Citrus Sinensis ID: 013502
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 442 | ||||||
| 73587480 | 505 | beclin 1 protein [Malus x domestica] | 0.846 | 0.740 | 0.812 | 0.0 | |
| 225454518 | 522 | PREDICTED: beclin 1 protein [Vitis vinif | 0.864 | 0.731 | 0.820 | 0.0 | |
| 73587486 | 479 | beclin 1 protein [Vitis vinifera] | 0.864 | 0.797 | 0.820 | 0.0 | |
| 224067974 | 516 | predicted protein [Populus trichocarpa] | 0.871 | 0.746 | 0.821 | 0.0 | |
| 73587476 | 511 | beclin 1 protein [Gossypium raimondii] | 0.871 | 0.753 | 0.836 | 1e-180 | |
| 255564727 | 523 | Beclin-1, putative [Ricinus communis] gi | 0.871 | 0.736 | 0.833 | 1e-179 | |
| 351724517 | 509 | beclin 1 protein [Glycine max] gi|735874 | 0.861 | 0.748 | 0.787 | 1e-172 | |
| 357456733 | 517 | Beclin 1 protein [Medicago truncatula] g | 0.859 | 0.735 | 0.803 | 1e-171 | |
| 357456731 | 567 | Beclin 1 protein [Medicago truncatula] g | 0.859 | 0.670 | 0.694 | 1e-170 | |
| 73587484 | 522 | beclin 1 protein [Solanum tuberosum] | 0.855 | 0.724 | 0.783 | 1e-170 |
| >gi|73587480|emb|CAJ27522.1| beclin 1 protein [Malus x domestica] | Back alignment and taxonomy information |
|---|
Score = 657 bits (1694), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 307/378 (81%), Positives = 342/378 (90%), Gaps = 4/378 (1%)
Query: 8 DKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGST 67
++GR+ +VDPNVPR+VCQNCR+ LC+VG DSYA+K+ +D SRS M GSS+H + SVL S
Sbjct: 3 ERGRSFTVDPNVPRYVCQNCRNSLCVVGADSYAEKFFHDFSRSGMQGSSMHGATSVLSSM 62
Query: 68 RMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHI 127
RMDNSFVVLP+QR Q GVPPRPRG + + SG AMDESFVV+ KSES++DGGG H+
Sbjct: 63 RMDNSFVVLPQQRAQ--GVPPRPRGGAVNT--GHSGNAMDESFVVVNKSESSADGGGAHL 118
Query: 128 PPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDD 187
P P+GG NGP+QPNNSGFHSTI++LKRAFEIA++QTQVEQPLC+ECMRVLSDKLDKEV+D
Sbjct: 119 PSPDGGPNGPLQPNNSGFHSTISLLKRAFEIASTQTQVEQPLCVECMRVLSDKLDKEVED 178
Query: 188 VTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAEL 247
V RDI+AYEACL+RLEGE R+VLSE DFLKEKLKIEEE+RKLEA IEE EKQNAEVN EL
Sbjct: 179 VNRDIKAYEACLKRLEGETREVLSETDFLKEKLKIEEEQRKLEAEIEEMEKQNAEVNNEL 238
Query: 248 KELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 307
K LELKS RFKELEE+YW +FNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND
Sbjct: 239 KGLELKSSRFKELEEQYWHKFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 298
Query: 308 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKII 367
AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKF YRIKI+
Sbjct: 299 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFQYRIKIL 358
Query: 368 PMGSYPRIMDSNNNTYEL 385
PMGSYPRIMD+NNNTYEL
Sbjct: 359 PMGSYPRIMDNNNNTYEL 376
|
Source: Malus x domestica Species: Malus x domestica Genus: Malus Family: Rosaceae Order: Rosales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225454518|ref|XP_002277370.1| PREDICTED: beclin 1 protein [Vitis vinifera] gi|297745431|emb|CBI40511.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|73587486|emb|CAJ27525.1| beclin 1 protein [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224067974|ref|XP_002302626.1| predicted protein [Populus trichocarpa] gi|222844352|gb|EEE81899.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|73587476|emb|CAJ27520.1| beclin 1 protein [Gossypium raimondii] | Back alignment and taxonomy information |
|---|
| >gi|255564727|ref|XP_002523358.1| Beclin-1, putative [Ricinus communis] gi|223537446|gb|EEF39074.1| Beclin-1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351724517|ref|NP_001238340.1| beclin 1 protein [Glycine max] gi|73587474|emb|CAJ27519.1| beclin 1 protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357456733|ref|XP_003598647.1| Beclin 1 protein [Medicago truncatula] gi|355487695|gb|AES68898.1| Beclin 1 protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357456731|ref|XP_003598646.1| Beclin 1 protein [Medicago truncatula] gi|355487694|gb|AES68897.1| Beclin 1 protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|73587484|emb|CAJ27524.1| beclin 1 protein [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 442 | ||||||
| TAIR|locus:2076715 | 517 | ATG6 "AT3G61710" [Arabidopsis | 0.871 | 0.744 | 0.687 | 2.1e-141 | |
| MGI|MGI:1891828 | 448 | Becn1 "beclin 1, autophagy rel | 0.515 | 0.508 | 0.356 | 1.1e-37 | |
| UNIPROTKB|Q14457 | 450 | BECN1 "Beclin-1" [Homo sapiens | 0.515 | 0.506 | 0.351 | 1.9e-37 | |
| UNIPROTKB|Q4A1L4 | 448 | BECN1 "Beclin-1" [Bos taurus ( | 0.515 | 0.508 | 0.351 | 2.4e-37 | |
| UNIPROTKB|E2RNW7 | 463 | AARSD1 "Uncharacterized protei | 0.515 | 0.492 | 0.351 | 2.4e-37 | |
| UNIPROTKB|Q4A1L5 | 448 | BECN1 "Beclin-1" [Sus scrofa ( | 0.515 | 0.508 | 0.351 | 2.4e-37 | |
| UNIPROTKB|Q5R878 | 450 | BECN1 "Beclin-1" [Pongo abelii | 0.515 | 0.506 | 0.351 | 2.4e-37 | |
| UNIPROTKB|F1S1F6 | 448 | BECN1 "Beclin-1" [Sus scrofa ( | 0.515 | 0.508 | 0.351 | 6.3e-37 | |
| RGD|620190 | 448 | Becn1 "beclin 1, autophagy rel | 0.515 | 0.508 | 0.351 | 8e-37 | |
| UNIPROTKB|E1C9A1 | 449 | BECN1 "Beclin-1" [Gallus gallu | 0.529 | 0.521 | 0.347 | 1.3e-36 |
| TAIR|locus:2076715 ATG6 "AT3G61710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1383 (491.9 bits), Expect = 2.1e-141, P = 2.1e-141
Identities = 266/387 (68%), Positives = 297/387 (76%)
Query: 1 MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHAS 60
M+KE+ PDK RT+ +DPN+P+WVCQNC H L IVGVDSYA K+ ND S GSSIH +
Sbjct: 1 MRKEEIPDKSRTIPIDPNLPKWVCQNCHHSLTIVGVDSYAGKFFNDPPPSATQGSSIHGA 60
Query: 61 NSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRXXXXXX-XXXXXXKAMDESFVVIYKSES 118
NSVLGSTRMDNSFVVLP+ +P QS G+PPRPR KAM+ESFVV+YKSE
Sbjct: 61 NSVLGSTRMDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEP 120
Query: 119 ASDXXXXXXXXXXXXTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLS 178
SD NGP+ N SGF++TI VL RAF+IA +QTQVEQPLCLECMRVLS
Sbjct: 121 VSDSGGSHNLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLS 180
Query: 179 DKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLXXXXXXXXXXXXXXXXXXXXXK 238
DKL+KEV+DVTRD+EAYEAC+QRLEGE +DVLSEADFL K
Sbjct: 181 DKLEKEVEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEK 240
Query: 239 QNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLEL 298
QNAEVN +LKELE K RF ELE+RYWQEFNNFQFQLIAHQEERDAI +KIEVSQAHLEL
Sbjct: 241 QNAEVNHQLKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLEL 300
Query: 299 LKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRP 358
L +TNVL DAFPI +DGEFGTINNFRLGRLP I VEWDEINAAWGQACLLLHTMC YFRP
Sbjct: 301 LNKTNVLIDAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRP 360
Query: 359 KFPYRIKIIPMGSYPRIMDSNNNTYEL 385
KF ++KI PMGSYPRI+DSNN TYEL
Sbjct: 361 KFQCQVKIQPMGSYPRIVDSNNETYEL 387
|
|
| MGI|MGI:1891828 Becn1 "beclin 1, autophagy related" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14457 BECN1 "Beclin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4A1L4 BECN1 "Beclin-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RNW7 AARSD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4A1L5 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R878 BECN1 "Beclin-1" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1F6 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|620190 Becn1 "beclin 1, autophagy related" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C9A1 BECN1 "Beclin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| atg6 | SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (522 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00002733001 | • | • | 0.632 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 442 | |||
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 1e-55 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.004 |
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
Score = 187 bits (477), Expect = 1e-55
Identities = 79/243 (32%), Positives = 137/243 (56%), Gaps = 3/243 (1%)
Query: 149 ITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARD 208
+ + F+I +SQT ++ PLC EC +L ++LD E+ D ++ + Y+ L +LE + +
Sbjct: 2 VKAMTNLFDILSSQTNIDHPLCEECADILLERLDSELRDAEKERDTYKQYLSKLESQNVE 61
Query: 209 VLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEF 268
+ + E ++++EE +L +EE EK++ +++ EL EL+ + ++ + E +Y +E+
Sbjct: 62 ISNYEALDSELDELKKEEERLLDELEELEKEDDDLDGELVELQEEKEQLENEELQYLREY 121
Query: 269 NNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRL 328
N F + ++ ++ + E S L+ L++TN+ N F I H G F TIN RLGRL
Sbjct: 122 NLFDRNNLQLEDNLQSLELQYEYSLNQLDKLRKTNIFNATFHISHSGPFATINGLRLGRL 181
Query: 329 PKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRI--MDSNNNTYELT 386
P + V W EINAAWGQ LLL + + F R +++P GS+ I + N+ Y +
Sbjct: 182 PSVVVPWKEINAAWGQTVLLLAALAKKLGLNFV-RYRLVPFGSHSYIEKLMVNSVEYNNS 240
Query: 387 LQN 389
N
Sbjct: 241 TTN 243
|
In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway. Length = 356 |
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 442 | |||
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 100.0 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 100.0 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 99.52 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 98.93 | |
| KOG2896 | 377 | consensus UV radiation resistance associated prote | 98.8 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 97.26 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.85 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.78 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.38 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.19 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.08 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 95.93 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.9 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.69 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.69 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.45 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.41 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 95.28 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 95.19 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.18 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.14 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.14 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.59 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 94.53 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.45 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.44 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.38 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.36 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.33 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.19 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.14 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.13 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.08 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.02 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.01 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.01 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.99 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.98 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 93.94 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 93.84 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 93.84 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 93.8 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 93.77 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.7 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 93.56 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 93.48 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 93.43 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 93.37 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 93.26 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.26 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.03 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 92.99 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.8 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 92.7 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.55 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 92.53 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.5 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.47 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 92.46 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 92.42 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.22 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 92.11 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.08 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.03 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 91.92 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 91.91 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 91.85 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 91.83 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 91.67 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 91.67 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 91.66 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 91.64 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 91.6 | |
| COG4985 | 289 | ABC-type phosphate transport system, auxiliary com | 91.57 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 91.41 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 91.21 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 91.15 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 90.91 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 90.88 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 90.84 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 90.81 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 90.68 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 90.33 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 90.29 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 90.25 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 90.14 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 90.13 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 90.07 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 89.97 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 89.46 | |
| PRK09039 | 343 | hypothetical protein; Validated | 89.35 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 89.31 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 89.26 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 89.26 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 89.15 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 89.13 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 89.13 | |
| PF15285 | 25 | BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: | 89.02 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 89.02 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 88.95 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 88.78 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 88.56 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 88.39 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 88.36 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 88.17 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 88.03 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 88.01 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 87.93 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 87.81 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 87.49 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 87.49 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 87.42 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 87.31 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 86.96 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 86.87 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 86.79 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 86.64 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 86.61 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 86.61 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 86.57 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 86.54 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 86.39 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 86.37 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 86.32 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 86.28 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 86.27 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 86.21 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 85.96 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 85.94 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 85.61 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 85.53 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 85.51 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 85.32 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 85.31 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 85.3 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 85.25 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 85.03 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 85.01 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 84.88 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 84.56 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 84.5 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 84.38 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 84.16 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 83.94 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 83.41 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 83.4 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 83.39 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 83.38 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 83.31 | |
| PRK08032 | 462 | fliD flagellar capping protein; Reviewed | 83.3 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 83.29 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 83.25 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 83.24 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 83.13 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 83.13 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 83.08 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 82.98 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 82.8 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 82.72 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 82.71 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 82.64 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 82.5 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 82.29 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 82.14 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 82.12 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 82.07 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 82.01 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 81.81 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 81.75 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 81.56 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 81.43 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 81.22 | |
| PRK06798 | 440 | fliD flagellar capping protein; Validated | 81.22 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 80.79 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 80.72 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 80.4 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 80.39 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 80.36 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 80.35 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 80.24 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 80.17 |
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.8e-90 Score=699.91 Aligned_cols=380 Identities=49% Similarity=0.766 Sum_probs=350.4
Q ss_pred EeecccccccccCCccCcCCCCCcccccccccccCCCCCceeeccCCCC-CCCCCCCCCCCCCCCcccccCCCCcccceE
Q 013502 33 IVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRGSSAQSEASQSGKAMDESFV 111 (442)
Q Consensus 33 i~g~d~~~~~~~~~~~~~~~~~s~~~~~~s~~~~~~~d~s~vvl~~~r~-~~~g~~~~~~~~~~~~~~~~~~~~~~eSfV 111 (442)
+||+|+|+++++..|..+.-.+.++|+..++.+..+|+.+++|+|.+.+ ++.+.|++++++.. +++. ++.++.+|||
T Consensus 1 ~~g~~~s~~~~~q~~~~~~r~~~~i~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~t~~~~a~~-~~~~-~~~~~~~~~~ 78 (447)
T KOG2751|consen 1 IVGVDSSANKFFQVPFPCQRCLQPIHLDNSLLGSDRMDISELVLPLHKPPQSQGGPTRPRGASS-GDAT-SGKTPQESSV 78 (447)
T ss_pred CcccccccccccCCChhhhhccchhhhhhhhccccccchhhccCCCCCCccccCCCccCccccC-cccc-CCcchhhccc
Confidence 5899999999999998888889999999999999999999999999965 99999999999887 5555 8899999999
Q ss_pred EEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccchHHHHHHHHHhhcCCCCcCCcchHHHHHHHHHHHHHHHHHHHHH
Q 013502 112 VIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRD 191 (442)
Q Consensus 112 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lss~i~~l~~lFdILSs~s~IDhPLC~ECtd~Lle~Ld~qle~~~~E 191 (442)
+.+...+..+....+-+....+..++.+.+.+++++++++++++|+|||++++||||+|.||+|.|++.|+++++.+++|
T Consensus 79 ~~~~~~p~r~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~f~i~~~qt~~d~PlC~eC~d~l~~~ld~e~~~~~~e 158 (447)
T KOG2751|consen 79 VVYFSPPVRDSDTEHNLSFELGENGSDGSNTKTLSATINVLTRLFDILSSQTQVDHPLCEECMDVLLNKLDKEVEDAEDE 158 (447)
T ss_pred eecccCcccccccccccccccccccchhhhhHHHHHHHHHHHHHHHHhhccCCcccchHHHHHHHHHHHHHHHHHHHHHH
Confidence 99877666655555544444444445567789999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhchhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 013502 192 IEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNF 271 (442)
Q Consensus 192 ~d~Y~~fL~~Le~e~~~~~s~e~l~~El~~LE~EE~~L~~eLeeLEkE~~~l~~El~~le~e~~~L~eeEe~~W~e~N~~ 271 (442)
+++|++|+++|+++..+. +++++.+|+++++.||++|.++|+++|++.++++.++.+++.+..++.++|.+||++||.+
T Consensus 159 ~~~Y~~~l~~Le~~~~~~-~~~~~~~e~~~l~~eE~~L~q~lk~le~~~~~l~~~l~e~~~~~~~~~e~~~~~~~ey~~~ 237 (447)
T KOG2751|consen 159 VDTYKACLQRLEQQNQDV-SEEDLLKELKNLKEEEERLLQQLEELEKEEAELDHQLKELEFKAERLNEEEDQYWREYNNF 237 (447)
T ss_pred HHHHHHHHHHHhhcCccc-chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999876543 7889999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCCceeeeecCCeeeeccccCCCCCCCCCChhhHHHHHHHHHHHHHH
Q 013502 272 QFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHT 351 (442)
Q Consensus 272 q~qL~~~~eE~~sl~~q~~~~q~qLdkLrktNV~Nd~F~I~hdG~fGTINGlRLGrlp~~~V~W~EINAAwGQ~~LLL~t 351 (442)
++++.+++++++||++++++++.||++|++|||||.+|||||+|+|||||||||||+|.+||+|+||||||||+||||++
T Consensus 238 ~~q~~~~~del~Sle~q~~~s~~qldkL~ktNv~n~~F~I~~~G~fgtIN~FRLG~lp~~pVew~EINAA~GQ~vLLL~~ 317 (447)
T KOG2751|consen 238 QRQLIEHQDELDSLEAQIEYSQAQLDKLRKTNVFNATFHIWHDGEFGTINNFRLGRLPSVPVEWDEINAAWGQTVLLLHT 317 (447)
T ss_pred HHhhhcccchHHHHHHHHHHHHHHHHHHHhhhhhhheeeEeecccccccccceeccccCCCcCHHHHHHHhhhHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhcCCCcc-cceeeeecCCcceeecCCC---ceeeccccc-ccchhhhhccHHHHHhhhhhHHhhhhhh
Q 013502 352 MCQYFRPKFP-YRIKIIPMGSYPRIMDSNN---NTYELTLQN-LQILRIKRITFHQINALNCPIRLKMTRW 417 (442)
Q Consensus 352 la~kl~~~F~-Yr~kLvPmGS~SkI~~~~~---~~y~Ly~s~-~~~~~~~rfd~~m~~fldc~~q~~~~~~ 417 (442)
|++|+|++|+ |+ ||||||||+|++... ..||||++| .+|+|.+|||+||++|||||+||.++-=
T Consensus 318 l~~kig~~~~~y~--lvp~GshSyI~~~~~~~~~el~l~~sgg~~~f~~tkfD~amvafLd~L~qf~~e~~ 386 (447)
T KOG2751|consen 318 LANKIGLNFVRYR--LVPMGSHSYIKKRMVNLPYELPLFQSGGLKFFWSTKFDKAMVAFLDCLKQFADELE 386 (447)
T ss_pred HHHhcCcccceee--eecccchhHHHHhccCCCccchhhcCCCceeeeccccCHHHHHHHHHHHHHHHHHH
Confidence 9999999998 66 999999999997653 589999766 7999999999999999999999998753
|
|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2896 consensus UV radiation resistance associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG4985 ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF15285 BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: 3BL2_C 2P1L_H 3DVU_C 2PON_A | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK08032 fliD flagellar capping protein; Reviewed | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06798 fliD flagellar capping protein; Validated | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 442 | ||||
| 4ddp_A | 210 | Crystal Structure Of Beclin 1 Evolutionarily Conser | 2e-25 | ||
| 3vp7_A | 220 | Crystal Structure Of The Beta-Alpha Repeated, Autop | 6e-11 |
| >pdb|4DDP|A Chain A, Crystal Structure Of Beclin 1 Evolutionarily Conserved Domain(Ecd) Length = 210 | Back alignment and structure |
|
| >pdb|3VP7|A Chain A, Crystal Structure Of The Beta-Alpha Repeated, Autophagy-Specific (Bara) Domain Of Vps30ATG6 Length = 220 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 442 | |||
| 4ddp_A | 210 | Beclin-1; ECD, autophagy, membrane binding, membra | 1e-47 | |
| 3vp7_A | 220 | Vacuolar protein sorting-associated protein 30; ta | 8e-38 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 2e-21 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 9e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 |
| >4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
Score = 162 bits (410), Expect = 1e-47
Identities = 51/112 (45%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
Query: 276 IAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEW 335
+ +E ++ +++ +Q L+ LK+TNV N F IWH G+FGTINNFRLGRLP +PVEW
Sbjct: 1 LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW 60
Query: 336 DEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELTL 387
+EINAAWGQ LLLH + KF R +++P G++ + + + EL L
Sbjct: 61 NEINAAWGQTVLLLHALANKMGLKFQ-RYRLVPYGNHSYLESLTDKSKELPL 111
|
| >3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} Length = 220 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Length = 96 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 442 | |||
| 4ddp_A | 210 | Beclin-1; ECD, autophagy, membrane binding, membra | 100.0 | |
| 3vp7_A | 220 | Vacuolar protein sorting-associated protein 30; ta | 100.0 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 99.75 | |
| 2p1l_B | 31 | Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2 | 98.28 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.68 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.19 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.14 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 95.96 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.59 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.54 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.29 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.12 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 94.68 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.67 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.54 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.47 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 93.39 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 91.67 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 91.2 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 90.67 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 90.11 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 89.09 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 88.63 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 87.98 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 87.77 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 87.21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 86.75 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 86.32 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 85.69 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 85.55 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 84.96 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 84.85 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 84.78 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 84.23 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 84.16 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 83.07 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 82.52 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 82.5 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 81.44 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 81.1 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 80.46 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 80.22 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 80.03 |
| >4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-58 Score=433.70 Aligned_cols=139 Identities=38% Similarity=0.735 Sum_probs=122.4
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhcccCCCceeeeecCCeeeeccccCCCCCCCCCChhhHHHHHHHHHHHHHHHHhhc
Q 013502 277 AHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYF 356 (442)
Q Consensus 277 ~~~eE~~sl~~q~~~~q~qLdkLrktNV~Nd~F~I~hdG~fGTINGlRLGrlp~~~V~W~EINAAwGQ~~LLL~tla~kl 356 (442)
++++|++|+++||++++.|||+|+||||||++|||||||+|||||||||||+|++||+|+||||||||+||||++||+++
T Consensus 2 ~~~~e~~sl~~q~~~~~~~L~~L~~tNv~n~~F~I~hdG~fgtINglRLGrlp~~~V~W~EINAAwGq~~LLL~tla~~l 81 (210)
T 4ddp_A 2 ELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKM 81 (210)
T ss_dssp ------CCHHHHHHHHHHHHHTC----CCSSCCCEEEETTEEEETTEECCCBTTBCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred chHHHHHHHHHHHHHHHHHHHHHHhcccccceeEEEecCCceeEcccccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHc
Confidence 67899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcccceeeeecCCcceeecCCC--ceeeccccc-ccchhhhhccHHHHHhhhhhHHhhhhh
Q 013502 357 RPKFPYRIKIIPMGSYPRIMDSNN--NTYELTLQN-LQILRIKRITFHQINALNCPIRLKMTR 416 (442)
Q Consensus 357 ~~~F~Yr~kLvPmGS~SkI~~~~~--~~y~Ly~s~-~~~~~~~rfd~~m~~fldc~~q~~~~~ 416 (442)
+++|+ +|+|+||||||+|++..+ .+|||||+| +++++.+|||.||++||+|++||.+.-
T Consensus 82 ~~~f~-~y~L~P~GS~S~I~~~~~~~~~l~Ly~sg~~~~f~~~kFD~Am~afL~cl~q~~~~~ 143 (210)
T 4ddp_A 82 GLKFQ-RYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEV 143 (210)
T ss_dssp TCCCS-SEEEECCGGGCEEEESSCTTCCEESCCCSSCGGGCCSHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCcc-ceeEEecCCcceeeEecCCCeEEeceeCCCccccccccccHHHHHHHHHHHHHHHHH
Confidence 99998 555999999999998653 589999976 689999999999999999999998754
|
| >3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2p1l_B Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2.50A {Homo sapiens} PDB: 3dvu_C 2pon_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00