------CCCcEEEEccCChHhHHHHHHHHHHcCCcEEEEcccC-
Q 013384          136 -------INSTVHIIEHREALRT-SNALEIL-----------SQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALG-  195 (444)
Q Consensus       136 -------lnp~~~v~~~~~~~~~-~~~~~~~-----------~~~DvVi~~~D~~~~r~~i~~~~~~~~~p~i~~~~~g-  195 (444)
                             +||+++|+.+...++. ++..+++           +++|+||||+||+++|++||++|++.++|||++++.+ 
T Consensus        94 a~~~L~~iNP~v~v~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~DlVid~~Dn~~~R~~in~~c~~~~~Pli~~gv~~~  173 (292)
T 3h8v_A           94 AEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN  173 (292)
T ss_dssp             HHHHHHHHCTTSEEEEECCCTTSHHHHHHHHHHHHHBSSSTTBCCSEEEECCSSHHHHHHHHHHHHHHTCCEEEEEECTT
T ss_pred             HHHHHHhhCCCcEEEEecccCCcHHHHHHHhhhhcccccccCCCCCEEEECCcchhhhhHHHHHHHHhCCCEEEeeeecc
Confidence                   8999999999999986 5555554           6899999999999999999999999999999998875 


Q ss_pred             -CcceEEEEeCCCCCceeecCCCCCCCc-cCCcccCCCc----ccchhHHHHHHHHHHHHHHHhcCCCCCCCceeEeecC
Q 013384          196 -LEGQLTVYNYNGGPCYRCLFPTPPPTT-ACQRCADSGV----LGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDAL  269 (444)
Q Consensus       196 -~~G~l~~~~~~~~~C~~C~~~~~~~~~-~~~~c~~~~~----~~~~~~i~g~l~a~e~lk~l~g~~~~~~~~~~~~d~~  269 (444)
                       +.||+.++.|+.+|||+|+||..++.. ....|...|+    ++|+++++|+|||.||||+|+|.+++  ++++.||+.
T Consensus       174 ~~~Gqv~~~~pg~t~Cy~Cl~p~~~~~~~~~~~~~~~gvc~~~l~~~~g~vgslqA~EalK~L~g~g~~--~~ll~~D~~  251 (292)
T 3h8v_A          174 AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTV--SFYLGYNAM  251 (292)
T ss_dssp             SSEEEEEEECTTTSCCTTSSSCCCCCCC-------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSCC--CSEEEEETT
T ss_pred             eeEEEEEEECCCCCCCHhhcCCccccccccccchhhcCcccCCcchHHHHHHHHHHHHHHHHHhCCCCC--CeEEEEECC
Confidence             899999999999999999999765432 2356777776    89999999999999999999999876  789999999


Q ss_pred             CCeEEEEEeeccCCCCC--ccCCC
Q 013384          270 SARIRIVKIRGRSSQCE--ACGEN  291 (444)
Q Consensus       270 ~~~~~~~~~~~r~~~C~--~Cg~~  291 (444)
                      +++|++++++ |+|+||  +||++
T Consensus       252 ~~~~~~~~~~-~~p~C~~~~Cg~~  274 (292)
T 3h8v_A          252 QDFFPTMSMK-PNPQCDDRNCRKQ  274 (292)
T ss_dssp             TTBCCEECCC-CCTTCSCHHHHHH
T ss_pred             CCcEEEEecC-CCcCcCccccCCc
Confidence            9999999998 999999  99964
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 444
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 4e-52
d1yova1 529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 2e-44
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 1e-40
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 4e-09
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 5e-12
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 3e-10
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 2e-08
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 6e-08
d1rhsa2144 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ 2e-07
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 2e-07
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 7e-07
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 3e-06
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 1e-05
d1t2da1150 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p 2e-05
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 3e-05
d1uara2141 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th 2e-04
d1urha2120 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran 4e-04
d1okga2139 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran 5e-04
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 8e-04
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 0.001
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 0.001
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Molybdenum cofactor biosynthesis protein MoeB
domain: Molybdenum cofactor biosynthesis protein MoeB
species: Escherichia coli [TaxId: 562]

 Score =  174 bits (440), Expect = 4e-52
 Identities = 87/248 (35%), Positives = 136/248 (54%), Gaps = 27/248 (10%)

Query: 66  LSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDH 125
           LS   + RY+R ++L  F  +GQ  L  S +L++G GGLG  A  YLA+ GVG L ++D 
Sbjct: 3   LSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDF 62

Query: 126 DVVEL-----------------------NNMHRINSTVHIIEHREALRTSNALEILSQYE 162
           D V L                       + + RIN  + I      L  +    ++++++
Sbjct: 63  DTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHD 122

Query: 163 IVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYNGG-PCYRCLFPTPPPT 221
           +V+D TDN   R  ++  C     PLVSGAA+ +EGQ+TV+ Y  G PCYRCL       
Sbjct: 123 LVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEN 182

Query: 222 TACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRGR 281
                C ++GV+  + G+IG LQA+EAIK+ +  G+P SG+++++DA++ + R +K+  R
Sbjct: 183 --ALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLM-R 239

Query: 282 SSQCEACG 289
           +  CE CG
Sbjct: 240 NPGCEVCG 247
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 99.93
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.86
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.86
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.84
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.82
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.82
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.8
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.8
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.73
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.71
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.71
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.7
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.7
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.7
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.59
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.58
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.53
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.38
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.89
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.81
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.59
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.55
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.47
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.44
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.4
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.29
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.23
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.15
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.06
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.98
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.94
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.93
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.86
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.7
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.7
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.68
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.67
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.59
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.56
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.54
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.53
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.4
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.39
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.35
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.33
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.28
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.28
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.23
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.1
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.03
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.03
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.01
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.01
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.0
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.92
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.9
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.89
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.86
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.85
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.8
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.8
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.78
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.72
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.71
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.71
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 95.71
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.7
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.61
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.51
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.46
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.44
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.37
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.36
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.3
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.24
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.22
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 95.15
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 95.15
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.11
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.06
d1yova1529 Amyloid beta precursor protein-binding protein 1, 95.04
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.04
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.98
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.96
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.95
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.91
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.9
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.89
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.86
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.77
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.73
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 94.71
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.68
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.67
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 94.66
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.54
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 94.53
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 94.5
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.49
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.47
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.45
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 94.44
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.37
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 94.32
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 94.31
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.25
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.25
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.22
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.2
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 94.2
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 94.19
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 94.19
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.15
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 94.15
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.12
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 94.08
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.05
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.01
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.0
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.96
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 93.95
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.93
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.84
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 93.82
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 93.82
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 93.78
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 93.78
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.76
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 93.75
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 93.74
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.74
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.74
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.72
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 93.65
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.6
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 93.59
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.55
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.54
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.52
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 93.51
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 93.47
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 93.46
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 93.39
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.34
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.32
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 93.29
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 93.28
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.24
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 93.14
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.01
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 92.99
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.98
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.9
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.88
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.84
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.74
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 92.74
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 92.64
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.58
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.54
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 92.52
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 92.47
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.46
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.42
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.39
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 92.38
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 92.31
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 92.29
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 92.25
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 92.23
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 92.23
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.2
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.17
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.12
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 92.09
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 92.06
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.03
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.02
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.9
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 91.86
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.82
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 91.71
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.67
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 91.59
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 91.55
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 91.54
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.53
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.46
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 91.45
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 91.4
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 91.35
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 91.23
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.22
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 91.2
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 91.16
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 91.09
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 91.07
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.06
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 91.06
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.04
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.99
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 90.94
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.94
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 90.93
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 90.93
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.89
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.87
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.81
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 90.7
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 90.66
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.6
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 90.59
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 90.42
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.4
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.34
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 90.29
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.25
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 90.22
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 90.17
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 90.16
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.13
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 90.01
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 89.99
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 89.97
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 89.93
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 89.91
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 89.75
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 89.73
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.67
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 89.65
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 89.57
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 89.54
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.54
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 89.45
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 89.37
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 89.29
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.17
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.1
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 88.94
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.89
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 88.87
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.75
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 88.74
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 88.68
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.62
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 88.55
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 88.5
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.46
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 88.44
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 88.41
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.17
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 88.1
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 87.99
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 87.98
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 87.96
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 87.93
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.89
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 87.74
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 87.72
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 87.63
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.6
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 87.49
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 87.49
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 87.47
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 87.44
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 87.44
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 87.38
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.17
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 86.98
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 86.87
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 86.86
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 86.68
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 86.56
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 86.33
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 86.25
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 86.2
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.11
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 86.04
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.93
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 85.82
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 85.78
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 85.78
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 85.53
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 85.49
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 85.42
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 85.42
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 85.36
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 85.23
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 85.11
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 84.84
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 84.5
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 84.22
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.13
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 83.72
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 83.66
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.48
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 83.3
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.02
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 82.78
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 82.32
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 82.28
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 81.87
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.81
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 81.61
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 81.48
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 81.07
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 80.67
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 80.02
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Molybdenum cofactor biosynthesis protein MoeB
domain: Molybdenum cofactor biosynthesis protein MoeB
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.4e-49  Score=378.29  Aligned_cols=222  Identities=39%  Similarity=0.752  Sum_probs=206.6

Q ss_pred             CCCHHHHhhhhccccCCCCCHHHHHhhhcCcEEEECCCccHHHHHHHHHHcCCCcEEEeeCCccccccccc---------
Q 013384           65 GLSPDMIYRYSRHLLLPSFGVEGQSNLLKSSILVIGAGGLGSPALLYLAACGVGRLGIVDHDVVELNNMHR---------  135 (444)
Q Consensus        65 ~l~~~~~~ry~Rq~~l~~~g~~~q~~L~~~~VlIvG~GglGs~ia~~La~~Gvg~i~lvD~D~V~~sNl~R---------  135 (444)
                      +||++|++||+||++|++||.++|++|++++|+|+|+||+||++|++|+++|||+|+|||+|.|++|||+|         
T Consensus         2 ~l~~~e~~ry~Rqi~l~~~g~~~Q~kL~~~~VliiG~GglGs~va~~La~~Gvg~i~lvD~D~Ve~sNL~RQ~l~~~~di   81 (247)
T d1jw9b_           2 ELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATV   81 (247)
T ss_dssp             CCCHHHHHHTHHHHTSTTTHHHHHHHHHHCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBCCGGGGGTCTTCCGGGT
T ss_pred             CCCHHHHHHhhceeccccCCHHHHHHHhCCCEEEECCCHHHHHHHHHHHHcCCCeEEEECCcccchhhhhhhccccHhhc
Confidence            69999999999999998899999999999999999999999999999999999999999999999999999         


Q ss_pred             --------------ccCcceEEEEeecCCcccHHhhcCCCcEEEEccCChHhHHHHHHHHHHcCCcEEEEcccCCcceEE
Q 013384          136 --------------INSTVHIIEHREALRTSNALEILSQYEIVVDATDNAPSRYMISDCCVVLGKPLVSGAALGLEGQLT  201 (444)
Q Consensus       136 --------------lnp~~~v~~~~~~~~~~~~~~~~~~~DvVi~~~D~~~~r~~i~~~~~~~~~p~i~~~~~g~~G~l~  201 (444)
                                    +||+++++.+...++.++...++..+|+||+|+|++..|+++|++|+++++|+|++++.++.|++.
T Consensus        82 G~~K~~~a~~~l~~~np~~~i~~~~~~~~~~~~~~~~~~~divid~~d~~~~~~~in~~~~~~~ip~i~g~~~~~~g~~~  161 (247)
T d1jw9b_          82 GQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQIT  161 (247)
T ss_dssp             TSBHHHHHHHHHHHHCTTSEEEEECSCCCHHHHHHHHHTSSEEEECCSSHHHHHHHHHHHHHHTCCEEEEEEEBTEEEEE
T ss_pred             CchHHHHHHHHHHHhhcccchhhhhhhhhhccccccccccceeeeccchhhhhhhHHHHHHHhCCCcccccccccccceE
Confidence                          899999999999999888888899999999999999999999999999999999999999999999


Q ss_pred             EEe-CCCCCceeecCCCCCCCccCCcccCCCcccchhHHHHHHHHHHHHHHHhcCCCCCCCceeEeecCCCeEEEEEeec
Q 013384          202 VYN-YNGGPCYRCLFPTPPPTTACQRCADSGVLGVVPGIIGCLQALEAIKVASAVGEPLSGRMLLFDALSARIRIVKIRG  280 (444)
Q Consensus       202 ~~~-~~~~~C~~C~~~~~~~~~~~~~c~~~~~~~~~~~i~g~l~a~e~lk~l~g~~~~~~~~~~~~d~~~~~~~~~~~~~  280 (444)
                      ++. ++.++|+.|+++..+...  .+|...|+++|+++++|+++|+|++|+|+|...++.++++.||+.+.+++.+++. 
T Consensus       162 ~~~~~~~~~c~~c~~~~~~~~~--~~~~~~g~~~p~~~~v~~~~a~e~ik~l~g~~~~~~~~~~~~d~~~~~~~~~~~~-  238 (247)
T d1jw9b_         162 VFTYQDGEPCYRCLSRLFGENA--LTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLM-  238 (247)
T ss_dssp             EECCCTTCCCTHHHHTTCCC---------CCBCHHHHHHHHHHHHHHHHHHHHTCSCCCBSEEEEEETTTTEEEEEECC-
T ss_pred             EEeecCCccccccccccccccc--CCcccCCcccccchhHHHHHHHHHHHHHhcCCCcCcCcEEEEECCCCEEEEEecC-
Confidence            886 578999999998776543  5788899999999999999999999999999998889999999999999999987 


Q ss_pred             cCCCCCccC
Q 013384          281 RSSQCEACG  289 (444)
Q Consensus       281 r~~~C~~Cg  289 (444)
                      |+|+||+||
T Consensus       239 ~~~~C~vCG  247 (247)
T d1jw9b_         239 RNPGCEVCG  247 (247)
T ss_dssp             CCTTCTTTC
T ss_pred             cCcCCCCCC
Confidence            999999998
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure