Citrus Sinensis ID: 013495

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--

MNYCHNGNRKSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM

cccccccEEEEHHHHHHHHHHHHHHcccEEEccccccEEEEcccccEEEEEccccccccccccccccccccEEEEEEEEEccccccHHHHHHHHcccccccccccccEEEEEEEEEEEccccccccccEEEEEccccccccccEEEEEEEcccEEEEEEEEEcccccccccHHHHHHHHHccccHHHHHccccEEEEcEEEEcccccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccEEEccccccccccccc

cccccccEEEEHHHHHHHHHHHHHHcccEEcccccHHHHHEcccccEEEEEEcccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHcccccccccccccEEEEEHEEHEccHHHccccEEEEEccccccccccccEEEEEccccEEEEEEEEEccccccccccHHHHHHHcccHHHHHHHccccHHHHHHHHHHHccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHcccccEEcccccccHHHcccHHHcccccccccccEEEEccccEEEEEccccccccccEEEEccccccHcccHHHccccccccccccEEEEEEccccccEEEEEccccEEEcccccccccccEEEEccccccccccccc

mnychngnrkSLSQLVRWLGgkaeelgveiypgfaaseilydadnkvigigtndmgiakdgskkenfQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEvweidegkhnpgeilhtlgwpldqktyggsfLYHMNDRQIALGLVVALNyhnpflnpyeefqkfkhhpaikplleggtvvQYGARtlnegglqsipypvfpggaiigcaagflnvpkikgtHTAMKSGMLAAEAgfgvlhedsnmeIYWDTLQKSWVWQELQRArnyrpafeygllpglaicglehyilrgkspytlkhgkpdheatdaarlhspieypkpdgvlsfdvptslhrsntnhehdqpahlrlrdpkipelvnlpeyagpesrycparvyeyvpdeKNQLKLQINAqnclhckacdikdpkqnikwtvpeggggpgysvm

mnychngnrksLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNdmgiakdgskkenfqrgVELRGRITllaegcrgslSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHrsntnhehdqpahlrlrdpkipELVNLpeyagpesrYCPARVYEYVPDEKNQLKLQINAQNCLHCKACdikdpkqnikwtvpeggggpgysvm

***********LSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAK*******FQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYT*************************************************************LVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTV************

*****NGNRKSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGG**YSV*

*********KSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHR***********HLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM

***CHNGNRKSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGG******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		442	2.2.26 [Sep-21-2011]
Q6UPE1		616	Electron transfer flavopr	yes	no	0.970	0.696	0.565	1e-144
Q16134		617	Electron transfer flavopr	yes	no	0.970	0.695	0.563	1e-144
Q5RDD3		617	Electron transfer flavopr	yes	no	0.970	0.695	0.563	1e-144
Q921G7		616	Electron transfer flavopr	yes	no	0.970	0.696	0.563	1e-143
Q54XM6		606	Electron transfer flavopr	yes	no	0.972	0.709	0.553	1e-143
Q2KIG0		617	Electron transfer flavopr	yes	no	0.970	0.695	0.554	1e-143
P55931		617	Electron transfer flavopr	yes	no	0.970	0.695	0.558	1e-142
Q11190		597	Electron transfer flavopr	yes	no	0.966	0.715	0.524	1e-131
Q08822		631	Probable electron transfe	yes	no	0.970	0.679	0.498	1e-125
P87111		632	Probable electron transfe	yes	no	0.968	0.677	0.497	1e-125

>sp\|Q6UPE1\|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=2 SV=1	Back alignment and function desciption

 Score =  511 bits (1317), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/444 (56%), Positives = 318/444 (71%), Gaps = 15/444 (3%)

Query: 12  LSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGV 71
           L  LV W+G +AE LGVE+YPG+AA+E+LY  D  V GI TND+GI KDG+ K  F+RG+
Sbjct: 175 LGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGL 234

Query: 72  ELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILH 131
           EL  ++T+ AEGC G L+++  K F LR    AQ  TY +G+KE+W IDE K  PG + H
Sbjct: 235 ELHAKVTIFAEGCHGHLAKQFYKKFDLRASCDAQ--TYGIGLKELWVIDEKKWKPGRVDH 292

Query: 132 TLGWPLDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLL 189
           T+GWPLD+ TYGGSFLYH+N+ +  +A+G VV L+Y NP+L+P+ EFQ++KHHP+I+P L
Sbjct: 293 TVGWPLDRHTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQRWKHHPSIRPTL 352

Query: 190 EGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEA 249
           EGG  + YGAR LNEGGLQSIP   FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAEA
Sbjct: 353 EGGKRIAYGARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGSLAAEA 412

Query: 250 GFGVLHEDS--------NMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGL 299
            F  L  ++        ++  Y D L++SWVW+EL   RN RP+     G+  G+   G+
Sbjct: 413 IFKQLTSENLQSKTAGLHVTEYEDNLKQSWVWKELHAVRNIRPSCHGILGVYGGMIYTGI 472

Query: 300 EHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQ 359
            ++ILRG  P+TLKH   D E    A+  +PIEYPKPDG +SFD+ +S+  S TNHEHDQ
Sbjct: 473 FYWILRGMEPWTLKHKGSDSEQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQ 532

Query: 360 PAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEK-NQLKLQINAQNCLHCKACD 418
           PAHL L+D  IP   NL  Y GPE R+CPA VYE+VP E+ +  +LQINAQNC+HCK CD
Sbjct: 533 PAHLTLKDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCD 592

Query: 419 IKDPKQNIKWTVPEGGGGPGYSVM 442
           IKDP QNI W VPEGGGGP Y+ M
Sbjct: 593 IKDPSQNINWVVPEGGGGPAYNGM 616

Accepts electrons from ETF and reduces ubiquinone.
Rattus norvegicus (taxid: 10116)
EC: 1EC: .EC: 5EC: .EC: 5EC: .EC: 1

>sp\|Q16134\|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2	Back alignment and function description

>sp\|Q5RDD3\|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1	Back alignment and function description

>sp\|Q921G7\|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1	Back alignment and function description

>sp\|Q54XM6\|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1	Back alignment and function description

>sp\|Q2KIG0\|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1	Back alignment and function description

>sp\|P55931\|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2	Back alignment and function description

>sp\|Q11190\|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=1 SV=2	Back alignment and function description

>sp\|Q08822\|ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIR2 PE=1 SV=1	Back alignment and function description

>sp\|P87111\|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		442
225433976		676	PREDICTED: electron transfer flavoprotei	0.977	0.639	0.844	0.0
297743836		536	unnamed protein product [Vitis vinifera]	0.977	0.805	0.844	0.0
449459846		659	PREDICTED: electron transfer flavoprotei	0.977	0.655	0.835	0.0
356557362		617	PREDICTED: electron transfer flavoprotei	0.977	0.700	0.831	0.0
224132778		424	predicted protein [Populus trichocarpa]	0.959	1.0	0.844	0.0
357454495		606	Electron transfer flavoprotein-ubiquinon	0.977	0.712	0.812	0.0
255577195		609	electron transfer flavoprotein-ubiquinon	0.977	0.709	0.821	0.0
15224277		633	electron-transferring-flavoprotein dehyd	0.977	0.682	0.828	0.0
297824323		629	electron-transfer flavoprotein:ubiquinon	0.977	0.686	0.826	0.0
449498831		668	PREDICTED: electron transfer flavoprotei	0.977	0.646	0.814	0.0

>gi\|225433976\|ref\|XP_002270682.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/432 (84%), Positives = 408/432 (94%)

Query: 11  SLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRG 70
           SLSQLVRWLGGKAEELGVEIYPGFAASEILYDA++ VIGIGTNDMGIAKDGSKK+NFQRG
Sbjct: 245 SLSQLVRWLGGKAEELGVEIYPGFAASEILYDANHNVIGIGTNDMGIAKDGSKKDNFQRG 304

Query: 71  VELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEIL 130
           VELRGR+TLLAEGCRGSLSEK+++++ LREK+ AQHQTYALGIKE+WEIDE KH  G +L
Sbjct: 305 VELRGRVTLLAEGCRGSLSEKVLRDYNLREKAQAQHQTYALGIKEIWEIDEAKHKTGTVL 364

Query: 131 HTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLE 190
           HTLGWPLD +TYGGSFLYHMNDRQ+++GLVVALNYHNPFLNPYEEFQK KHHPAIKPLL+
Sbjct: 365 HTLGWPLDHRTYGGSFLYHMNDRQVSIGLVVALNYHNPFLNPYEEFQKLKHHPAIKPLLK 424

Query: 191 GGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAG 250
           GGTV+QYGARTLNEGG QSIPYPVFPGGAIIGC+AGFLNVPKIKGTHTAMKSGMLAAEA 
Sbjct: 425 GGTVLQYGARTLNEGGFQSIPYPVFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAA 484

Query: 251 FGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPY 310
           F VLHE S+ME YWD L+ SW+W+EL +ARNYRPAFEYGL+PGLA+  LEHY+L+G+SP 
Sbjct: 485 FDVLHEGSSMEKYWDGLRNSWIWEELHKARNYRPAFEYGLIPGLALSALEHYVLKGRSPL 544

Query: 311 TLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKI 370
           TLKHGKPDHEATD A+LHSPI+YPKPDG++SFDVPTSL+RSNTNH+HDQP+HL LRDP+I
Sbjct: 545 TLKHGKPDHEATDVAQLHSPIQYPKPDGIVSFDVPTSLYRSNTNHDHDQPSHLHLRDPQI 604

Query: 371 PELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTV 430
           P+ VNLP++AGPESRYCPARVYEYVPDEK +L+LQINAQNCLHCKACDIKDPKQNI+WTV
Sbjct: 605 PDRVNLPDFAGPESRYCPARVYEYVPDEKGELRLQINAQNCLHCKACDIKDPKQNIEWTV 664

Query: 431 PEGGGGPGYSVM 442
           PEGGGGPGYSVM
Sbjct: 665 PEGGGGPGYSVM 676

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297743836\|emb\|CBI36719.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449459846\|ref\|XP_004147657.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356557362\|ref\|XP_003546985.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|224132778\|ref\|XP_002327878.1\| predicted protein [Populus trichocarpa] gi\|222837287\|gb\|EEE75666.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357454495\|ref\|XP_003597528.1\| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago truncatula] gi\|355486576\|gb\|AES67779.1\| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255577195\|ref\|XP_002529480.1\| electron transfer flavoprotein-ubiquinone oxidoreductase, putative [Ricinus communis] gi\|223531038\|gb\|EEF32890.1\| electron transfer flavoprotein-ubiquinone oxidoreductase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|15224277\|ref\|NP_181868.1\| electron-transferring-flavoprotein dehydrogenase [Arabidopsis thaliana] gi\|2288999\|gb\|AAB64328.1\| putative electron transfer flavoprotein ubiquinone oxidoreductase [Arabidopsis thaliana] gi\|330255167\|gb\|AEC10261.1\| electron-transferring-flavoprotein dehydrogenase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297824323\|ref\|XP_002880044.1\| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi\|297325883\|gb\|EFH56303.1\| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449498831\|ref\|XP_004160647.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		442
TAIR\|locus:2058183		633	ETFQO "AT2G43400" [Arabidopsis	0.977	0.682	0.828	5.2e-207
ZFIN\|ZDB-GENE-040912-168		617	etfdh "electron-transferring-f	0.984	0.705	0.561	4.4e-139
UNIPROTKB\|J3KND9		570	ETFDH "Electron transfer flavo	0.970	0.752	0.563	4.1e-136
UNIPROTKB\|Q16134		617	ETFDH "Electron transfer flavo	0.970	0.695	0.563	4.1e-136
RGD\|735052		616	Etfdh "electron-transferring-f	0.970	0.696	0.565	5.2e-136
MGI\|MGI:106100		616	Etfdh "electron transferring f	0.970	0.696	0.563	1.8e-135
UNIPROTKB\|Q2KIG0		617	ETFDH "Electron transfer flavo	0.970	0.695	0.554	2.3e-135
UNIPROTKB\|F1RW89		616	ETFDH "Electron transfer flavo	0.970	0.696	0.558	2.3e-135
UNIPROTKB\|P55931		617	ETFDH "Electron transfer flavo	0.970	0.695	0.558	3.7e-135
UNIPROTKB\|F6V7P2		617	ETFDH "Uncharacterized protein	0.970	0.695	0.560	4.7e-135

TAIR\|locus:2058183 ETFQO "AT2G43400" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2002 (709.8 bits), Expect = 5.2e-207, P = 5.2e-207
 Identities = 358/432 (82%), Positives = 394/432 (91%)

Query:    11 SLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRG 70
             SLSQLVRWLGGKAEELG EIYPGF+ASE+L+DA +KV+GI T DMGI+KDGSKKENFQ G
Sbjct:   202 SLSQLVRWLGGKAEELGTEIYPGFSASEVLFDASDKVVGIATKDMGISKDGSKKENFQPG 261

Query:    71 VELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEIL 130
             V+++GR+TL AEGCRGSLSE++IK +KLRE+ +AQHQTYALGIKEVWEIDE KHNPGE++
Sbjct:   262 VDIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVI 321

Query:   131 HTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLE 190
             HTLGWPLD KTYGGSFLYHMNDRQ+ALGLVVALNYHNPFLNPYEEFQK KHHPAIK +LE
Sbjct:   322 HTLGWPLDPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEEFQKLKHHPAIKGILE 381

Query:   191 GGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAG 250
             GGTV+QYGARTLNEGG QSIPYPVFPGGAIIGC+AGFLNVPKIKGTHTAMKSGMLAAEA 
Sbjct:   382 GGTVLQYGARTLNEGGFQSIPYPVFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAA 441

Query:   251 FGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPY 310
             FG LHE  NM  YWD L+ SWVW+EL  ARNYRPAFEYGLLPGLAI  +EHY+L+GK P+
Sbjct:   442 FGALHEGLNMNTYWDNLRDSWVWKELYAARNYRPAFEYGLLPGLAISAMEHYVLKGKVPF 501

Query:   311 TLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKI 370
             TLKHGK DHEATD AR  +PI YPKPDGVLSFDVPTSL+RSNTNH+HDQP+HLRLRDPKI
Sbjct:   502 TLKHGKADHEATDLARKWTPIVYPKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKI 561

Query:   371 PELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTV 430
             PE VN PEYA PESRYCPARVYEY+ DE+ + KLQINAQNCLHCKACDIKDPKQNI+WTV
Sbjct:   562 PEKVNFPEYAAPESRYCPARVYEYIEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTV 621

Query:   431 PEGGGGPGYSVM 442
             PEGGGGP YS+M
Sbjct:   622 PEGGGGPAYSLM 633

GO:0003824 "catalytic activity" evidence=ISS

GO:0004174 "electron-transferring-flavoprotein dehydrogenase activity" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0005740 "mitochondrial envelope" evidence=ISS

GO:0009055 "electron carrier activity" evidence=ISS

GO:0009228 "thiamine biosynthetic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009646 "response to absence of light" evidence=IEP

GO:0006552 "leucine catabolic process" evidence=IMP

GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA

ZFIN\|ZDB-GENE-040912-168 etfdh "electron-transferring-flavoprotein dehydrogenase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|J3KND9 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q16134 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|735052 Etfdh "electron-transferring-flavoprotein dehydrogenase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:106100 Etfdh "electron transferring flavoprotein, dehydrogenase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KIG0 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RW89 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|P55931 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F6V7P2 ETFDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q16134	ETFD_HUMAN	1, ., 5, ., 5, ., 1	0.5630	0.9705	0.6952	yes	no
Q6UPE1	ETFD_RAT	1, ., 5, ., 5, ., 1	0.5653	0.9705	0.6964	yes	no
Q11190	ETFD_CAEEL	1, ., 5, ., 5, ., 1	0.5247	0.9660	0.7152	yes	no
Q9HZP5	ETFD_PSEAE	1, ., 5, ., 5, ., 1	0.5182	0.9728	0.7803	yes	no
Q54XM6	ETFD_DICDI	1, ., 5, ., 5, ., 1	0.5535	0.9728	0.7095	yes	no
Q2KIG0	ETFD_BOVIN	1, ., 5, ., 5, ., 1	0.5540	0.9705	0.6952	yes	no
Q5RDD3	ETFD_PONAB	1, ., 5, ., 5, ., 1	0.5630	0.9705	0.6952	yes	no
Q921G7	ETFD_MOUSE	1, ., 5, ., 5, ., 1	0.5630	0.9705	0.6964	yes	no
P55931	ETFD_PIG	1, ., 5, ., 5, ., 1	0.5585	0.9705	0.6952	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.5.5	0.921
4th Layer	1.5.5.1	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00010287001	SubName- Full=Chromosome chr5 scaffold_253, whole genome shotgun sequence; (536 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00027378001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (347 aa)	•	•	•	•	•	0.991
	GSVIVG00020216001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (251 aa)	•	•	•	•	•	0.987
	GSVIVG00024504001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (403 aa)	•		•		•	0.735
	GSVIVG00024946001	SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (528 aa)			•		•	0.680
	GSVIVG00036606001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (570 aa)	•		•			0.597
	GSVIVG00020486001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (564 aa)	•		•			0.564
	GSVIVG00023766001	SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (714 aa)	•		•		•	0.548
	GSVIVG00020558001	SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (310 aa)			•	•	•	0.545
	GSVIVG00002216001	SubName- Full=Chromosome chr14 scaffold_128, whole genome shotgun sequence; (485 aa)					•	0.540
	GSVIVG00005777001	SubName- Full=Chromosome chr3 scaffold_158, whole genome shotgun sequence; (214 aa)	•				•	0.527

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		442
pfam05187		110	pfam05187, ETF_QO, Electron transfer flavoprotein-	2e-62
COG0644		396	COG0644, FixC, Dehydrogenases (flavoproteins) [Ene	4e-57
PRK10015		429	PRK10015, PRK10015, oxidoreductase; Provisional	9e-20
PRK10157		428	PRK10157, PRK10157, putative oxidoreductase FixC;	1e-17
COG2440		99	COG2440, FixX, Ferredoxin-like protein [Energy pro	8e-06
pfam12838		48	pfam12838, Fer4_7, 4Fe-4S dicluster domain	4e-04

>gnl\|CDD\|218485 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiquinone oxidoreductase	Back alignment and domain information

 Score =  197 bits (503), Expect = 2e-62
 Identities = 71/110 (64%), Positives = 82/110 (74%)

Query: 289 GLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSL 348
           GL  GLA  GL+ +ILRGKSP+TLKH KPDH A   A    PI+YPKPDG L+FD  +S+
Sbjct: 1   GLWLGLAYAGLDQWILRGKSPWTLKHHKPDHAALKPASECKPIDYPKPDGKLTFDRLSSV 60

Query: 349 HRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDE 398
             SNTNHE DQP HL+L+DP +P  VNLP+YAGPE RYCPA VYE V DE
Sbjct: 61  FLSNTNHEEDQPCHLKLKDPSVPIAVNLPKYAGPEQRYCPAGVYEIVEDE 110

Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The two redox centres in the protein, FAD and a [4Fe4S] cluster, are present in a 64-kDa monomer. Length = 110

>gnl\|CDD\|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|182194 PRK10015, PRK10015, oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional	Back alignment and domain information

>gnl\|CDD\|225289 COG2440, FixX, Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		442
KOG2415		621	consensus Electron transfer flavoprotein ubiquinon	100.0
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	100.0
PRK10015		429	oxidoreductase; Provisional	100.0
PRK10157		428	putative oxidoreductase FixC; Provisional	100.0
PF05187		110	ETF_QO: Electron transfer flavoprotein-ubiquinone	100.0
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	99.97
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	99.97
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	99.96
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	99.9
COG2440		99	FixX Ferredoxin-like protein [Energy production an	99.9
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	99.87
PRK11445		351	putative oxidoreductase; Provisional	99.83
PRK15449		95	ferredoxin-like protein FixX; Provisional	99.82
PLN02697		529	lycopene epsilon cyclase	99.8
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	99.79
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	99.77
PRK07045		388	putative monooxygenase; Reviewed	99.75
PLN02463		447	lycopene beta cyclase	99.75
PRK06185		407	hypothetical protein; Provisional	99.75
PRK09126		392	hypothetical protein; Provisional	99.74
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	99.74
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.73
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.72
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	99.72
PRK07538		413	hypothetical protein; Provisional	99.7
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.7
PRK08013		400	oxidoreductase; Provisional	99.69
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	99.68
PRK06753		373	hypothetical protein; Provisional	99.67
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.67
PRK08244		493	hypothetical protein; Provisional	99.67
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	99.66
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	99.66
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.66
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.65
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	99.65
PRK07588		391	hypothetical protein; Provisional	99.64
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.64
PRK06996		398	hypothetical protein; Provisional	99.62
PRK08163		396	salicylate hydroxylase; Provisional	99.62
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	99.62
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	99.62
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	99.57
PLN02985		514	squalene monooxygenase	99.57
PRK05868		372	hypothetical protein; Validated	99.55
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.54
PRK06847		375	hypothetical protein; Provisional	99.53
PRK08132		547	FAD-dependent oxidoreductase; Provisional	99.51
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	99.51
PTZ00367		567	squalene epoxidase; Provisional	99.51
PRK06184		502	hypothetical protein; Provisional	99.5
PRK06834		488	hypothetical protein; Provisional	99.47
PRK07190		487	hypothetical protein; Provisional	99.46
PRK06475		400	salicylate hydroxylase; Provisional	99.46
PRK06126		545	hypothetical protein; Provisional	99.43
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	99.4
PRK08294		634	phenol 2-monooxygenase; Provisional	99.37
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	99.35
PRK07236		386	hypothetical protein; Provisional	99.25
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	99.18
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	99.11
PF08491		276	SE: Squalene epoxidase; InterPro: IPR013698 This d	98.96
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	98.93
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	98.89
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	98.88
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	98.85
KOG1298		509	consensus Squalene monooxygenase [Lipid transport	98.81
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	98.81
COG1146		68	Ferredoxin [Energy production and conversion]	98.65
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	98.61
KOG2614		420	consensus Kynurenine 3-monooxygenase and related f	98.61
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	98.59
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	98.59
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	98.54
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	98.53
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	98.52
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	98.51
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	98.49
CHL00065		81	psaC photosystem I subunit VII	98.48
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	98.47
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	98.45
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	98.41
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	98.4
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	98.39
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	98.38
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	98.38
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	98.38
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	98.37
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	98.36
PLN00071		81	photosystem I subunit VII; Provisional	98.34
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	98.33
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	98.31
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	98.31
PRK08222		181	hydrogenase 4 subunit H; Validated	98.31
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	98.3
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	98.29
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	98.29
KOG3256		212	consensus NADH:ubiquinone oxidoreductase, NDUFS8/2	98.28
PRK06273		165	ferredoxin; Provisional	98.25
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	98.23
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	98.22
PRK02651		81	photosystem I subunit VII; Provisional	98.22
PRK05888		164	NADH dehydrogenase subunit I; Provisional	98.2
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	98.18
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	98.18
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	98.16
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	98.14
PRK05113		191	electron transport complex protein RnfB; Provision	98.14
PRK14993		244	tetrathionate reductase subunit B; Provisional	98.11
KOG3855		481	consensus Monooxygenase involved in coenzyme Q (ub	98.1
COG1145		99	NapF Ferredoxin [Energy production and conversion]	98.1
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	98.1
PRK06991		270	ferredoxin; Provisional	98.1
PRK07118		280	ferredoxin; Validated	98.08
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	98.07
PRK08764		135	ferredoxin; Provisional	98.07
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	98.06
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	98.05
PRK10194		163	ferredoxin-type protein; Provisional	98.04
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	98.02
TIGR02066		341	dsrB sulfite reductase, dissimilatory-type beta su	97.99
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	97.99
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	97.99
PRK09898		208	hypothetical protein; Provisional	97.99
PRK10882		328	hydrogenase 2 protein HybA; Provisional	97.97
COG1149		284	MinD superfamily P-loop ATPase containing an inser	97.97
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	97.97
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	97.97
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	97.96
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	97.95
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	97.95
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	97.93
COG2768		354	Uncharacterized Fe-S center protein [General funct	97.93
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	97.91
PRK13409		590	putative ATPase RIL; Provisional	97.88
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	97.85
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	97.84
CHL00014		167	ndhI NADH dehydrogenase subunit I	97.84
PLN02612		567	phytoene desaturase	97.83
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	97.83
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	97.81
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	97.8
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	97.8
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	97.8
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	97.79
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	97.78
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	97.73
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	97.71
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	97.68
PRK10194		163	ferredoxin-type protein; Provisional	97.68
PRK13795		636	hypothetical protein; Provisional	97.67
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	97.62
PRK13984		604	putative oxidoreductase; Provisional	97.61
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	97.61
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	97.6
cd07030		259	RNAP_D D subunit of Archaeal RNA polymerase. The D	97.59
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	97.59
PRK09898		208	hypothetical protein; Provisional	97.59
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	97.58
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	97.56
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	97.52
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	97.51
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	97.47
PRK07233		434	hypothetical protein; Provisional	97.47
PLN02464		627	glycerol-3-phosphate dehydrogenase	97.47
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	97.45
PRK07118		280	ferredoxin; Validated	97.44
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	97.42
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	97.41
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	97.4
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	97.39
PRK09326		341	F420H2 dehydrogenase subunit F; Provisional	97.37
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	97.31
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	97.29
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	97.29
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	97.27
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	97.27
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	97.21
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	97.2
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	97.19
PRK14993		244	tetrathionate reductase subunit B; Provisional	97.18
PRK10882		328	hydrogenase 2 protein HybA; Provisional	97.17
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	97.16
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	97.16
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	97.15
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	97.08
TIGR02064		402	dsrA sulfite reductase, dissimilatory-type alpha s	97.07
PRK08493		819	NADH dehydrogenase subunit G; Validated	97.07
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	97.07
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	97.06
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	97.05
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	96.99
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	96.94
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	96.91
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	96.9
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	96.9
COG0579		429	Predicted dehydrogenase [General function predicti	96.88
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	96.87
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	96.86
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	96.82
PRK11728		393	hydroxyglutarate oxidase; Provisional	96.82
PLN02487		569	zeta-carotene desaturase	96.78
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	96.78
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	96.77
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	96.74
TIGR02486		314	RDH reductive dehalogenase. This model represents	96.73
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	96.68
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	96.63
PRK12839		572	hypothetical protein; Provisional	96.63
PRK08274		466	tricarballylate dehydrogenase; Validated	96.6
PRK07121		492	hypothetical protein; Validated	96.59
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	96.58
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	96.58
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	96.57
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	96.54
PTZ00383		497	malate:quinone oxidoreductase; Provisional	96.54
PRK08275		554	putative oxidoreductase; Provisional	96.53
COG1941		247	FrhG Coenzyme F420-reducing hydrogenase, gamma sub	96.52
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	96.48
PLN02661		357	Putative thiazole synthesis	96.46
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	96.46
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	96.44
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	96.43
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	96.41
PRK05035		695	electron transport complex protein RnfC; Provision	96.39
KOG0063		592	consensus RNAse L inhibitor, ABC superfamily [RNA	96.37
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	96.35
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	96.33
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	96.33
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	96.32
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	96.3
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	96.29
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	96.27
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	96.27
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	96.2
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	96.19
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	96.19
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	96.16
PRK07804		541	L-aspartate oxidase; Provisional	96.15
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	96.15
PRK05257		494	malate:quinone oxidoreductase; Validated	96.07
PLN02676		487	polyamine oxidase	96.04
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	96.02
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	96.01
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	95.99
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	95.98
TIGR01945		435	rnfC electron transport complex, RnfABCDGE type, C	95.94
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	95.94
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	95.94
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.94
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.9
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	95.86
COG1140		513	NarY Nitrate reductase beta subunit [Energy produc	95.86
PRK09129		776	NADH dehydrogenase subunit G; Validated	95.84
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	95.84
PRK07860		797	NADH dehydrogenase subunit G; Validated	95.82
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	95.75
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	95.69
PRK08166		847	NADH dehydrogenase subunit G; Validated	95.68
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	95.68
PRK12842		574	putative succinate dehydrogenase; Reviewed	95.65
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	95.56
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	95.54
PRK12416		463	protoporphyrinogen oxidase; Provisional	95.51
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	95.5
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	95.47
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	95.47
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	95.46
PRK13339		497	malate:quinone oxidoreductase; Reviewed	95.44
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	95.37
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	95.35
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	95.34
PRK13984		604	putative oxidoreductase; Provisional	95.29
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	95.22
PRK08401		466	L-aspartate oxidase; Provisional	95.21
PRK08222		181	hydrogenase 4 subunit H; Validated	95.2
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	95.19
TIGR00314		784	cdhA CO dehydrogenase/acetyl-CoA synthase complex,	95.19
PRK12814		652	putative NADPH-dependent glutamate synthase small	95.17
PRK06175		433	L-aspartate oxidase; Provisional	95.17
COG2081		408	Predicted flavoproteins [General function predicti	95.16
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	95.15
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	95.14
PRK09130		687	NADH dehydrogenase subunit G; Validated	95.1
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	95.02
PLN02976		1713	amine oxidase	95.0
TIGR00273		432	iron-sulfur cluster-binding protein. Members of th	94.96
KOG2852		380	consensus Possible oxidoreductase [General functio	94.95
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	94.9
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	94.9
PRK08071		510	L-aspartate oxidase; Provisional	94.79
PRK09077		536	L-aspartate oxidase; Provisional	94.78
PLN03000		881	amine oxidase	94.76
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	94.74
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	94.71
PTZ00305		297	NADH:ubiquinone oxidoreductase; Provisional	94.7
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	94.7
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	94.68
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	94.63
PRK15033		389	tricarballylate utilization protein B; Provisional	94.58
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	94.56
COG1600		337	Uncharacterized Fe-S protein [Energy production an	94.54
PRK07512		513	L-aspartate oxidase; Provisional	94.54
PRK11883		451	protoporphyrinogen oxidase; Reviewed	94.53
TIGR00275		400	flavoprotein, HI0933 family. The model when search	94.53
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	94.47
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	94.46
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	94.44
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	94.44
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	94.44
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	94.42
COG1145		99	NapF Ferredoxin [Energy production and conversion]	94.42
PRK00941		781	acetyl-CoA decarbonylase/synthase complex subunit	94.37
PRK13030		1159	2-oxoacid ferredoxin oxidoreductase; Provisional	94.27
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	94.24
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	94.23
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	94.21
COG1034		693	NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc	94.2
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	94.15
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	94.12
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	94.12
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	94.1
PLN02815		594	L-aspartate oxidase	94.04
cd01916		731	ACS_1 Acetyl-CoA synthase (ACS), also known as ace	94.01
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	93.99
PRK09193		1165	indolepyruvate ferredoxin oxidoreductase; Validate	93.95
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	93.94
COG4656		529	RnfC Predicted NADH:ubiquinone oxidoreductase, sub	93.89
PRK07395		553	L-aspartate oxidase; Provisional	93.86
COG1139		459	Uncharacterized conserved protein containing a fer	93.84
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	93.82
PRK13029		1186	2-oxoacid ferredoxin oxidoreductase; Provisional	93.78
PRK07570		250	succinate dehydrogenase/fumarate reductase iron-su	93.74
PRK06273		165	ferredoxin; Provisional	93.66
PLN02576		496	protoporphyrinogen oxidase	93.65
PRK05352		448	Na(+)-translocating NADH-quinone reductase subunit	93.63
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	93.56
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	93.45
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	93.36
TIGR00384		220	dhsB succinate dehydrogenase and fumarate reductas	93.36
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	93.32
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	93.26
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	93.26
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	93.23
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	93.15
PLN00071		81	photosystem I subunit VII; Provisional	92.96
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	92.94
TIGR02910		334	sulfite_red_A sulfite reductase, subunit A. Member	92.85
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	92.74
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	92.49
CHL00065		81	psaC photosystem I subunit VII	92.48
COG1141		68	Fer Ferredoxin [Energy production and conversion]	92.47
PF13534		61	Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9	92.45
KOG0042		680	consensus Glycerol-3-phosphate dehydrogenase [Ener	92.43
PLN02268		435	probable polyamine oxidase	92.42
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	92.38
PLN02568		539	polyamine oxidase	92.35
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	92.28
COG1149		284	MinD superfamily P-loop ATPase containing an inser	92.24
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	92.24
PRK05888		164	NADH dehydrogenase subunit I; Provisional	92.19
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	92.15
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	92.15
PRK12576		279	succinate dehydrogenase iron-sulfur subunit; Provi	91.9
PLN02529		738	lysine-specific histone demethylase 1	91.88
TIGR03379		397	glycerol3P_GlpC glycerol-3-phosphate dehydrogenase	91.87
PRK12385		244	fumarate reductase iron-sulfur subunit; Provisiona	91.75
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	91.54
TIGR01936		447	nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo	91.48
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	91.42
PRK15055		344	anaerobic sulfite reductase subunit A; Provisional	91.3
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	91.24
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	91.24
COG1146		68	Ferredoxin [Energy production and conversion]	91.23
PRK11168		396	glpC sn-glycerol-3-phosphate dehydrogenase subunit	91.18
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	90.96
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	90.82
COG1150		195	HdrC Heterodisulfide reductase, subunit C [Energy	90.78
CHL00014		167	ndhI NADH dehydrogenase subunit I	90.74
PRK13977		576	myosin-cross-reactive antigen; Provisional	90.65
TIGR02484		372	CitB CitB domain protein. CobZ is essential for co	90.6
PRK11274		407	glcF glycolate oxidase iron-sulfur subunit; Provis	90.59
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	90.57
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	90.47
COG0348		386	NapH Polyferredoxin [Energy production and convers	90.06
PRK06991		270	ferredoxin; Provisional	89.91
PRK12577		329	succinate dehydrogenase iron-sulfur subunit; Provi	89.89
PRK07208		479	hypothetical protein; Provisional	89.88
PRK02651		81	photosystem I subunit VII; Provisional	89.87
PRK06116		450	glutathione reductase; Validated	89.85
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	89.78
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	89.74
KOG3256		212	consensus NADH:ubiquinone oxidoreductase, NDUFS8/2	89.49
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	89.47
PRK14989		847	nitrite reductase subunit NirD; Provisional	89.3
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	89.05
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	88.89
PRK12386		251	fumarate reductase iron-sulfur subunit; Provisiona	88.83
PRK05950		232	sdhB succinate dehydrogenase iron-sulfur subunit;	88.81
PRK09564		444	coenzyme A disulfide reductase; Reviewed	88.8
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	88.7
PLN02328		808	lysine-specific histone demethylase 1 homolog	88.58
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	88.51
PRK05113		191	electron transport complex protein RnfB; Provision	88.2
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	87.96
PRK06370		463	mercuric reductase; Validated	87.87
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	87.64
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	87.52
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	87.2
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	87.02
PRK08640		249	sdhB succinate dehydrogenase iron-sulfur subunit;	86.98
COG1941		247	FrhG Coenzyme F420-reducing hydrogenase, gamma sub	86.92
COG1141		68	Fer Ferredoxin [Energy production and conversion]	86.82
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	86.67
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	86.49
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	86.11
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	86.1
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	85.94
COG1152		772	CdhA CO dehydrogenase/acetyl-CoA synthase alpha su	85.93
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	85.8
PRK02106		560	choline dehydrogenase; Validated	85.77
PRK12831		464	putative oxidoreductase; Provisional	85.74
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	85.63
KOG0404		322	consensus Thioredoxin reductase [Posttranslational	85.51
COG1035		332	FrhB Coenzyme F420-reducing hydrogenase, beta subu	85.39
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	85.37
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	85.2
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	84.59
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	84.51
PRK06259		486	succinate dehydrogenase/fumarate reductase iron-su	84.51
TIGR02053		463	MerA mercuric reductase. This model represents the	84.42
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	84.11
PRK12575		235	succinate dehydrogenase iron-sulfur subunit; Provi	84.03
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	84.01
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	83.72
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	83.51
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	83.24
PRK09897		534	hypothetical protein; Provisional	83.09
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	83.06
KOG2404		477	consensus Fumarate reductase, flavoprotein subunit	82.9
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	82.51
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	82.3
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	82.19
PRK13795		636	hypothetical protein; Provisional	82.17
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	81.98
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	81.88
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	81.69
PLN00129		276	succinate dehydrogenase [ubiquinone] iron-sulfur s	81.52
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	81.2
cd07032		291	RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA poly	81.16
PLN02507		499	glutathione reductase	81.02
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	80.78
PRK08764		135	ferredoxin; Provisional	80.66
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	80.6
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	80.38

>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion]	Back alignment and domain information

Probab=100.00  E-value=2.6e-131  Score=968.98  Aligned_cols=437  Identities=65%  Similarity=1.144  Sum_probs=426.3

Q ss_pred             ccCCEEEehHHHHHHHHHHHHHCCcEEecCCeEeEEEEcCCCcEEEEEeCCccccCCCCCccCCCCceEEEEcEEEeccC
Q 013495            4 CHNGNRKSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEG   83 (442)
Q Consensus         4 ~~~~y~v~R~~fd~~L~~~Ae~~Gvei~~g~~v~~i~~~~~g~v~gV~t~~~g~~~~G~~~~~~~~g~~i~Ak~vI~AdG   83 (442)
                      -||||+|++.+|-+||.++||++||||+++++++++++++||.|+||.|+|+||++||.||++|++|++++|+++|+|+|
T Consensus       174 NhGNYvv~L~~~v~wLg~kAEe~GvEiyPg~aaSevly~edgsVkGiaT~D~GI~k~G~pKd~FerGme~hak~TifAEG  253 (621)
T KOG2415|consen  174 NHGNYVVSLGQLVRWLGEKAEELGVEIYPGFAASEVLYDEDGSVKGIATNDVGISKDGAPKDTFERGMEFHAKVTIFAEG  253 (621)
T ss_pred             cCCcEEEEHHHHHHHHHHHHHhhCceeccccchhheeEcCCCcEeeEeeccccccCCCCccccccccceecceeEEEecc
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccHHHHHhcCCcccccCCCceEEEEEEEEEeeCCCCCCCCcEEEEecCCCCCCCCceEEEEEcCCCeEEEEEEEec
Q 013495           84 CRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVAL  163 (442)
Q Consensus        84 ~~s~lar~l~~~~gl~~~~~~~~~~~~~g~ke~~~~~~~~~~~g~~~~~~G~pl~~~~~Gggwiy~~~~~~vsVGlv~~~  163 (442)
                      ++++|++|++++|+|+  .++++|+|++|+||+|+++++++++|.+.|++||||+.++|||+|+||+.|++|+||+|+.+
T Consensus       254 c~G~Lskqi~kkf~Lr--~n~e~qtYglGlKEvWei~~~~~~pG~v~HT~GwPl~~~tYGGsFlYh~~d~~VavGlVVgL  331 (621)
T KOG2415|consen  254 CHGSLSKQIIKKFDLR--ENCEPQTYGLGLKEVWEIDPENHNPGEVAHTLGWPLDNDTYGGSFLYHFNDPLVAVGLVVGL  331 (621)
T ss_pred             ccchhHHHHHHHhCcc--cCCCcceeccccceeEecChhhcCCcceeeeccCcccCCccCceeEEEcCCCeEEEEEEEEe
Confidence            9999999999999999  58999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCChHHHHHHHHhCCCcccccCCCeEEeecceeeccCCCccCCccccCCEEEEccCCCcccCcccccHHHHHHHH
Q 013495          164 NYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSG  243 (442)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~~P~i~~~l~~~~~~~~ga~~i~~gg~~~~~~~~~~g~llvGDAAg~vdp~~g~GI~~Am~SG  243 (442)
                      ||+||+++|+++||++|+||.+++.|++|+++.|+||++++||+|++|++++||.+|||++|||+|...++|.|+||+||
T Consensus       332 dY~NP~lsP~~EFQk~K~hP~i~~vleGgk~i~YgARaLNEGGfQsiPkl~FPGG~liGcSaGFlNVpKIKGTHtAMKSG  411 (621)
T KOG2415|consen  332 DYKNPYLSPYKEFQKMKHHPSISKVLEGGKRIAYGARALNEGGFQSIPKLVFPGGALIGCSAGFLNVPKIKGTHTAMKSG  411 (621)
T ss_pred             cCCCCCCCHHHHHHHhhcCcchhhhhcCcceeeehhhhhccCCcccCcccccCCceEeecccccccccccccchhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhcc-C------chHHHHHHHHHHhhhHHHHHHHHchhhhhh--hCChHHHHHHHHHHHHhcCCCCCcccC
Q 013495          244 MLAAEAGFGVLHE-D------SNMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGLEHYILRGKSPYTLKH  314 (442)
Q Consensus       244 ~lAAeai~~al~~-~------~~l~~Y~~~~~~~~~~~el~~~r~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (442)
                      |+|||+|++++.+ .      -.+..|++.++++|+++||+.+||+|+.|+  +|.|+||++++++.++++|+.||||+|
T Consensus       412 mlAAesif~ai~~~~~~k~~~~~~~~Ye~nlkds~V~KeLysvRNirPsf~~~lG~ygGmiySgi~~~~lkG~~PwTLkh  491 (621)
T KOG2415|consen  412 MLAAESIFEAIKGLPQSKMAGLDPTTYEENLKDSYVWKELYSVRNIRPSFHGKLGLYGGMIYSGIFSYVLKGKVPWTLKH  491 (621)
T ss_pred             hhHHHHHHHHHhcCccccccccChhhHHHhhhhhHHHHHHHHhhccCcccccccccccchhhhhhHHHhhcCccceeecc
Confidence            9999999999976 1      236799999999999999999999999997  999999999999999999999999999


Q ss_pred             CCCccccchhhhcCCCCCCCCCCCCcCcCcccceeecCccccCCCCCCeEecCCCCCcccCCCCCccccccccccceEEE
Q 013495          315 GKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEY  394 (442)
Q Consensus       315 ~~~d~~~~~~~~~~~~i~y~~pdg~l~fd~~~~~~~~~~~~~~d~~~Hl~v~d~~~c~~~~~~~~~~~c~~~CPa~~y~~  394 (442)
                      .+.|++.|+|+++++||+||||||+||||.+|||++|||||++|||+||+++|++++...+++.|.+|+.|||||+|||+
T Consensus       492 ~~~D~e~l~pa~k~~pI~YPKPDg~lSFDlltSvs~sgTnH~~dqP~HL~l~~~~ip~~~nf~~y~gpE~rfCPAgVYEy  571 (621)
T KOG2415|consen  492 GKNDHEALKPASKYKPIVYPKPDGVLSFDLLTSVSRSGTNHDEDQPAHLTLRDDDIPVKVNFPVYKGPESRFCPAGVYEY  571 (621)
T ss_pred             CCCchhhccchhhCCCcccCCCCceEEEeecchhhccCCCCCCCCCceeeecCCCcchhcCcccccChhhccCCccceee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCCc--eeEEEecCCCccCCcccccCCCCCeeEECcCCCCCCcccCC
Q 013495          395 VPDEKNQ--LKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM  442 (442)
Q Consensus       395 ~~~~~~~--~~~~i~~~~Ci~Cg~C~~~cp~~~I~w~~p~gg~G~~y~~~  442 (442)
                      +++|.+.  ++++||+||||||+||+|++|.|+|+|++||||+||.|+.|
T Consensus       572 V~dE~~~~~krlqINaQNCiHCKtCDIKdP~QnI~W~vPeGGgGP~Y~~m  621 (621)
T KOG2415|consen  572 VPDEAGPVGKRLQINAQNCIHCKTCDIKDPKQNINWVVPEGGGGPKYTLM  621 (621)
T ss_pred             cccccCCCcceEEEccccceecccccccCcccCceeeCcCCCCCCCcccC
Confidence            8877543  59999999999999999999999999999999999999988

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PF05187 ETF_QO: Electron transfer flavoprotein-ubiquinone oxidoreductase; InterPro: IPR007859 Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>COG2440 FixX Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK15449 ferredoxin-like protein FixX; Provisional	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism]	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only]	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion]	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>COG2768 Uncharacterized Fe-S center protein [General function prediction only]	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>cd07030 RNAP_D D subunit of Archaeal RNA polymerase	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PRK09326 F420H2 dehydrogenase subunit F; Provisional	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK05035 electron transport complex protein RnfC; Provisional	Back alignment and domain information

>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification]	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK08166 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>TIGR00273 iron-sulfur cluster-binding protein	Back alignment and domain information

>KOG2852 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK15033 tricarballylate utilization protein B; Provisional	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated	Back alignment and domain information

>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion]	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>TIGR02910 sulfite_red_A sulfite reductase, subunit A	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>COG1141 Fer Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B	Back alignment and domain information

>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit	Back alignment and domain information

>PRK12385 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PRK15055 anaerobic sulfite reductase subunit A; Provisional	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>TIGR02484 CitB CitB domain protein	Back alignment and domain information

>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>COG0348 NapH Polyferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PRK12386 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>COG1141 Fer Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion]	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>cd07032 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		442
2gmh_A		584	Structure Of Porcine Electron Transfer Flavoprotein		1e-144

>pdb|2GMH|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein- Ubiquinone Oxidoreductase In Complexed With Ubiquinone Length = 584

Back alignment and structure

Iteration: 1

Score = 506 bits (1303), Expect = e-144, Method: Compositional matrix adjust. Identities = 248/444 (55%), Positives = 318/444 (71%), Gaps = 15/444 (3%) Query: 12 LSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGV 71 L LV W+G +AE LGVE+YPG+AA+EIL+ D V GI TND+GI KDG+ K F+RG+ Sbjct: 143 LGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGL 202 Query: 72 ELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILH 131 EL ++T+ AEGC G L+++L K F LR ++ + QTY +G+KE+W IDE K PG + H Sbjct: 203 ELHAKVTIFAEGCHGHLAKQLYKKFDLR--ANCEPQTYGIGLKELWVIDEKKWKPGRVDH 260 Query: 132 TLGWPLDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLL 189 T+GWPLD+ TYGGSFLYH+N+ + +ALG VV L+Y NP+L+P+ EFQ++KHHP+IKP L Sbjct: 261 TVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTL 320 Query: 190 EGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEA 249 EGG + YGAR LNEGG QSIP FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAE+ Sbjct: 321 EGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAES 380 Query: 250 GFGVLHEDS--------NMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGL 299 F L ++ ++ Y D L+ SWVW+EL RN RP+ G+ G+ G+ Sbjct: 381 IFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGI 440 Query: 300 EHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQ 359 ++I RG P+TLKH D + A+ +PIEYPKPDG +SFD+ +S+ S TNHEHDQ Sbjct: 441 FYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQ 500 Query: 360 PAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEK-NQLKLQINAQNCLHCKACD 418 PAHL L+D +P NL Y GPE R+CPA VYE+VP E+ + +LQINAQNC+HCK CD Sbjct: 501 PAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCD 560 Query: 419 IKDPKQNIKWTVPEGGGGPGYSVM 442 IKDP QNI W VPEGGGGP Y+ M Sbjct: 561 IKDPSQNINWVVPEGGGGPAYNGM 584

PyMOL of 2gmh

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		442
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	0.0
3atr_A		453	Conserved archaeal protein; saturating double bond	8e-29
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	8e-15
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	3e-14
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	1e-11
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	3e-08
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	3e-07
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	3e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584	Back alignment and structure

 Score =  651 bits (1682), Expect = 0.0
 Identities = 248/445 (55%), Positives = 315/445 (70%), Gaps = 15/445 (3%)

Query: 11  SLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRG 70
            L  LV W+G +AE LGVE+YPG+AA+EIL+  D  V GI TND+GI KDG+ K  F+RG
Sbjct: 142 RLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERG 201

Query: 71  VELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEIL 130
           +EL  ++T+ AEGC G L+++L K F LR     + QTY +G+KE+W IDE K  PG + 
Sbjct: 202 LELHAKVTIFAEGCHGHLAKQLYKKFDLRANC--EPQTYGIGLKELWVIDEKKWKPGRVD 259

Query: 131 HTLGWPLDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPL 188
           HT+GWPLD+ TYGGSFLYH+N+ +  +ALG VV L+Y NP+L+P+ EFQ++KHHP+IKP 
Sbjct: 260 HTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPT 319

Query: 189 LEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAE 248
           LEGG  + YGAR LNEGG QSIP   FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAE
Sbjct: 320 LEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAE 379

Query: 249 AGFGVLHEDS--------NMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICG 298
           + F  L  ++        ++  Y D L+ SWVW+EL   RN RP+     G+  G+   G
Sbjct: 380 SIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTG 439

Query: 299 LEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHD 358
           + ++I RG  P+TLKH   D +    A+  +PIEYPKPDG +SFD+ +S+  S TNHEHD
Sbjct: 440 IFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHD 499

Query: 359 QPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKN-QLKLQINAQNCLHCKAC 417
           QPAHL L+D  +P   NL  Y GPE R+CPA VYE+VP E+    +LQINAQNC+HCK C
Sbjct: 500 QPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTC 559

Query: 418 DIKDPKQNIKWTVPEGGGGPGYSVM 442
           DIKDP QNI W VPEGGGGP Y+ M
Sbjct: 560 DIKDPSQNINWVVPEGGGGPAYNGM 584

PyMOL of 2gmh

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		442
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	100.0
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	99.96
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	99.93
3atr_A		453	Conserved archaeal protein; saturating double bond	99.92
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	99.9
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	99.88
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	99.81
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	99.8
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	99.75
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	99.74
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	99.72
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	99.71
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	99.71
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	99.7
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	99.7
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	99.7
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	99.69
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	99.69
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	99.69
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	99.64
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	99.63
1pn0_A		665	Phenol 2-monooxygenase; two dimers, TLS refinement	99.62
3c4a_A		381	Probable tryptophan hydroxylase VIOD; alpha-beta p	99.52
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	99.52
4hb9_A		412	Similarities with probable monooxygenase; flavin,	99.49
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	99.47
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	99.46
3ihm_A		430	Styrene monooxygenase A; rossman fold, anti-parall	98.91
1jb0_C		80	Photosystem I iron-sulfur center; membrane protein	98.88
7fd1_A		106	FD1, protein (7-Fe ferredoxin I); electron transpo	98.85
3eun_A		82	Ferredoxin; electron transport, [4Fe-4S] cluster,	98.81
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	98.81
1xer_A		103	Ferredoxin; electron transport, iron-sulfur, dupli	98.79
2fdn_A		55	Ferredoxin; electron transport, iron-sulfur, 4Fe-4	98.79
1dwl_A		59	Ferredoxin I; electron transfer, model, heteronucl	98.79
1bc6_A		77	7-Fe ferredoxin; electron transport, iron-sulfur;	98.77
2fgo_A		82	Ferredoxin; allochromatium vinosum, [4Fe-4S] clust	98.74
1h98_A		78	Ferredoxin; electron transport, thermophilic, iron	98.74
2v2k_A		105	Ferredoxin; iron, transport, iron-sulfur, mycobact	98.7
1rgv_A		80	Ferredoxin; electron transport; 2.90A {Thauera aro	98.69
3gyx_B		166	Adenylylsulfate reductase; oxidoreductase; HET: FA	98.67
1jnr_B		150	Adenylylsulfate reductase; oxidoreductase; HET: FA	98.67
2zvs_A		85	Uncharacterized ferredoxin-like protein YFHL; elec	98.56
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	98.54
3i9v_9		182	NADH-quinone oxidoreductase subunit 9; electron tr	98.51
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	98.46
1dax_A		64	Ferredoxin I; electron transport, electron-transfe	98.46
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	98.41
1rof_A		60	Ferredoxin; electron transport, iron-sulfur; NMR {	98.4
1f2g_A		58	Ferredoxin II; electron transport, FDII desulfovib	98.38
2vpz_B		195	NRFC protein; oxidoreductase, molybdopterin guanin	98.34
1hfe_L		421	Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg	98.32
1iqz_A		81	Ferredoxin; iron-sulfer protein, ultlahigh resolut	98.31
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	98.3
2ivf_B		352	Ethylbenzene dehydrogenase beta-subunit; anaerobic	98.2
3or1_B		386	Sulfite reductase beta; dissimilatory sulfite redu	98.16
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	98.15
3dme_A		369	Conserved exported protein; structural genomics, P	98.15
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	98.14
1ti6_B		274	Pyrogallol hydroxytransferase small subunit; molyb	98.13
1kqf_B		294	FDH-N beta S, formate dehydrogenase, nitrate-induc	98.13
1q16_B		512	Respiratory nitrate reductase 1 beta chain; membra	98.12
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	98.12
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	98.09
1sj1_A		66	Ferredoxin; thermostability, iron-sulfur cluster,	98.05
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	98.04
3mm5_B		366	Sulfite reductase, dissimilatory-type subunit BET;	98.02
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	98.02
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	97.98
2c42_A		1231	Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron,	97.93
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	97.87
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	97.85
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	97.81
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	97.79
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	97.77
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	97.77
3mm5_A		418	Sulfite reductase, dissimilatory-type subunit ALP;	97.72
1ti6_B		274	Pyrogallol hydroxytransferase small subunit; molyb	97.72
1h0h_B		214	Formate dehydrogenase (small subunit); tungsten se	97.67
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	97.64
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	97.64
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	97.53
3or1_A		437	Sulfite reductase alpha; dissimilatory sulfite red	97.52
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	97.5
2ivf_B		352	Ethylbenzene dehydrogenase beta-subunit; anaerobic	97.46
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	97.45
2vpz_B		195	NRFC protein; oxidoreductase, molybdopterin guanin	97.43
3i9v_3		783	NADH-quinone oxidoreductase subunit 3; electron tr	97.39
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	97.33
2cul_A		232	Glucose-inhibited division protein A-related PROT	97.32
1h0h_B		214	Formate dehydrogenase (small subunit); tungsten se	97.29
1q16_B		512	Respiratory nitrate reductase 1 beta chain; membra	97.29
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	97.28
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	97.25
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	97.21
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	97.19
1kqf_B		294	FDH-N beta S, formate dehydrogenase, nitrate-induc	97.17
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	97.17
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	97.16
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	97.12
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	97.04
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	97.0
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	96.97
2pa8_D		265	DNA-directed RNA polymerase subunit D; ferredoxin-	96.92
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	96.91
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	96.85
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	96.83
2bry_A		497	NEDD9 interacting protein with calponin homology a	96.79
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	96.76
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	96.66
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	96.54
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	96.53
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	96.51
1c0p_A		363	D-amino acid oxidase; alpha-beta-alpha motif, flav	96.47
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	96.38
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	96.27
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	96.26
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	96.26
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	96.21
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	96.21
1dwl_A		59	Ferredoxin I; electron transfer, model, heteronucl	96.02
3eun_A		82	Ferredoxin; electron transport, [4Fe-4S] cluster,	95.99
1xer_A		103	Ferredoxin; electron transport, iron-sulfur, dupli	95.96
2bs2_A		660	Quinol-fumarate reductase flavoprotein subunit A;	95.94
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	95.92
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	95.89
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	95.85
1dax_A		64	Ferredoxin I; electron transport, electron-transfe	95.84
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	95.83
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	95.82
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	95.81
3fpz_A		326	Thiazole biosynthetic enzyme; FAD, mitochondrion,	95.79
1jb0_C		80	Photosystem I iron-sulfur center; membrane protein	95.76
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	95.76
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	95.76
1iqz_A		81	Ferredoxin; iron-sulfer protein, ultlahigh resolut	95.65
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	95.61
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	95.58
2zvs_A		85	Uncharacterized ferredoxin-like protein YFHL; elec	95.58
3gyx_A		662	Adenylylsulfate reductase; oxidoreductase; HET: FA	95.56
1sj1_A		66	Ferredoxin; thermostability, iron-sulfur cluster,	95.55
3g3e_A		351	D-amino-acid oxidase; FAD, flavoprotein, oxidoredu	95.52
2fgo_A		82	Ferredoxin; allochromatium vinosum, [4Fe-4S] clust	95.49
1jnr_A		643	Adenylylsulfate reductase; oxidoreductase; HET: FA	95.38
1rgv_A		80	Ferredoxin; electron transport; 2.90A {Thauera aro	95.36
2fdn_A		55	Ferredoxin; electron transport, iron-sulfur, 4Fe-4	95.32
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	95.25
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	95.13
2wdq_B		238	Succinate dehydrogenase iron-sulfur subunit; succi	95.13
1vg0_A		650	RAB proteins geranylgeranyltransferase component A	95.09
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	94.94
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	94.89
1rof_A		60	Ferredoxin; electron transport, iron-sulfur; NMR {	94.8
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	94.76
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	94.7
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	94.7
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	94.67
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	94.65
1f2g_A		58	Ferredoxin II; electron transport, FDII desulfovib	94.53
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	94.44
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	94.42
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	94.41
1bc6_A		77	7-Fe ferredoxin; electron transport, iron-sulfur;	94.37
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	94.36
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	94.31
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	94.25
1kf6_B		243	Fumarate reductase iron-sulfur protein; respiratio	94.05
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	93.95
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	93.93
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	93.86
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	93.81
7fd1_A		106	FD1, protein (7-Fe ferredoxin I); electron transpo	93.76
1h98_A		78	Ferredoxin; electron transport, thermophilic, iron	93.76
3i9v_9		182	NADH-quinone oxidoreductase subunit 9; electron tr	93.63
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	93.62
2h88_B		252	Succinate dehydrogenase IP subunit; complex II, me	93.59
2c42_A		1231	Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron,	93.5
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	93.32
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	93.25
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	93.15
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	93.13
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	93.04
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	93.03
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	92.97
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	92.83
2v2k_A		105	Ferredoxin; iron, transport, iron-sulfur, mycobact	92.83
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	92.8
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	92.58
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	92.51
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	92.48
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	92.42
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	92.39
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	92.27
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	92.25
1fec_A		490	Trypanothione reductase; redox-active center, oxid	92.23
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	92.02
4dna_A		463	Probable glutathione reductase; structural genomic	91.91
3cf4_A		807	Acetyl-COA decarboxylase/synthase alpha subunit; m	91.9
1hfe_L		421	Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg	91.88
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	91.77
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	91.46
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	91.27
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	91.16
2bs2_B		241	Quinol-fumarate reductase iron-sulfur subunit B; 2	91.14
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	91.11
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	91.0
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	90.63
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	90.41
4b63_A		501	L-ornithine N5 monooxygenase; oxidoreductase, side	90.25
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	90.11
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	89.91
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	89.83
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	89.16
3vr8_B		282	Iron-sulfur subunit of succinate dehydrogenase; me	89.13
3qvp_A		583	Glucose oxidase; oxidoreductase; HET: NAG BMA MAN	88.98
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	88.87
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	88.84
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	88.56
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	88.56
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	88.27
1gpe_A		587	Protein (glucose oxidase); oxidoreductase(flavopro	88.26
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	88.22
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	88.14
1ju2_A		536	HydroxynitrIle lyase; flavin, GMC oxidoreductase,	88.12
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	87.85
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	87.26
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	87.13
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	87.05
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	86.75
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	86.74
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	86.58
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	86.58
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	85.78
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	85.77
3r9u_A		315	Thioredoxin reductase; structural genomics, center	85.5
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	85.48
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	85.28
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	84.89
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	84.77
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	84.75
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	83.59
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	83.0
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	82.68
3r9u_A		315	Thioredoxin reductase; structural genomics, center	82.2
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	82.0
3fim_B		566	ARYL-alcohol oxidase; AAO, lignin degradation, oxi	81.6
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	81.5
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	81.21
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	80.69
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	80.18

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

Probab=100.00  E-value=1.3e-90  Score=745.43  Aligned_cols=436  Identities=57%  Similarity=1.060  Sum_probs=401.8

Q ss_pred             cCCEEEehHHHHHHHHHHHHHCCcEEecCCeEeEEEEcCCCcEEEEEeCCccccCCCCCccCCCCceEEEEcEEEeccCC
Q 013495            5 HNGNRKSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGC   84 (442)
Q Consensus         5 ~~~y~v~R~~fd~~L~~~Ae~~Gvei~~g~~v~~i~~~~~g~v~gV~t~~~g~~~~G~~~~~~~~g~~i~Ak~vI~AdG~   84 (442)
                      +++|+++|..|++||.++|++.||+|+++++|++++.+++|.|++|++.++|++++|+++++|+++.+++||+||+|||+
T Consensus       136 ~~~~~v~r~~l~~~L~~~a~~~Gv~i~~g~~v~~l~~~~~g~V~gV~~~~~g~~~~G~~~~~~~~g~~i~Ad~VV~AdG~  215 (584)
T 2gmh_A          136 HGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTIFAEGC  215 (584)
T ss_dssp             TTCEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSEEEEEECCEEECTTSCEEEEEECCCEEECSEEEECCCT
T ss_pred             CCCEEEeHHHHHHHHHHHHHHcCCEEEcCCEEEEEEEcCCCCEEEEEeCCccccCCCCcccccCCceEEECCEEEEeeCC
Confidence            46899999999999999999999999999999999998778899999999999999999999999999999999999999


Q ss_pred             CCcccHHHHHhcCCcccccCCCceEEEEEEEEEeeCCCCCCCCcEEEEecCCCCCCCCceEEEEEcC--CCeEEEEEEEe
Q 013495           85 RGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMN--DRQIALGLVVA  162 (442)
Q Consensus        85 ~s~lar~l~~~~gl~~~~~~~~~~~~~g~ke~~~~~~~~~~~g~~~~~~G~pl~~~~~Gggwiy~~~--~~~vsVGlv~~  162 (442)
                      +|.++++|+++++++  ....++.+++|++++|+++...+.++.+.|++|||+....+|++|+|+.+  ++.++||+++.
T Consensus       216 ~S~vr~~l~~~~gl~--~~~~p~~~g~g~~~~~~v~~~~~~~~~~~~~~g~~~~~~~~gg~~~~~~~~~~~~~~vg~~~~  293 (584)
T 2gmh_A          216 HGHLAKQLYKKFDLR--ANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVG  293 (584)
T ss_dssp             TCHHHHHHHHHTTTT--TTSCCCCEEEEEEEEEECCGGGCCTTEEEEEEETTSCTTSCEEEEEEECCSSSCEEEEEEEEE
T ss_pred             CchHHHHHHHHhCCC--CCCCchhHHhhhhhheecCcccccCCeEEEEEeccccCCcCCceEEEEecCCCCeEEEEEEEe
Confidence            999999999999987  35567888999999998887767788889999999875577889999998  78999999998


Q ss_pred             cCCCCCCCChHHHHHHHHhCCCcccccCCCeEEeecceeeccCCCccCCccccCCEEEEccCCCcccCcccccHHHHHHH
Q 013495          163 LNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKS  242 (442)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~P~i~~~l~~~~~~~~ga~~i~~gg~~~~~~~~~~g~llvGDAAg~vdp~~g~GI~~Am~S  242 (442)
                      .++.++.+++.++|++|++||.+++++++++++.++++.++.++++.+++++.+|++||||||++++|+.|+|+++||.+
T Consensus       294 ~~~~~~~~~~~~~l~~~~~~p~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~rv~LvGDAAh~~~P~~GqG~~~Ai~d  373 (584)
T 2gmh_A          294 LDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKS  373 (584)
T ss_dssp             TTCCCTTCCHHHHHHHHTTSTTTHHHHTTCEEEEEEEEEEECCGGGGCCCCEETTEEECTTTTCCCBTTTTBCHHHHHHH
T ss_pred             cCcccccCChHHHHHHHHhChHHHHHhCCCeEEEecceEccCCCcccCCccccCCEEEEcccccccCccccccHHHHHHH
Confidence            88777777888999999999999999999999999999999988888889999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhcc-----Cch---HHHHHHHHHHhhhHHHHHHHHchhhhhh-h-CChHHHHHHHHHHHHhcCCCCCcc
Q 013495          243 GMLAAEAGFGVLHE-----DSN---MEIYWDTLQKSWVWQELQRARNYRPAFE-Y-GLLPGLAICGLEHYILRGKSPYTL  312 (442)
Q Consensus       243 G~lAAeai~~al~~-----~~~---l~~Y~~~~~~~~~~~el~~~r~~~~~~~-~-~~~~~~~~~~~~~~~~~~~~~~~~  312 (442)
                      |+++|++|.+++..     ..+   |+.|++.++.+|+++||+.+|+++++|+ + |.|++|++.++++|+++|+.||||
T Consensus       374 a~~LA~~L~~~~~~g~~~~~~a~~~L~~Ye~~r~~~~v~~~l~~~r~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~  453 (584)
T 2gmh_A          374 GTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTL  453 (584)
T ss_dssp             HHHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTTTTGGGGSTTTHHHHHHHHHHHTTTTTTCCSCCC
T ss_pred             HHHHHHHHHHHHHcCCcchhhhhhhHHHHHHHHHHhHHHHHHHHHhChhHHHHHhhccHHHHHHHHHHHHHcCCCCCCcc
Confidence            99999999998853     232   8999999999999999999999999886 3 999999999999999999999999


Q ss_pred             cCCCCccccchhhhcCCCCCCCCCCCCcCcCcccceeecCccccCCCCCCeEecCCCCCcccCCCCCccccccccccceE
Q 013495          313 KHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVY  392 (442)
Q Consensus       313 ~~~~~d~~~~~~~~~~~~i~y~~pdg~l~fd~~~~~~~~~~~~~~d~~~Hl~v~d~~~c~~~~~~~~~~~c~~~CPa~~y  392 (442)
                      +|.++||.+++|+++++||+||||||+||||+||||++|||||+||||+||+|+|+++|...|++.|+++|+++|||+||
T Consensus       454 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hl~~~d~~~~~~~~~~~~~~~c~~~CPa~~~  533 (584)
T 2gmh_A          454 KHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVY  533 (584)
T ss_dssp             CCCSCGGGCCCCGGGSCCCCCCCCCSSSSCCHHHHHHTTTCBCCSSSCCSEEESSTTHHHHTHHHHHCCTHHHHCTTCCE
T ss_pred             CCCCCCchhhhhHHhcCCCCCCCccccccccccchhhhccccccCCCCCeEEEcCcccchhhchhhhcchhhhcCChhhE
Confidence            99999999999999999999999999999999999999999999999999999999999777777888999999999999


Q ss_pred             EEecCCCCc-eeEEEecCCCccCCcccccCCCCCeeEECcCCCCCCcccCC
Q 013495          393 EYVPDEKNQ-LKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM  442 (442)
Q Consensus       393 ~~~~~~~~~-~~~~i~~~~Ci~Cg~C~~~cp~~~I~w~~p~gg~G~~y~~~  442 (442)
                      ++++++++. .+++||+++|+|||||+++||+++|+|++|+||+||+|++|
T Consensus       534 ~~~~~~~~~~~~~~i~~~~Ci~C~~C~~~cp~~~i~~~~p~gg~g~~~~~~  584 (584)
T 2gmh_A          534 EFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  584 (584)
T ss_dssp             EEEECSSTTCEEEEECGGGCCCCCHHHHHCTTCCEEECCCSTTCBCCCSCC
T ss_pred             EEeecCCCCceEEEEeCCCCcCCCCchhhCCCCCceeECCCCCCCcCccCC
Confidence            995432332 27999999999999999999999999999999999999998

PyMOL of 2gmh

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A*	Back alignment and structure

>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472}	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida}	Back alignment and structure

>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C*	Back alignment and structure

>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ...	Back alignment and structure

>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A	Back alignment and structure

>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A	Back alignment and structure

>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1	Back alignment and structure

>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A	Back alignment and structure

>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa}	Back alignment and structure

>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2	Back alignment and structure

>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis}	Back alignment and structure

>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1	Back alignment and structure

>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B*	Back alignment and structure

>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli}	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9*	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A	Back alignment and structure

>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A	Back alignment and structure

>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B*	Back alignment and structure

>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A*	Back alignment and structure

>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A*	Back alignment and structure

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum}	Back alignment and structure

>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B*	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N*	Back alignment and structure

>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B*	Back alignment and structure

>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B*	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B*	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A*	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A*	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A*	Back alignment and structure

>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N*	Back alignment and structure

>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A*	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum}	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B*	Back alignment and structure

>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3*	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5	Back alignment and structure

>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B*	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B*	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A*	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A*	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ...	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1	Back alignment and structure

>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A	Back alignment and structure

>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A	Back alignment and structure

>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A*	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae}	Back alignment and structure

>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C*	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli}	Back alignment and structure

>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A	Back alignment and structure

>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A*	Back alignment and structure

>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa}	Back alignment and structure

>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A*	Back alignment and structure

>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1	Back alignment and structure

>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B*	Back alignment and structure

>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R*	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B*	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ...	Back alignment and structure

>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2	Back alignment and structure

>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ...	Back alignment and structure

>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis}	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri}	Back alignment and structure

>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B*	Back alignment and structure

>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A*	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A*	Back alignment and structure

>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii}	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		442
d2gmha1		380	c.3.1.2 (A:4-236,A:336-482) Electron transfer flav	1e-47
d2gmha1		380	c.3.1.2 (A:4-236,A:336-482) Electron transfer flav	1e-11
d2gmha3		102	d.58.1.6 (A:483-584) Electron transfer flavoprotei	2e-46
d2gmha2		99	d.16.1.8 (A:237-335) Electron transfer flavoprotei	1e-41
d2gjca1		311	c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th	2e-05
d1rp0a1		278	c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi	0.003

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  165 bits (419), Expect = 1e-47
 Identities = 71/146 (48%), Positives = 90/146 (61%), Gaps = 10/146 (6%)

Query: 206 GLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNME---- 261
           G QSIP   FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAE+ F  L  ++       
Sbjct: 235 GFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIG 294

Query: 262 ----IYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGLEHYILRGKSPYTLKHG 315
                Y D L+ SWVW+EL   RN RP+     G+  G+   G+ ++I RG  P+TLKH 
Sbjct: 295 LHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHK 354

Query: 316 KPDHEATDAARLHSPIEYPKPDGVLS 341
             D +    A+  +PIEYPKPDG +S
Sbjct: 355 GSDSDQLKPAKDCTPIEYPKPDGQIS 380

PyMOL of d2gmha1

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380	Back information, alignment and structure

>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 102	Back information, alignment and structure

>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 99	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311	Back information, alignment and structure

>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		442
d2gmha1		380	Electron transfer flavoprotein-ubiquinone oxidored	100.0
d2gmha3		102	Electron transfer flavoprotein-ubiquinone oxidored	100.0
d2gmha2		99	Electron transfer flavoprotein-ubiquinone oxidored	99.93
d1bc6a_		77	Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	99.07
d1h98a_		77	Ferredoxin {Thermus thermophilus [TaxId: 274]}	99.05
d1blua_		80	Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	98.94
d2fdna_		55	Ferredoxin II {Clostridium acidurici [TaxId: 1556]	98.93
d7fd1a_		106	Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	98.92
d1xera_		103	Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	98.9
d1jnrb_		149	Adenylylsulfate reductase B subunit {Archaeon Arch	98.87
d1hfel2		85	Fe-only hydrogenase larger subunit, N-domain {Desu	98.86
d1jb0c_		80	Photosystem I iron-sulfur protein PsaC {Synechococ	98.83
d1dura_		55	Ferredoxin II {Peptostreptococcus asaccharolyticus	98.81
d3c7bb1		65	DsrB insert domain {Archaeoglobus fulgidus [TaxId:	98.78
d1rgva_		80	Ferredoxin II {Thauera aromatica [TaxId: 59405]}	98.74
d2fug91		154	NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus	98.64
d1vjwa_		59	Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	98.54
d1gtea5		173	Dihydropyrimidine dehydrogenase, C-terminal domain	98.5
d1y5ib1		509	Respiratory nitrate reductase 1 beta chain {Escher	98.39
d1kqfb1		244	Formate dehydrogenase N, iron-sulfur (beta) subuni	98.38
d2c42a5		117	Pyruvate-ferredoxin oxidoreductase, PFOR, domain V	98.35
d3c8ya3		83	Fe-only hydrogenase, second domain {Clostridium pa	98.3
d1fxra_		64	Ferredoxin I {Sulfate-reducing bacteria (Desulfovi	98.3
d1vlfn2		195	Transhydroxylase beta subunit, BthL, N-terminal do	98.24
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	98.1
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	98.08
d1iqza_		81	Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1	98.08
d1sj1a_		66	Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI	98.05
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	98.03
d1fxda_		58	Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	98.03
d1pn0a1		360	Phenol hydroxylase {Soil-living yeast (Trichosporo	98.03
d3c96a1		288	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	97.96
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	97.92
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	97.77
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	97.58
d1neka2		330	Succinate dehydogenase {Escherichia coli [TaxId: 5	97.53
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	97.48
d2fug34		151	NADH-quinone oxidoreductase chain 3, Nqo3, domain	97.47
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	97.33
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	97.24
d1vlfn2		195	Transhydroxylase beta subunit, BthL, N-terminal do	97.12
d2v4jb1		69	DsrB insert domain {Desulfovibrio vulgaris [TaxId:	97.11
d1y5ib1		509	Respiratory nitrate reductase 1 beta chain {Escher	96.95
d1h0hb_		214	Tungsten containing formate dehydrogenase, small s	96.93
d1kqfb1		244	Formate dehydrogenase N, iron-sulfur (beta) subuni	96.89
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	96.76
d1hfel2		85	Fe-only hydrogenase larger subunit, N-domain {Desu	96.71
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	96.48
d1blua_		80	Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	96.45
d1xera_		103	Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	96.37
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	96.3
d3c7ba1		66	DsrA insert domain {Archaeoglobus fulgidus [TaxId:	96.28
d1jb0c_		80	Photosystem I iron-sulfur protein PsaC {Synechococ	96.27
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	96.25
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	96.24
d2fdna_		55	Ferredoxin II {Clostridium acidurici [TaxId: 1556]	96.22
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	96.21
d1kf6a2		311	Fumarate reductase {Escherichia coli [TaxId: 562]}	96.19
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	96.0
d2v4ja1		81	DsrA insert domain {Desulfovibrio vulgaris [TaxId:	95.94
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	95.86
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	95.78
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	95.68
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	95.6
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	95.55
d1rgva_		80	Ferredoxin II {Thauera aromatica [TaxId: 59405]}	95.44
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	95.34
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	95.25
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	95.18
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	95.17
d1dura_		55	Ferredoxin II {Peptostreptococcus asaccharolyticus	95.11
d1vjwa_		59	Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	94.95
d2c42a5		117	Pyruvate-ferredoxin oxidoreductase, PFOR, domain V	94.87
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	94.86
d1fxra_		64	Ferredoxin I {Sulfate-reducing bacteria (Desulfovi	94.75
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	94.72
d1bc6a_		77	Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	94.72
d1h0hb_		214	Tungsten containing formate dehydrogenase, small s	94.61
d1sj1a_		66	Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI	94.57
d3c8ya3		83	Fe-only hydrogenase, second domain {Clostridium pa	94.18
d1h98a_		77	Ferredoxin {Thermus thermophilus [TaxId: 274]}	94.17
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	93.94
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	93.57
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	93.44
d1rp0a1		278	Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara	93.3
d2bs2b1		133	Fumarate reductase {Wolinella succinogenes [TaxId:	93.05
d2cula1		230	GidA-related protein TTHA1897 {Thermus thermophilu	92.82
d7fd1a_		106	Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	92.72
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	92.71
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	92.45
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	92.3
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	92.23
d2fug91		154	NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus	92.22
d1chua2		305	L-aspartate oxidase {Escherichia coli [TaxId: 562]	92.17
d1gtea5		173	Dihydropyrimidine dehydrogenase, C-terminal domain	91.94
d1iqza_		81	Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1	91.53
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	91.28
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	91.25
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	90.97
d1kf6b1		138	Fumarate reductase {Escherichia coli [TaxId: 562]}	90.8
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	89.93
d1nekb1		132	Succinate dehydogenase {Escherichia coli [TaxId: 5	89.91
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	89.83
d1fxda_		58	Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	89.81
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	89.44
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	89.09
d1kdga1		360	Flavoprotein domain of flavocytochrome cellobiose	85.81
d1cf3a1		385	Glucose oxidase {Aspergillus niger [TaxId: 5061]}	85.79
d1jnrb_		149	Adenylylsulfate reductase B subunit {Archaeon Arch	84.72
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	84.51
d1gtea3		153	Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su	83.86
d3c7bb1		65	DsrB insert domain {Archaeoglobus fulgidus [TaxId:	82.97
d1nekb1		132	Succinate dehydogenase {Escherichia coli [TaxId: 5	82.73
d1gpea1		391	Glucose oxidase {Penicillium amagasakiense [TaxId:	82.64
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	81.95
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	81.38
d2bs2b1		133	Fumarate reductase {Wolinella succinogenes [TaxId:	80.27

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=8.8e-45  Score=367.97  Aligned_cols=239  Identities=51%  Similarity=0.916  Sum_probs=218.8

Q ss_pred             ccCCEEEehHHHHHHHHHHHHHCCcEEecCCeEeEEEEcCCCcEEEEEeCCccccCCCCCccCCCCceEEEEcEEEeccC
Q 013495            4 CHNGNRKSLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEG   83 (442)
Q Consensus         4 ~~~~y~v~R~~fd~~L~~~Ae~~Gvei~~g~~v~~i~~~~~g~v~gV~t~~~g~~~~G~~~~~~~~g~~i~Ak~vI~AdG   83 (442)
                      .+++|++.|..||+||+++|+++|++++.++.+.+++.++++.+.++.+.++++++++.+++.+.++..+.++++|+++|
T Consensus       132 ~~~~~~~~~~~~~~~l~~~Ae~~g~~~~~~~~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~G  211 (380)
T d2gmha1         132 NHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTIFAEG  211 (380)
T ss_dssp             CTTCEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSEEEEEECCEEECTTSCEEEEEECCCEEECSEEEECCC
T ss_pred             cccceeehhhHHHHHHHHHHhhccceeeeecceeeeeeccCCceeecccccccccccccccccccccccccccEEEEeee
Confidence            46789999999999999999999999999999999999888999999999999999999999999999999999999999


Q ss_pred             CCCcccHHHHHhcCCcccccCCCceEEEEEEEEEeeCCCCCCCCcEEEEecCCCCCCCCceEEEEEcCCCeEEEEEEEec
Q 013495           84 CRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVAL  163 (442)
Q Consensus        84 ~~s~lar~l~~~~gl~~~~~~~~~~~~~g~ke~~~~~~~~~~~g~~~~~~G~pl~~~~~Gggwiy~~~~~~vsVGlv~~~  163 (442)
                      +++++.+++++.+.+..  ..                                                           
T Consensus       212 ~~G~l~k~li~~~~l~~--~~-----------------------------------------------------------  230 (380)
T d2gmha1         212 CHGHLAKQLYKKFDLRA--NC-----------------------------------------------------------  230 (380)
T ss_dssp             TTCHHHHHHHHHTTTTT--TS-----------------------------------------------------------
T ss_pred             CCCcchHHHHhhhhhcc--cc-----------------------------------------------------------
Confidence            99999998877665441  00                                                           


Q ss_pred             CCCCCCCChHHHHHHHHhCCCcccccCCCeEEeecceeeccCCCccCCccccCCEEEEccCCCcccCcccccHHHHHHHH
Q 013495          164 NYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSG  243 (442)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~~P~i~~~l~~~~~~~~ga~~i~~gg~~~~~~~~~~g~llvGDAAg~vdp~~g~GI~~Am~SG  243 (442)
                                                            ++.+|++++|++++||++|||||||++||++++||++||+||
T Consensus       231 --------------------------------------~~~~G~~sip~l~~~G~lLVGDAAG~vnP~~g~GI~~Am~SG  272 (380)
T d2gmha1         231 --------------------------------------EPQGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSG  272 (380)
T ss_dssp             --------------------------------------CCCCGGGGCCCCEETTEEECTTTTCCCBTTTTBCHHHHHHHH
T ss_pred             --------------------------------------ccccccccccccccCCeeEEeccccccchhhcCCeeeeeccH
Confidence                                                  112355667899999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhcc--------CchHHHHHHHHHHhhhHHHHHHHHchhhhhh--hCChHHHHHHHHHHHHhcCCCCCccc
Q 013495          244 MLAAEAGFGVLHE--------DSNMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGLEHYILRGKSPYTLK  313 (442)
Q Consensus       244 ~lAAeai~~al~~--------~~~l~~Y~~~~~~~~~~~el~~~r~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (442)
                      ++|||+|++++..        ...+..|++.+++||+++||+.+||+++.|+  +|+|.|++++++++++++|+.||||+
T Consensus       273 ~lAAeai~~al~~~~~~~~~~~~~~~~y~~~~~~s~~~~eL~~~rn~~~~~~~~~g~~~g~~~~~~~~~~~~g~~p~tl~  352 (380)
T d2gmha1         273 TLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTLK  352 (380)
T ss_dssp             HHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTTTTGGGGSTTTHHHHHHHHHHHTTTTTTCCSCCCC
T ss_pred             HHHHHHHHHHHHcCCcccchhhhhhhhHHHHHHhhHHHHHHHHhhCCCHHHHhhchHHHHHHHHHHHHHHhCCCCCccCC
Confidence            9999999999975        1337889999999999999999999999996  69999999999999999999999999


Q ss_pred             CCCCccccchhhhcCCCCCCCCCCCCcC
Q 013495          314 HGKPDHEATDAARLHSPIEYPKPDGVLS  341 (442)
Q Consensus       314 ~~~~d~~~~~~~~~~~~i~y~~pdg~l~  341 (442)
                      |.++||++|+|++.++||+||||||+||
T Consensus       353 ~~~~d~~~l~~~~~~~~i~y~~~d~~~~  380 (380)
T d2gmha1         353 HKGSDSDQLKPAKDCTPIEYPKPDGQIS  380 (380)
T ss_dssp             CCSCGGGCCCCGGGSCCCCCCCCCSSSS
T ss_pred             CCCCCHHHHHHHHhCCCCCCCCCCCccC
Confidence            9999999999999999999999999997

PyMOL of d2gmha1

>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	Back information, alignment and structure

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	Back information, alignment and structure

>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]}	Back information, alignment and structure

>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	Back information, alignment and structure

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}	Back information, alignment and structure

>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]}	Back information, alignment and structure

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}	Back information, alignment and structure

>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}	Back information, alignment and structure

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}	Back information, alignment and structure

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}	Back information, alignment and structure

>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}	Back information, alignment and structure

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}	Back information, alignment and structure

>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	Back information, alignment and structure

>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	Back information, alignment and structure

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2v4ja1 d.58.1.5 (A:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}	Back information, alignment and structure

>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	Back information, alignment and structure

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure