Citrus Sinensis ID: 013548

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-
MAVQDECGGNHSNSVFSAGNGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMHPYPRKLAHPPVKESLNPELSRTSLSPILSVSERENQSPTSVLFAIGSDAFGSSDSNSPNGSLSPVSSAVPEQLGGLTLSHPSSSPEERGSPSSDPVTPGSVTDEQSPKGLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVQGREFKKEGSLTGSNSKSVNEEDSIDKSSDVDSQSSRQSLDKEDKWLEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKRIVERDNQLSAVGNGRDQREW
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHcccccccccccccccc
cccHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHccccccccccccccEEEEcccccccHHHHHHHHHHcccccccccccccccEEEcccccccccEcccccccccccccccccccccccccccccccccccccHHHcccccEEEEEcccccEEEEEEEccccccccccccHHHHHHHcccccccccccHHccc
mavqdecggnhsnsvfsagngiesssglhtvtglevkdqfscgndfapkprkpytitkqRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVresngcstspvepveippprpkrkpmhpyprklahppvkeslnpelsrtslspilsvserenqsptSVLFAIgsdafgssdsnspngslspvssavpeqlggltlshpssspeergspssdpvtpgsvtdeqspkGLVNYLNHFLPRLLRVNLCsycrwrlcipnhclrtqnmhgdvpchmeglglsVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVqgrefkkegsltgsnsksvneedsidkssdvdsqssrqsldkEDKWLEVAFElkpsensafSVIRTRtdkhmkgfvpykkRIVERdnqlsavgngrdqrew
mavqdecggnhsnSVFSAGNGIESSSGLHTVTGLEVKDQfscgndfapkprkpytitkqrerwteeeHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVresngcstspvepveippprpkrkpMHPYPRKlahppvkeslnpeLSRTSLSPILSVSERENQSPTSVLFAIGSDAFGSSDSNSPNGSLSPVSSAVPEQLGGLTLSHPSSSPEERGSPSSDPVTPGSVTDEQSPKGLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVQGRefkkegsltgsnsksvneedsidkssdvdsqssrqsldkeDKWLEVAfelkpsensafsvirtrtdkhmkgfvpykkriverdnqlsavgngrdqrew
MAVQDECGGNHSNSVFSAGNGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSpvepveippprpkrkpmhpyprkLAHPPVKESLNPELSRTSLSPILSVSERENQSPTSVLFAIGSDAFgssdsnspngslspVSSAVPEQLGGLTLshpssspeergspssdpVTPGSVTDEQSPKGLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVQGREFKKEGSLTGSNSKSVNEEdsidkssdvdsqssrqsldKEDKWLEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKRIVERDNQLSAVGNGRDQREW
******************************VTGLEVKDQFSCG******************RWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKV****************************************************************************************************************************************GLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVK***********************************************WLEVAFE********FSVIRTRTDKHMKGFVPYKKRI*******************
******************************************************************EHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFF********************************************************************************************************************************************************************************************************QIWWILVLVLIFHGGISLMVCHM*************************************************************************************GFVPYK**********************
*********NHSNSVFSAGNGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKV**************VEIPPPRPKRKPMHPYPRKLAHPPVKESLNPELSRTSLSPILS********PTSVLFAIGSDAFG*****************VPEQLGGL****************************QSPKGLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVQG***************************************KEDKWLEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKRIVERDNQL************
***********************************************PKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRE****************P*****************************************************************************************************************SPKGLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVQG******************************************KWLEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKRIVERDN**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVQDECGGNHSNSVFSAGNGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMHPYPRKLAHPPVKESLNPELSRTSLSPILSVSERENQSPTSVLFAIGSDAFGSSDSNSPNGSLSPVSSAVPEQLGGLTLSHPSSSPEERGSPSSDPVTPGSVTDEQSPKGLVNYLNHFLPRLLRVNLCSYCRWRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLVLIFHGGISLMVCHMLSLQIISSVKEVQGREFKKEGSLTGSNSKSVNEEDSIDKSSDVDSQSSRQSLDKEDKWLEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKRIVERDNQLSAVGNGRDQREW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query441 2.2.26 [Sep-21-2011]
Q54IF9423 Myb-like protein G OS=Dic yes no 0.199 0.208 0.614 6e-29
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.235 0.161 0.650 2e-28
P92973 608 Protein CCA1 OS=Arabidops no no 0.229 0.166 0.699 7e-28
Q6R0H0287 Transcription factor ASG4 no no 0.238 0.365 0.547 5e-26
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.122 0.044 0.535 2e-09
Q869R9734 Myb-like protein J OS=Dic no no 0.126 0.076 0.421 2e-08
Q54HX6 977 Myb-like protein I OS=Dic no no 0.122 0.055 0.436 2e-07
Q5RGA4 822 Histone H2A deubiquitinas yes no 0.138 0.074 0.362 5e-06
Q8S9H7307 Transcription factor DIVA N/A no 0.163 0.234 0.375 2e-05
Q5VVJ2 828 Histone H2A deubiquitinas yes no 0.131 0.070 0.360 5e-05
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 70/96 (72%), Gaps = 8/96 (8%)

Query: 49  KPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKV 108
           K RKPYTI+KQRE WT+EEH+KFLEAL LF R W+KIE  VG+KT +QIRSHAQK+F KV
Sbjct: 30  KSRKPYTISKQRENWTDEEHQKFLEALTLFDRDWKKIESFVGSKTVIQIRSHAQKYFIKV 89

Query: 109 VRESNGCSTSPVEPVEIPPPRPKRKPMHPYPRKLAH 144
            + + G          IPPPRPKRK + PYP+K  H
Sbjct: 90  QKNNTGE--------RIPPPRPKRKSIQPYPQKQKH 117

Dictyostelium discoideum (taxid: 44689)
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q5VVJ2|MYSM1_HUMAN Histone H2A deubiquitinase MYSM1 OS=Homo sapiens GN=MYSM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query441
224077470372 predicted protein [Populus trichocarpa] 0.825 0.978 0.531 4e-79
255571279468 DNA binding protein, putative [Ricinus c 0.485 0.457 0.684 4e-66
297738146479 unnamed protein product [Vitis vinifera] 0.544 0.501 0.630 2e-64
359476477495 PREDICTED: uncharacterized protein LOC10 0.544 0.484 0.630 2e-64
356500995436 PREDICTED: uncharacterized protein LOC10 0.893 0.903 0.426 5e-63
147817015 543 hypothetical protein VITISV_012100 [Viti 0.541 0.440 0.624 6e-63
351725365436 MYB transcription factor MYB177 [Glycine 0.893 0.903 0.415 8e-63
61375063447 putative At5g37260 [Solanum pimpinellifo 0.843 0.832 0.424 3e-59
346990873445 hypothetical protein, partial [Solanum p 0.839 0.831 0.420 4e-59
317457059446 At5g37260-like protein [Solanum arcanum] 0.823 0.813 0.414 2e-57
>gi|224077470|ref|XP_002305260.1| predicted protein [Populus trichocarpa] gi|222848224|gb|EEE85771.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  301 bits (772), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 210/395 (53%), Positives = 250/395 (63%), Gaps = 31/395 (7%)

Query: 35  EVKDQFSCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTA 94
           ++K+QFSCG+D++PK RKPYTITKQRERWTEEEHKKFLEALKL+GRAWR+IEEHVGTKTA
Sbjct: 1   QLKEQFSCGSDYSPKARKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTA 60

Query: 95  VQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMHPYPRKLAHPPVKESLNPE 154
           VQIRSHAQKFFSKVVRES G +TS VEP+EIPPPRPKRKPMHPYPRKLAHP  KE L PE
Sbjct: 61  VQIRSHAQKFFSKVVRESGGSNTSSVEPIEIPPPRPKRKPMHPYPRKLAHPLEKELLIPE 120

Query: 155 LSRTSLSPILSVSERENQSPTSVLFAIGSDAFGSSDSNSPNGSLSPVSSAVPEQLGGLTL 214
            S  S SP  S+SE+ENQSPTSVL A+GSDA GS+DS++PN SLSPVS A     GG  +
Sbjct: 121 KSLRSSSPNFSISEQENQSPTSVLSAVGSDALGSTDSDTPNHSLSPVSFA-----GG--V 173

Query: 215 SHPSSSPEERGSPSSDPVTPGSVTDEQSPKGL-------VNYLNHFLPRLLRVNLCSYCR 267
            H  SSPEE GSPS  P T  SV DEQ PK L       V+     +      +L  + R
Sbjct: 174 HHADSSPEEDGSPS--PATASSVPDEQFPKKLDSSPEENVSSDEPVVEETSTRSLKLFGR 231

Query: 268 WRLCIPNHCLRTQNMHGDVPCHMEGLGLSVVCNRQMMTQIWWILVLV-LIFHGGISLMVC 326
             L    H   + NM          L        +++  +    V     F  G S    
Sbjct: 232 TVLVTEWHKPSSPNM------GTSKLSTPDAAEEKLVRPLTLNNVAAEFPFRNGESTWK- 284

Query: 327 HMLSLQIISSVKEVQGREFKKEGSLTGSNSKSVNEEDSIDKSSDVDSQSSRQSLDKEDKW 386
                 + S   EVQ +E  KE S TGSNS  V+E +++DK+ D +++S  Q    E+K 
Sbjct: 285 -----NLDSKGDEVQDKEIPKEVSWTGSNSGLVSEGENVDKNMDAETES--QQFSYEEKE 337

Query: 387 LEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKR 421
           L   FELK +  SA S  +   +K  KGFVPYKKR
Sbjct: 338 LSPIFELKLTRKSASSGSKVINEKCPKGFVPYKKR 372

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255571279|ref|XP_002526589.1| DNA binding protein, putative [Ricinus communis] gi|223534083|gb|EEF35801.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297738146|emb|CBI27347.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476477|ref|XP_002267976.2| PREDICTED: uncharacterized protein LOC100263252 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500995|ref|XP_003519315.1| PREDICTED: uncharacterized protein LOC100785040 [Glycine max] Back     alignment and taxonomy information
>gi|147817015|emb|CAN68733.1| hypothetical protein VITISV_012100 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351725365|ref|NP_001236066.1| MYB transcription factor MYB177 [Glycine max] gi|110931734|gb|ABH02866.1| MYB transcription factor MYB177 [Glycine max] Back     alignment and taxonomy information
>gi|61375063|gb|AAX44369.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375065|gb|AAX44370.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375067|gb|AAX44371.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375069|gb|AAX44372.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375071|gb|AAX44373.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375075|gb|AAX44375.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375077|gb|AAX44376.1| putative At5g37260 [Solanum pimpinellifolium] gi|61375079|gb|AAX44377.1| putative At5g37260 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|346990873|gb|AEO52901.1| hypothetical protein, partial [Solanum peruvianum] Back     alignment and taxonomy information
>gi|317457059|gb|ADV29611.1| At5g37260-like protein [Solanum arcanum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query441
TAIR|locus:2167210387 RVE1 "REVEILLE 1" [Arabidopsis 0.367 0.418 0.526 1.6e-45
TAIR|locus:2169135287 RVE2 "REVEILLE 2" [Arabidopsis 0.183 0.282 0.707 2.5e-40
TAIR|locus:2014114372 EPR1 "EARLY-PHYTOCHROME-RESPON 0.285 0.338 0.492 2.3e-29
TAIR|locus:504955668336 AT3G10113 [Arabidopsis thalian 0.285 0.375 0.492 2.3e-29
TAIR|locus:2044345 608 CCA1 "circadian clock associat 0.163 0.118 0.777 4.4e-26
TAIR|locus:2200970 645 LHY "LATE ELONGATED HYPOCOTYL" 0.170 0.116 0.693 3.8e-25
TAIR|locus:2075049298 RVE8 "REVEILLE 8" [Arabidopsis 0.145 0.214 0.712 8.4e-21
TAIR|locus:2149589331 AT5G52660 [Arabidopsis thalian 0.206 0.274 0.547 8.4e-21
TAIR|locus:2124928303 AT4G01280 [Arabidopsis thalian 0.213 0.310 0.536 1.1e-20
TAIR|locus:2025411287 ASG4 "ALTERED SEED GERMINATION 0.190 0.292 0.566 6e-20
TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 393 (143.4 bits), Expect = 1.6e-45, Sum P(2) = 1.6e-45
 Identities = 91/173 (52%), Positives = 108/173 (62%)

Query:    34 LEVKDQFSCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKT 93
             ++  DQ   GND+APK RKPYTITK+RERWT+EEHKKF+EALKL+GRAWR+IEEHVG+KT
Sbjct:    29 IQFNDQSFGGNDYAPKVRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGSKT 88

Query:    94 AVQIRSHAQKFFSKVVRESNGCSTSXXXXXXXXXXXXXXXXXXXXXXXLAHPPVKESLNP 153
             AVQIRSHAQKFFSKV RE+ G   S                        AHP  ++  N 
Sbjct:    89 AVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKP--------AHPYPRKFGN- 139

Query:   154 ELSRTSLSPILSVSERENQSPTSVLFAIGSDAFXXXXXXXXXXXXXXVSSAVP 206
             E  +TS S  +S SER+ QSPTSVL  +GS+A               VSSA P
Sbjct:   140 EADQTSRS--VSPSERDTQSPTSVLSTVGSEALCSLDSSSPNRSLSPVSSASP 190
GO:0003677 "DNA binding" evidence=IEA;IDA
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0007623 "circadian rhythm" evidence=IEP;RCA
GO:0009734 "auxin mediated signaling pathway" evidence=IMP
GO:0009851 "auxin biosynthetic process" evidence=IMP
GO:0010600 "regulation of auxin biosynthetic process" evidence=IMP
GO:0009651 "response to salt stress" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009739 "response to gibberellin stimulus" evidence=RCA
GO:0009751 "response to salicylic acid stimulus" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0048574 "long-day photoperiodism, flowering" evidence=RCA
TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014114 EPR1 "EARLY-PHYTOCHROME-RESPONSIVE1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200970 LHY "LATE ELONGATED HYPOCOTYL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IV.3973.1
hypothetical protein (372 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query441
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 2e-13
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-09
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 0.004
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 64.3 bits (157), Expect = 2e-13
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 58  KQRERWTEEEHKKFLEALKLFGR-AW---RKI-EEHVGTK-TAVQIRSHAQKFFSKV 108
           K R  WTE+ H +FL+A++  G   W   ++I E  V    T  Q+ SH QK+  K 
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 441
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.6
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.43
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 99.2
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.03
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.01
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.84
KOG0724335 consensus Zuotin and related molecular chaperones 98.78
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 98.51
PLN03212249 Transcription repressor MYB5; Provisional 98.41
PLN03212249 Transcription repressor MYB5; Provisional 98.33
PLN03091459 hypothetical protein; Provisional 98.31
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.24
PLN03091459 hypothetical protein; Provisional 98.23
KOG1279506 consensus Chromatin remodeling factor subunit and 98.04
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.01
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.52
PLN03162526 golden-2 like transcription factor; Provisional 96.92
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.66
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.32
KOG4329445 consensus DNA-binding protein [General function pr 95.34
KOG4468 782 consensus Polycomb-group transcriptional regulator 94.73
KOG0724335 consensus Zuotin and related molecular chaperones 94.04
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 93.98
KOG0051607 consensus RNA polymerase I termination factor, Myb 93.86
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 93.41
KOG0051607 consensus RNA polymerase I termination factor, Myb 93.28
KOG3554693 consensus Histone deacetylase complex, MTA1 compon 93.11
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 92.82
PLN031421033 Probable chromatin-remodeling complex ATPase chain 92.71
KOG4167907 consensus Predicted DNA-binding protein, contains 92.25
smart0042668 TEA TEA domain. 91.73
KOG3841455 consensus TEF-1 and related transcription factor, 91.68
KOG1194534 consensus Predicted DNA-binding protein, contains 90.92
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 90.42
PF01285431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 89.71
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 89.5
COG5147512 REB1 Myb superfamily proteins, including transcrip 85.93
COG5147 512 REB1 Myb superfamily proteins, including transcrip 83.5
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.60  E-value=1.3e-15  Score=118.18  Aligned_cols=50  Identities=40%  Similarity=0.648  Sum_probs=45.3

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCcc-h---HHHHhhcC-CC-CHHHHHHHHHHHHHH
Q 013548           58 KQRERWTEEEHKKFLEALKLFGRA-W---RKIEEHVG-TK-TAVQIRSHAQKFFSK  107 (441)
Q Consensus        58 k~rg~WT~EEH~lFLeaLe~yGrg-W---kkIAe~Vg-TR-T~~QVrSHAQKYF~K  107 (441)
                      +.+..||+|||.+||+||+.||.+ |   ++|+++++ ++ |+.||+|||||||.+
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k   56 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK   56 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence            357789999999999999999995 9   99998765 78 999999999999986

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query441
2cu7_A72 Solution Structure Of The Sant Domain Of Human Kiaa 1e-05
>pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 34/49 (69%)
Query: 62  RWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVR 110
           +WT EE + F + L  FGR W KI + +G++T +Q++S+A+++F   V+
Sbjct: 11  KWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVK 59

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query441
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-24
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 5e-19
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-18
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 6e-16
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-15
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-15
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 4e-13
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 5e-12
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 3e-09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 1e-07
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 1e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 1e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-05
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 2e-05
2cjj_A93 Radialis; plant development, DNA-binding protein, 8e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 1e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-04
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 4e-04
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 5e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 9e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 94.9 bits (236), Expect = 2e-24
 Identities = 19/56 (33%), Positives = 35/56 (62%)

Query: 57  TKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRES 112
           +    +WT EE + F + L  FGR W KI + +G++T +Q++S+A+++F   V+  
Sbjct: 6   SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCG 61
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query441
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.59
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.54
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.52
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.38
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.36
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.35
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.27
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.23
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.22
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.19
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.19
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.18
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.18
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.13
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.73
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.1
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.08
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.07
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.03
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.97
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.92
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.92
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.92
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.91
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.9
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.9
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.87
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.86
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.85
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.84
2crg_A70 Metastasis associated protein MTA3; transcription 98.81
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.78
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.78
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.76
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.7
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.63
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.62
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.61
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.61
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.59
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.59
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.55
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.44
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.11
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.28
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.14
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 96.71
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.66
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.58
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.84
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.56
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.15
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 93.37
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.2
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 93.05
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 92.19
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 89.18
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 87.77
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 87.48
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.14
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
Probab=99.59  E-value=9.1e-16  Score=124.08  Aligned_cols=61  Identities=26%  Similarity=0.408  Sum_probs=55.3

Q ss_pred             CCCCCCCCCcccccCCCCCCHHHHHHHHHHHHHhCcchHHHHhhcCCCCHHHHHHHHHHHH
Q 013548           45 DFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFF  105 (441)
Q Consensus        45 ~~~~K~rKPytitk~rg~WT~EEH~lFLeaLe~yGrgWkkIAe~VgTRT~~QVrSHAQKYF  105 (441)
                      .-+++.++++.....++.||+||+.+||+||++||.+|.+||++||+||+.||+.|+++|+
T Consensus         3 sg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~   63 (79)
T 2yus_A            3 SGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLP   63 (79)
T ss_dssp             CSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSC
T ss_pred             CcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhc
Confidence            3455788888888889999999999999999999977999999999999999999998874
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 441
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 1e-15
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 8e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 6e-12
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-07
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-07
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 2e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-05
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 2e-04
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-04
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 6e-04
d1ofcx152 a.4.1.3 (X:799-850) SANT domain of the nucleosome 0.001
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.001
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 69.2 bits (169), Expect = 1e-15
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 58  KQRERWTEEEHKKFLEALKLFGRAWR---KIEEH--VGTKTAVQIRSHAQKFFSKVVRES 112
           K R  WT E H KFL A+   G       KI +   V   T   + SH QKF   + + S
Sbjct: 5   KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 64
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query441
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.5
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.5
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.47
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.29
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.27
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.24
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.23
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.2
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.13
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.11
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.96
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.93
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.89
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.74
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.43
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.43
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.21
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.61
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.25
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 90.81
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 82.28
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.50  E-value=1.3e-14  Score=112.55  Aligned_cols=54  Identities=37%  Similarity=0.489  Sum_probs=47.9

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCcch---HHHHhh--cCCCCHHHHHHHHHHHHHHHhHh
Q 013548           58 KQRERWTEEEHKKFLEALKLFGRAW---RKIEEH--VGTKTAVQIRSHAQKFFSKVVRE  111 (441)
Q Consensus        58 k~rg~WT~EEH~lFLeaLe~yGrgW---kkIAe~--VgTRT~~QVrSHAQKYF~Kl~r~  111 (441)
                      +.+..||+|||.+|++||+.||.+|   +.|.++  |+++|..||+||+||||.++.|.
T Consensus         5 k~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k~   63 (64)
T d1irza_           5 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKV   63 (64)
T ss_dssp             CSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHSC
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHhc
Confidence            4467899999999999999999996   688765  67889999999999999999764
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure