Citrus Sinensis ID: 013403

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MWDLGIATLYYLDLSNNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNLTSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNNISVEVDYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPLLESCNIDEAPEPVGSTRFDEEEDASSWFDWKFAKMGYGSGLVIGLSVGYMVFGTGKPRWLVRMIEKYQSNKEFYTHGMELSCRSQIITLQVQKLIFSLLFPIPNNILRLNLLLESLIKILREKII

ccccccccccEEEcccccccccccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHHHccccccccccccEEEEcccccccccEEEEEEEEEEccEEEEcEEcccEEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEHHHHHHHHHHccccHHHHHHHHHHHccEEEEEEEccHHcccccEEEEEHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc

ccEccccccEEEEcccccccccccccHccccccccccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccEEEEEcccccccccccccHHccccccEEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEccccccccccccHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHcccccEEEcccccHHccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHccccHccccHHHHHHHHHHHHHHHcc

MWDLGIATLYYLDLSnnfltnieyfpptnmtqlnfdsnlTHKVLDMRmnnfngkiprkfvkscnltslnlngnrlegplppslvnchhlevlnvgnnqindnfpnwLEILPELQVLILRsnrfwgpigenttivpfpslriidlshneFTGVLLTGYLDNfkammhgnniSVEVDymtplnssnyYESIILTIKGIDIKMERILTIFMTIdlssnkfqggipeVVGKLNllkglnishnnltgdipsslrnltevesldlssnmlvghiptqltsLKYLSVLNLSynqfegpiprgsqfntfpndsyvgnsglcgfpllescnideapepvgstrfdeeedasswfdwKFAKMGYGSGLVIGLSVGYMVFGTGKPRWLVRMIEKYQSNKEFYTHGMELSCRSQIITLQVQKLIFSLLFPIPNNILRLNLLLESLIKILREKII

*WDLGIATLYYLDLSNNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNLTSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNNISVEVDYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPLLESCNID*****************SSWFDWKFAKMGYGSGLVIGLSVGYMVFGTGKPRWLVRMIEKYQSNKEFYTHGMELSCRSQIITLQVQKLIFSLLFPIPNNILRLNLLLESLIKILR****

MWDLGIATLYYLDLSNNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNLTSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMH********DYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPL***************************FDWKFAKMGYGSGLVIGLSVGYMVFGTGKPRWLVRMIEKYQSNKEFYTHGMELSCRSQIITLQVQKLIFSLLFPIPNNILRLNLLLESLIKILREKII

MWDLGIATLYYLDLSNNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNLTSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNNISVEVDYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPLLESCN********************SWFDWKFAKMGYGSGLVIGLSVGYMVFGTGKPRWLVRMIEKYQSNKEFYTHGMELSCRSQIITLQVQKLIFSLLFPIPNNILRLNLLLESLIKILREKII

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		443	2.2.26 [Sep-21-2011]
Q9C9H7		847	Receptor-like protein 12	no	no	0.830	0.434	0.401	1e-67
Q9FIZ3		1252	LRR receptor-like serine/	no	no	0.575	0.203	0.355	3e-32
Q9SHI3		729	Receptor-like protein 2 O	no	no	0.672	0.408	0.320	2e-29
Q9LRT1		1016	Probably inactive leucine	no	no	0.697	0.304	0.330	3e-28
C0LGQ5		1249	LRR receptor-like serine/	no	no	0.523	0.185	0.336	8e-28
Q9ZWC8		1166	Serine/threonine-protein	no	no	0.765	0.290	0.285	1e-27
Q8LPB4		1021	Phytosulfokine receptor 1	N/A	no	0.555	0.240	0.359	7e-27
O49318		1124	Probable leucine-rich rep	no	no	0.681	0.268	0.300	2e-26
Q9FN37		1036	Phytosulfokine receptor 2	no	no	0.677	0.289	0.308	2e-26
Q9C7S5		1095	Tyrosine-sulfated glycope	no	no	0.656	0.265	0.273	3e-26

>sp\|Q9C9H7\|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2	Back alignment and function desciption

 Score =  257 bits (656), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 154/384 (40%), Positives = 221/384 (57%), Gaps = 16/384 (4%)

Query: 6   IATLYYLDLSNNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNL 65
           +++L +LDLSNN  +      P+ +   NF  ++  K L++  NNF+G +P  F K+  L
Sbjct: 466 LSSLGFLDLSNNLFSGS---IPSCIR--NFSGSI--KELNLGDNNFSGTLPDIFSKATEL 518

Query: 66  TSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWG 125
            SL+++ N+LEG  P SL+NC  LE++NV +N+I D FP+WLE LP L VL LRSN+F+G
Sbjct: 519 VSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYG 578

Query: 126 PIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNNISVEVD-YMTPL--NS 182
           P+      + F SLRIID+SHN F+G L   Y  N+K M     ++ E+D YMT     +
Sbjct: 579 PLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMT---TLTEEMDQYMTEFWRYA 635

Query: 183 SNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLT 242
            +YY  + +  KG+D+  ERI   F  ID S NK  G IPE +G L  L+ LN+S N  T
Sbjct: 636 DSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFT 695

Query: 243 GDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTF 302
             IP  L NLT++E+LD+S N L G IP  L +L +LS +N S+N  +GP+PRG+QF   
Sbjct: 696 SVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQ 755

Query: 303 PNDSYVGNSGLCGFPLLESCNIDEAPEPVGSTRFDEEEDASSWFDWKFAKMGYGSGLVIG 362
              S++ N GL G  L + C    A  P      D  E   + F+W  A + YG G++ G
Sbjct: 756 KCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCG 813

Query: 363 LSVGYMVFGTGKPRWLVRMIEKYQ 386
           L +G+  + +    W      + Q
Sbjct: 814 LVIGHF-YTSHNHEWFTEKFGRKQ 836

Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9FIZ3\|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2	Back alignment and function description

>sp\|Q9SHI3\|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1	Back alignment and function description

>sp\|Q9LRT1\|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1	Back alignment and function description

>sp\|C0LGQ5\|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZWC8\|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1	Back alignment and function description

>sp\|Q8LPB4\|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1	Back alignment and function description

>sp\|O49318\|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1	Back alignment and function description

>sp\|Q9FN37\|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1	Back alignment and function description

>sp\|Q9C7S5\|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		443
224116970		921	predicted protein [Populus trichocarpa]	0.835	0.401	0.579	1e-109
225462116		1001	PREDICTED: receptor-like protein 12-like	0.857	0.379	0.502	1e-103
296082718		745	unnamed protein product [Vitis vinifera]	0.832	0.495	0.533	4e-99
359493541		383	PREDICTED: receptor-like protein 12-like	0.844	0.976	0.530	8e-99
255568090		1014	serine/threonine-protein kinase bri1, pu	0.844	0.368	0.505	5e-98
359493544		978	PREDICTED: receptor-like protein 12-like	0.855	0.387	0.513	7e-98
359493479		814	PREDICTED: receptor-like protein 12-like	0.830	0.452	0.533	1e-97
225455498		980	PREDICTED: receptor-like protein 12-like	0.817	0.369	0.536	2e-97
296089526		616	unnamed protein product [Vitis vinifera]	0.830	0.597	0.533	3e-97
296086784		816	unnamed protein product [Vitis vinifera]	0.828	0.449	0.512	1e-96

>gi\|224116970\|ref\|XP_002331797.1\| predicted protein [Populus trichocarpa] gi\|222874493\|gb\|EEF11624.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 272/388 (70%), Gaps = 18/388 (4%)

Query: 2   WDLGIATLYYLDLSNNFLTNIEYFPPTNMTQL--NFDSNLTHKVLDMRMNNFNGKIPRKF 59
           W   I T   ++LSNN L+        N+ Q   NF + L+  VL++R N+F+G IP  F
Sbjct: 537 WICNITTFQIINLSNNSLSG-------NIPQCLGNFSTELS--VLNLRSNSFHGTIPGSF 587

Query: 60  VKSCNLTSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILR 119
            +   + SL+LNGN LEG LP SL NC  LEVL++GNN IND+FP WL+ LP+LQVL+LR
Sbjct: 588 TEGNKIRSLDLNGNELEGSLPLSLANCKMLEVLDLGNNYINDSFPLWLQTLPKLQVLVLR 647

Query: 120 SNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNNISVEVDYMTP 179
           SNR  G IG  T I PF SLRIIDLSHNEF G+L T Y+ NF+AM     +  EV     
Sbjct: 648 SNRLHGSIGNPTAISPFSSLRIIDLSHNEFIGLLPTQYIANFQAM---KKVDGEVKATPK 704

Query: 180 LNSSNYYE-SIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISH 238
                YY+ SI+LT+KG +I MERILTIF TIDLSSN+F+G IP+ VG L+ L  LNIS 
Sbjct: 705 YIGEIYYQDSIVLTMKGTEIPMERILTIFTTIDLSSNRFEGQIPKEVGLLSSLIVLNISR 764

Query: 239 NNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQ 298
           N++TG IPSSL NLT +ESLDLSSN L G IP+QLT L +L+VLNLSYNQ  GPIP GSQ
Sbjct: 765 NSVTGQIPSSLGNLTALESLDLSSNGLGGGIPSQLTRLTFLAVLNLSYNQLVGPIPHGSQ 824

Query: 299 FNTFPNDSYVGNSGLCGFPLLESCNIDEAPEPVGSTRFDEEEDASSWFDWKFAKMGYGSG 358
           F+TF NDSYVGN  LCGFPL   C+ D AP+P     F E+ED +S F+WKFA +GYG G
Sbjct: 825 FDTFQNDSYVGNLRLCGFPLSVKCSGDVAPQP---PPFQEKEDPASLFNWKFAMIGYGCG 881

Query: 359 LVIGLSVGYMVFGTGKPRWLVRMIEKYQ 386
           LVIGLSVGY+VF TGKP+W VR +E  Q
Sbjct: 882 LVIGLSVGYIVFTTGKPQWFVRKVEVEQ 909

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225462116\|ref\|XP_002263233.1\| PREDICTED: receptor-like protein 12-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296082718\|emb\|CBI21723.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493541\|ref\|XP_003634623.1\| PREDICTED: receptor-like protein 12-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255568090\|ref\|XP_002525021.1\| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi\|223535683\|gb\|EEF37348.1\| serine/threonine-protein kinase bri1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359493544\|ref\|XP_002267509.2\| PREDICTED: receptor-like protein 12-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493479\|ref\|XP_003634609.1\| PREDICTED: receptor-like protein 12-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225455498\|ref\|XP_002264793.1\| PREDICTED: receptor-like protein 12-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296089526\|emb\|CBI39345.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296086784\|emb\|CBI32933.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		443
TAIR\|locus:2086979		890	RLP42 "receptor like protein 4	0.839	0.417	0.416	3.3e-70
TAIR\|locus:2040035		671	RLP20 "receptor like protein 2	0.772	0.509	0.420	4.9e-69
TAIR\|locus:2205005		1019	RLP7 "AT1G47890" [Arabidopsis	0.823	0.358	0.428	6e-69
TAIR\|locus:2046397		589	RLP22 "receptor like protein 2	0.799	0.601	0.415	9.2e-68
TAIR\|locus:2829370		915	RLP40 "receptor like protein 4	0.823	0.398	0.411	1.2e-67
TAIR\|locus:2078102		875	RLP33 "receptor like protein 3	0.803	0.406	0.419	1.9e-67
TAIR\|locus:2825384		847	RLP12 "AT1G71400" [Arabidopsis	0.830	0.434	0.401	6.5e-67
TAIR\|locus:2087253		884	RLP39 "AT3G24900" [Arabidopsis	0.817	0.409	0.407	8.2e-67
TAIR\|locus:2046600		800	RLP26 "receptor like protein 2	0.765	0.423	0.426	1.3e-66
TAIR\|locus:2825762		994	RLP6 "AT1G45616" [Arabidopsis	0.814	0.363	0.418	1.4e-66

TAIR\|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 711 (255.3 bits), Expect = 3.3e-70, P = 3.3e-70
 Identities = 164/394 (41%), Positives = 234/394 (59%)

Query:     7 ATLYYLDLS-NNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNL 65
             ++L  LDLS NNF   I   PP         SNL +  L +R NN  G IP K+     L
Sbjct:   507 SSLDVLDLSYNNFSGQI---PPCL-------SNLLY--LKLRKNNLEGSIPDKYYVDTPL 554

Query:    66 TSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWG 125
              S ++  NRL G LP SL+NC  L+ L+V +N I D FP +L+ LP+LQVL+L SN F+G
Sbjct:   555 RSFDVGYNRLTGKLPRSLINCSALQFLSVDHNGIKDTFPFYLKALPKLQVLLLSSNEFYG 614

Query:   126 PIGE-NTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNN--ISVEVDYMTPLNS 182
             P+   N   + FP LRI++++ N+ TG L   +  N+KA  H  N  + + + Y   +  
Sbjct:   615 PLSPPNQGPLGFPELRILEIAGNKLTGSLPPDFFVNWKASSHTMNEDLGLYMVYSKVIFG 674

Query:   183 S---NYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHN 239
             +    YYE+I L  KG+ ++ E +LT   TIDLS N+ +G IPE +G L  L  LN+S+N
Sbjct:   675 NYHLTYYETIDLRYKGLSMEQENVLTSSATIDLSGNRLEGEIPESLGLLKALIALNLSNN 734

Query:   240 NLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQF 299
               TG IP SL NL ++ESLDLSSN L G IP  L +L +L+ +N+S+NQ  G IP+G+Q 
Sbjct:   735 AFTGHIPLSLANLKKIESLDLSSNQLSGTIPNGLGTLSFLAYMNVSHNQLNGEIPQGTQI 794

Query:   300 NTFPNDSYVGNSGLCGFPLLESCNIDEAPEPVGSTRFDEE-EDASSWFDWKFAKMGYGSG 358
                P  S+ GN+GLCGFPL ESC    AP P    + +EE E+     +WK   +GYG G
Sbjct:   795 TGQPKSSFEGNAGLCGFPLQESCFGTNAP-PAQKPKEEEEAEEDEQELNWKAVAIGYGVG 853

Query:   359 LVIGLSVGYMVFGTGKPRWLVRMIEKYQSNKEFY 392
             +++GL++  ++  + KP WLV +++     + F+
Sbjct:   854 VLLGLAIAQLI-ASYKPEWLVCLVKSRNPLRSFF 886

GO:0005576 "extracellular region" evidence=ISM

GO:0006952 "defense response" evidence=ISS

GO:0007165 "signal transduction" evidence=IC

TAIR\|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2829370 RLP40 "receptor like protein 40" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		443
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-32
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-27
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	6e-25
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-23
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-22
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-21
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-19
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	6e-19
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	2e-16
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-11
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-08
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	3e-08
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-06
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-05
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	2e-05
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	7e-05
cd00116		319	cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo	3e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

 Score =  128 bits (323), Expect = 8e-32
 Identities = 94/301 (31%), Positives = 139/301 (46%), Gaps = 32/301 (10%)

Query: 15  SNNFLTNIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNLTSLNLNGNR 74
           SN F   I    P N+ + N   NLT  VLD+  NN  G+IP     S NL  L L  N 
Sbjct: 341 SNKFSGEI----PKNLGKHN---NLT--VLDLSTNNLTGEIPEGLCSSGNLFKLILFSNS 391

Query: 75  LEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIV 134
           LEG +P SL  C  L  + + +N  +   P+    LP +  L + +N   G I  N+   
Sbjct: 392 LEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRI--NSRKW 449

Query: 135 PFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHGNNISVEVDYMTPLNSSNYYESIILTIK 194
             PSL+++ L+ N+F G    G  D+F +    N           L+ + +  ++   + 
Sbjct: 450 DMPSLQMLSLARNKFFG----GLPDSFGSKRLEN---------LDLSRNQFSGAVPRKL- 495

Query: 195 GIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTE 254
                    L+  M + LS NK  G IP+ +     L  L++SHN L+G IP+S   +  
Sbjct: 496 -------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPV 548

Query: 255 VESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLC 314
           +  LDLS N L G IP  L +++ L  +N+S+N   G +P    F      +  GN  LC
Sbjct: 549 LSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLC 608

Query: 315 G 315
           G
Sbjct: 609 G 609

Length = 968

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		443
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.98
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.94
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.94
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.89
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.88
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.84
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.84
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.82
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.82
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.8
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.79
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.79
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.78
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.77
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.75
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.75
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.73
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.72
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.7
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.67
PLN03150		623	hypothetical protein; Provisional	99.64
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.6
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.3
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.22
PLN03150		623	hypothetical protein; Provisional	99.21
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.18
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.12
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.11
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.07
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.07
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	99.03
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.02
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.98
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.95
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.92
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.91
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.87
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.81
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.81
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.73
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.61
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.32
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.25
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.24
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.2
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.2
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.13
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.09
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.0
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.98
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.95
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.93
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.85
PRK15386		426	type III secretion protein GogB; Provisional	97.82
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.74
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.64
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.59
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.53
PRK15386		426	type III secretion protein GogB; Provisional	97.41
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.95
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.67
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.46
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.2
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.07
KOG4341		483	consensus F-box protein containing LRR [General fu	95.96
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.87
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.78
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.42
KOG4341		483	consensus F-box protein containing LRR [General fu	94.53
KOG4308		478	consensus LRR-containing protein [Function unknown	94.02
KOG4308		478	consensus LRR-containing protein [Function unknown	93.62
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.61
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.12
KOG1947		482	consensus Leucine rich repeat proteins, some prote	90.99
KOG0473		326	consensus Leucine-rich repeat protein [Function un	89.67
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.57
smart00370		26	LRR Leucine-rich repeats, outliers.	89.57
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	88.07
smart00370		26	LRR Leucine-rich repeats, outliers.	88.07
KOG3864		221	consensus Uncharacterized conserved protein [Funct	84.04
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	82.87
KOG4242		553	consensus Predicted myosin-I-binding protein [Cell	81.42

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=2.1e-35  Score=325.34  Aligned_cols=310  Identities=30%  Similarity=0.435  Sum_probs=212.3

Q ss_pred             CCCCccEEeccCCCCCCcCC---CCCCCCCEEECCCC-------------CCCCEEECcCCcccccccccccCCCCCCEE
Q 013403            5 GIATLYYLDLSNNFLTNIEY---FPPTNMTQLNFDSN-------------LTHKVLDMRMNNFNGKIPRKFVKSCNLTSL   68 (443)
Q Consensus         5 ~~~~L~~L~Ls~n~l~~~~~---~~~~~L~~L~Ls~n-------------~~L~~LdLs~n~l~~~~p~~~~~l~~L~~L   68 (443)
                      ++++|++|++++|.+++..|   ..+.+|+.|++++|             ++|++|++++|.+++.+|..+.++++|++|
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L  337 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVL  337 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEE
Confidence            45667777777777766655   44566666666666             466666666666666666666666666666


Q ss_pred             EccCCcCCCCCCccccCCCCCcEEEcccCCCCCCCchhhhCCCCCcEEEeecccCcCCCCCCCCccCCCCCcEEEccCCc
Q 013403           69 NLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNE  148 (443)
Q Consensus        69 ~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~L~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~L~Ls~n~  148 (443)
                      ++++|.+++.+|..++.+++|+.|++++|.+++.+|.++..+++|+.|++++|++.+.+|..+  ..+++|+.|++++|+
T Consensus       338 ~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~--~~~~~L~~L~L~~n~  415 (968)
T PLN00113        338 QLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSL--GACRSLRRVRLQDNS  415 (968)
T ss_pred             ECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHH--hCCCCCCEEECcCCE
Confidence            666666666666666666666666666666666566655555555555555555555555443  445555555555555


Q ss_pred             cccccchhhHHhHhhhhccCCCcccc---------------------cccC-CCC---CCCcceeEEEEec---cchhhh
Q 013403          149 FTGVLLTGYLDNFKAMMHGNNISVEV---------------------DYMT-PLN---SSNYYESIILTIK---GIDIKM  200 (443)
Q Consensus       149 l~~~~~~~~~~~l~~L~~~~~~~~~~---------------------~~~~-~~~---~~~~~~~~~~~~~---~~~~~~  200 (443)
                      +++..|.. +..++.+..++......                     +.+. ..+   ....+..+....+   +..+..
T Consensus       416 l~~~~p~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~  494 (968)
T PLN00113        416 FSGELPSE-FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRK  494 (968)
T ss_pred             eeeECChh-HhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChh
Confidence            55444432 23333333222211100                     0000 000   0011122222222   222333


Q ss_pred             HhhhccccEEEccCCcCCCCCchhcCCCCCCCEEecCCCcCCCCCCccccCCCCCCeeecCCCcCCCCCcccccCCCCCC
Q 013403          201 ERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLS  280 (443)
Q Consensus       201 ~~~~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  280 (443)
                      +..+++|+.|++++|++.+.+|..+..+++|++|++++|.+++.+|..++++++|++|||++|++++.+|..+..+++|+
T Consensus       495 ~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~  574 (968)
T PLN00113        495 LGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV  574 (968)
T ss_pred             hhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccC
Confidence            45578899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeCcCCcCcCCCCCCCCCCCcCCCccCCCCCCCCCC
Q 013403          281 VLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFP  317 (443)
Q Consensus       281 ~L~Ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lcg~p  317 (443)
                      .+++++|+++|.+|...++.++...++.||+.+||.+
T Consensus       575 ~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        575 QVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             EEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999854

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		443
3riz_A		772	Crystal Structure Of The Plant Steroid Receptor Bri		1e-23
3rgx_A		768	Structural Insight Into Brassinosteroid Perception		1e-23
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		2e-12
4g8a_A		635	Crystal Structure Of Human Tlr4 Polymorphic Variant		4e-04

>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772

Back alignment and structure

Iteration: 1

Score = 107 bits (268), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 86/286 (30%), Positives = 128/286 (44%), Gaps = 14/286 (4%) Query: 40 THKVLDMRMNNFNGKIPRKFVKSCNLTSLNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQI 99 T + L + N+ G+IP NL ++L+ NRL G +P + +L +L + NN Sbjct: 464 TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF 523 Query: 100 NDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVLLTGYL- 158 + N P L L L L +N F G I P + F Y+ Sbjct: 524 SGNIPAELGDCRSLIWLDLNTNLFNGTI-------PAAMFKQSGKIAANFIAGKRYVYIK 576 Query: 159 -DNFKAMMHGNN-----ISVEVDYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDL 212 D K HG + + + L++ N G M +D+ Sbjct: 577 NDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDM 636 Query: 213 SSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQ 272 S N G IP+ +G + L LN+ HN+++G IP + +L + LDLSSN L G IP Sbjct: 637 SYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA 696 Query: 273 LTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPL 318 +++L L+ ++LS N GPIP QF TFP ++ N GLCG+PL Sbjct: 697 MSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL 742

PyMOL of 3riz

>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		443
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-82
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-47
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-44
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-44
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-42
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-40
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-39
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-35
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-16
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-46
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-34
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-34
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-32
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-31
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-29
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-23
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-38
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-28
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-34
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-27
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-27
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-25
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-25
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-32
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-27
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-25
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-24
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-19
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-18
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-31
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-31
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-30
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-28
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-24
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-23
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-23
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-21
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-15
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-30
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-29
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-29
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-28
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-24
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-26
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-25
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-24
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-17
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-15
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-24
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-23
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-22
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-20
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-18
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-23
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-22
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-18
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-23
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-22
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-17
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-22
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-19
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-16
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-21
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-21
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-21
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-21
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-16
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-15
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-14
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	8e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-21
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-18
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-14
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-13
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-21
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-18
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-18
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-16
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-15
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-14
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-13
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-20
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-19
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-16
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-20
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-19
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-13
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-19
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	7e-16
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	8e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-17
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-11
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-16
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-12
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-10
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-16
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-14
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-16
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-15
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-14
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-13
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	8e-15
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-14
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-14
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-13
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-10
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	6e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-13
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-12
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-09
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	7e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	4e-13
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-12
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-11
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	9e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-12
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-10
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	9e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	8e-10
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-11
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-11
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	8e-09
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-09
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-09
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	9e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-06
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	5e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	4e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	4e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	8e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	5e-08
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	5e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	7e-08
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	4e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	9e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	6e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	8e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	8e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	8e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-06
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	2e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	5e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	5e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	8e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	7e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	7e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	5e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	3e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	5e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	8e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	9e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-05
3e6j_A		229	Variable lymphocyte receptor diversity region; var	3e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	6e-04

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

 Score =  267 bits (684), Expect = 4e-82
 Identities = 88/348 (25%), Positives = 148/348 (42%), Gaps = 40/348 (11%)

Query: 9   LYYLDLSNNFLT-NIEYFPPTNMTQLNFDSNLTHKVLDMRMNNFNGKIPRKFVKSCNLTS 67
           L  L LS N+L+  I    P+++  L   S L    L + +N   G+IP++ +    L +
Sbjct: 420 LVSLHLSFNYLSGTI----PSSLGSL---SKLR--DLKLWLNMLEGEIPQELMYVKTLET 470

Query: 68  LNLNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPI 127
           L L+ N L G +P  L NC +L  +++ NN++    P W+  L  L +L L +N F G I
Sbjct: 471 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI 530

Query: 128 GENTTIVPFPSLRIIDLSHNEFTGVLLTGYLDNFKAMMHG---NNISVEVDYMTPLNSSN 184
                +    SL  +DL+ N F G +          +          V +          
Sbjct: 531 PA--ELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC- 587

Query: 185 YYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGD 244
           +    +L  +GI  +    L+     +++S  + G           +  L++S+N L+G 
Sbjct: 588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY 647

Query: 245 IPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQ---------------- 288
           IP  + ++  +  L+L  N + G IP ++  L+ L++L+LS N+                
Sbjct: 648 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 707

Query: 289 --------FEGPIPRGSQFNTFPNDSYVGNSGLCGFPLLESCNIDEAP 328
                     GPIP   QF TFP   ++ N GLCG+PL      +   
Sbjct: 708 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADG 755

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		443
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.97
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.97
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.97
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.97
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.97
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.97
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.97
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.96
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.96
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.96
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.96
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.96
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.96
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.96
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.96
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.96
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.96
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.96
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.96
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.96
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.96
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.95
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.95
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.95
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.95
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.95
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.95
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.95
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.95
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.95
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.95
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.95
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.95
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.94
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.94
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.94
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.94
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.93
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.93
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.93
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.93
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.93
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.93
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.92
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.92
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.92
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.92
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.92
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.92
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.91
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.91
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.91
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.9
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.89
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.89
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.89
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.89
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.89
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.89
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.88
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.88
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.87
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.87
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.86
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.86
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.86
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.85
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.85
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.84
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.84
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.84
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.84
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.83
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.81
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.81
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.8
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.8
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.8
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.79
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.79
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.79
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.79
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.79
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.79
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.78
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.76
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.75
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.75
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.75
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.74
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.74
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.74
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.73
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.72
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.71
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.69
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.69
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.68
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.66
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.65
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.65
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.64
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.63
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.63
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.63
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.61
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.59
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.59
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.54
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.53
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.52
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.5
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.5
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.5
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.49
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.48
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.46
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.41
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.39
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.33
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.29
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.29
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.25
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.99
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.91
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.82
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.66
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.51
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.46
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.46
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.45
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.33
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.3
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.22
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.92
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.83
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.75
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.37
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.15
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.96
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.81

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=7e-42  Score=366.39  Aligned_cols=322  Identities=31%  Similarity=0.479  Sum_probs=203.3

Q ss_pred             CCCccEEeccCCCCCCcCC---CCCCCCCEEECCCC-------------CCCCEEECcCCcccccccccccCCCCCCEEE
Q 013403            6 IATLYYLDLSNNFLTNIEY---FPPTNMTQLNFDSN-------------LTHKVLDMRMNNFNGKIPRKFVKSCNLTSLN   69 (443)
Q Consensus         6 ~~~L~~L~Ls~n~l~~~~~---~~~~~L~~L~Ls~n-------------~~L~~LdLs~n~l~~~~p~~~~~l~~L~~L~   69 (443)
                      +++|++|++++|.+++.+|   ..+++|+.|++++|             ++|++|++++|.+++.+|..+..+++|++|+
T Consensus       393 ~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  472 (768)
T 3rgz_A          393 KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI  472 (768)
T ss_dssp             TCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEE
T ss_pred             cCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEE
Confidence            3445555555555544444   33445555555554             4455555555555555555555555555555


Q ss_pred             ccCCcCCCCCCccccCCCCCcEEEcccCCCCCCCchhhhCCCCCcEEEeecccCcCCCCCCCCccCCCCCcEEEccCCcc
Q 013403           70 LNGNRLEGPLPPSLVNCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSLRIIDLSHNEF  149 (443)
Q Consensus        70 L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~L~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~L~Ls~n~l  149 (443)
                      +++|.+++.+|..+.++++|++|++++|.+++.+|.+++.+++|++|++++|++++.+|..+  +.+++|+.|++++|.+
T Consensus       473 L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l--~~l~~L~~L~Ls~N~l  550 (768)
T 3rgz_A          473 LDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL--GDCRSLIWLDLNTNLF  550 (768)
T ss_dssp             CCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GGCTTCCEEECCSSEE
T ss_pred             ecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHH--cCCCCCCEEECCCCcc
Confidence            55555555555555555555555555555555555555555555555555555555555443  5555555555555555


Q ss_pred             ccccchhhHHhHhhhhccCCCcc-cccccCCC--------------------------CCCCcceeEEEEeccchhhhHh
Q 013403          150 TGVLLTGYLDNFKAMMHGNNISV-EVDYMTPL--------------------------NSSNYYESIILTIKGIDIKMER  202 (443)
Q Consensus       150 ~~~~~~~~~~~l~~L~~~~~~~~-~~~~~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~  202 (443)
                      +|.+|..++. ...+........ ...++...                          ..............+.....+.
T Consensus       551 ~g~ip~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~  629 (768)
T 3rgz_A          551 NGTIPAAMFK-QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD  629 (768)
T ss_dssp             ESBCCGGGGT-TTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCS
T ss_pred             CCcCChHHhc-ccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhh
Confidence            5555544222 111111000000 00000000                          0000000000011111122233


Q ss_pred             hhccccEEEccCCcCCCCCchhcCCCCCCCEEecCCCcCCCCCCccccCCCCCCeeecCCCcCCCCCcccccCCCCCCeE
Q 013403          203 ILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVL  282 (443)
Q Consensus       203 ~~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L  282 (443)
                      .++.|+.|||++|+++|.+|..++.++.|+.|+|++|+++|.+|..++++++|++|||++|+++|.+|..+..+++|++|
T Consensus       630 ~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L  709 (768)
T 3rgz_A          630 NNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI  709 (768)
T ss_dssp             SSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEE
T ss_pred             ccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEE
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCcCCcCcCCCCCCCCCCCcCCCccCCCCCCCCCCCCCCCCCCCCCCCC
Q 013403          283 NLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPLLESCNIDEAPEPV  331 (443)
Q Consensus       283 ~Ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lcg~p~~~~C~~~~~~~~~  331 (443)
                      |+++|+++|.||...++.++...++.||+++||.|+. .|.......+.
T Consensus       710 ~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~~~~~  757 (768)
T 3rgz_A          710 DLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNADGYA  757 (768)
T ss_dssp             ECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-----
T ss_pred             ECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCccCCCC
Confidence            9999999999999999999999999999999999987 89766554443

PyMOL of 3rgz

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		443
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	2e-20
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	6e-07
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	4e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-16
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	8e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-13
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-12
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	2e-11
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	8e-06
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	2e-05
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	0.001
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	6e-10
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	9e-08
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.002
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.002
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	2e-06
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	3e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	5e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	9e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	5e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	7e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.003
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	8e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	2e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	3e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	5e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.003
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	7e-04
d2ifga3		156	c.10.2.7 (A:36-191) High affinity nerve growth fac	0.002

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 62/264 (23%), Positives = 100/264 (37%), Gaps = 8/264 (3%)

Query: 61  KSCNLTSLNLNGNRLEG--PLPPSLVNCHHLEVLNV-GNNQINDNFPNWLEILPELQVLI 117
           ++  + +L+L+G  L    P+P SL N  +L  L + G N +    P  +  L +L  L 
Sbjct: 48  QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLY 107

Query: 118 LRSNRFWGPIGENTTIVPFPSLRIIDLSHNEFTGVL---LTGYLDNFKAMMHGNNISVEV 174
           +      G I     +    +L  +D S+N  +G L   ++   +       GN IS  +
Sbjct: 108 ITHTNVSGAI--PDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAI 165

Query: 175 DYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGL 234
                  S  +    I   +           + +     S     G   V+   +     
Sbjct: 166 PDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQK 225

Query: 235 NISHNNLTGDIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIP 294
                N        +     +  LDL +N + G +P  LT LK+L  LN+S+N   G IP
Sbjct: 226 IHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP 285

Query: 295 RGSQFNTFPNDSYVGNSGLCGFPL 318
           +G     F   +Y  N  LCG PL
Sbjct: 286 QGGNLQRFDVSAYANNKCLCGSPL 309

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		443
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	100.0
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.95
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.92
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.92
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.91
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.91
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.9
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.9
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.89
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.85
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.78
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.78
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.75
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.75
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.74
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.74
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.73
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.73
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.73
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.71
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.71
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.69
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.61
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.58
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.56
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.52
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.52
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.49
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.48
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.47
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.46
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.45
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.29
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.26
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.23
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.17
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.4
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.38
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.73
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.73
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.0
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.83

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.1e-33  Score=268.64  Aligned_cols=258  Identities=28%  Similarity=0.449  Sum_probs=193.6

Q ss_pred             CccEEeccCCCCCCc--CCCCCCCCCEEECCCCCCCCEEECcC-CcccccccccccCCCCCCEEEccCCcCCCCCCcccc
Q 013403            8 TLYYLDLSNNFLTNI--EYFPPTNMTQLNFDSNLTHKVLDMRM-NNFNGKIPRKFVKSCNLTSLNLNGNRLEGPLPPSLV   84 (443)
Q Consensus         8 ~L~~L~Ls~n~l~~~--~~~~~~~L~~L~Ls~n~~L~~LdLs~-n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~   84 (443)
                      +++.|||++|.+++.  +|..+.+|..|        ++|||++ |+++|.+|.+|+++++|++|+|++|++++..+..+.
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L--------~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~  122 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYL--------NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS  122 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTC--------SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGG
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccc--------cccccccccccccccccccccccccchhhhcccccccccccccc
Confidence            466667776666653  34444444333        6666664 566666666677777777777777776666666666


Q ss_pred             CCCCCcEEEcccCCCCCCCchhhhCCCCCcEEEeecccCcCCCCCCCCccCCCCC-cEEEccCCccccccchhhHHhHhh
Q 013403           85 NCHHLEVLNVGNNQINDNFPNWLEILPELQVLILRSNRFWGPIGENTTIVPFPSL-RIIDLSHNEFTGVLLTGYLDNFKA  163 (443)
Q Consensus        85 ~l~~L~~L~Ls~N~l~~~~p~~~~~L~~L~~L~L~~N~l~~~~~~~~~~~~l~~L-~~L~Ls~n~l~~~~~~~~~~~l~~  163 (443)
                      .+.+|+.++++.|.+.+.+|..+..++.++++++++|.+.+.+|...  ..+..+ +.+++++|++++..+..+      
T Consensus       123 ~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~--~~l~~l~~~l~~~~n~l~~~~~~~~------  194 (313)
T d1ogqa_         123 QIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY--GSFSKLFTSMTISRNRLTGKIPPTF------  194 (313)
T ss_dssp             GCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GCCCTTCCEEECCSSEEEEECCGGG------
T ss_pred             chhhhcccccccccccccCchhhccCcccceeecccccccccccccc--ccccccccccccccccccccccccc------
Confidence            66677777777766666666666667777777777776666666544  444443 666666666665544321      


Q ss_pred             hhccCCCcccccccCCCCCCCcceeEEEEeccchhhhHhhhccccEEEccCCcCCCCCchhcCCCCCCCEEecCCCcCCC
Q 013403          164 MMHGNNISVEVDYMTPLNSSNYYESIILTIKGIDIKMERILTIFMTIDLSSNKFQGGIPEVVGKLNLLKGLNISHNNLTG  243 (443)
Q Consensus       164 L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~  243 (443)
                                                            . ......++++.+...+.+|..+..+++++.+++++|.+.+
T Consensus       195 --------------------------------------~-~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~  235 (313)
T d1ogqa_         195 --------------------------------------A-NLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF  235 (313)
T ss_dssp             --------------------------------------G-GCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC
T ss_pred             --------------------------------------c-cccccccccccccccccccccccccccccccccccccccc
Confidence                                                  1 1234578999999999999999999999999999999997


Q ss_pred             CCCccccCCCCCCeeecCCCcCCCCCcccccCCCCCCeEeCcCCcCcCCCCCCCCCCCcCCCccCCCCCCCCCCCCCCC
Q 013403          244 DIPSSLRNLTEVESLDLSSNMLVGHIPTQLTSLKYLSVLNLSYNQFEGPIPRGSQFNTFPNDSYVGNSGLCGFPLLESC  322 (443)
Q Consensus       244 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lcg~p~~~~C  322 (443)
                      .+| .++.+++|+.|+|++|+++|.+|..++++++|++|||++|+++|.+|+...+..+...++.||+.+||.|+. .|
T Consensus       236 ~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         236 DLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             BGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             ccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            655 688899999999999999999999999999999999999999999999888888888999999999999864 56

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure