Citrus Sinensis ID: 013559

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-

MEPEDEQSNSMMEEICSNGGEESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVRAARKL

ccccccccccHHHHccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccHHHHHHHHHHHHHcccccEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccc

ccccccccccccccccccccccccccccEEccccccHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHEHHHHEEEEEEEEcccHHHHHHHHHHHHHcHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccc

mepedeqsNSMMEEICsnggeesartrpiisgeqlDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIdgrlgpnyamdeawcDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGyndfgdfyyahgalgdafksyvrtrdycttsKHIIHMCMSAILVSIEMGQFTHVTSYVskaeqtpealepVTIAKLRCAAGLAHLEARKYKLAARKFLevgpdlgnsynEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVRAARKL

mepedeqsnsMMEEICSNGGEESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIkkgentqlfREVVKKIdgrlgpnyamdeawcDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRanllkheynvraarkl

*******************************GEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSV*************ELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYN*******

*****************************ISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVR*****

*************************TRPIISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVRAARKL

**************************RPIISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVR*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEPEDEQSNSMMEEICSNGGEESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVRAARKL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		441	2.2.26 [Sep-21-2011]
P45432		441	COP9 signalosome complex	yes	no	0.997	0.997	0.809	0.0
Q54QX3		458	COP9 signalosome complex	yes	no	0.907	0.873	0.486	1e-114
Q6NRT5		487	COP9 signalosome complex	N/A	no	0.925	0.837	0.456	1e-103
Q13098		491	COP9 signalosome complex	yes	no	0.922	0.828	0.453	1e-103
Q99LD4		471	COP9 signalosome complex	yes	no	0.922	0.864	0.457	1e-102
P97834		471	COP9 signalosome complex	yes	no	0.922	0.864	0.455	1e-102
Q9VVU5		525	COP9 signalosome complex	yes	no	0.920	0.773	0.407	1e-97
Q5BD89		498	COP9 signalosome complex	yes	no	0.968	0.857	0.361	7e-70
Q7RXQ1		425	COP9 signalosome complex	N/A	no	0.852	0.884	0.325	2e-52
O94308		422	COP9 signalosome complex	yes	no	0.802	0.838	0.284	5e-35

>sp\|P45432\|CSN1_ARATH COP9 signalosome complex subunit 1 OS=Arabidopsis thaliana GN=CSN1 PE=1 SV=2	Back alignment and function desciption

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/442 (80%), Positives = 403/442 (91%), Gaps = 2/442 (0%)

Query: 1   MEPEDEQSNSMMEEICSNGGEESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADHC 60
           ME ++E S  MME +C+NGGEE++  RPIISGE LD+EAYA+LY+GRTKI RL+FIA+HC
Sbjct: 1   MERDEEASGPMME-MCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHC 59

Query: 61  DIA-SMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRK 119
               ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  Y MD AWC++VDRRAEQ+K
Sbjct: 60  GGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKK 119

Query: 120 EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMC 179
            KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LGDAFK+Y+RTRDYCTT+KHIIHMC
Sbjct: 120 VKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMC 179

Query: 180 MSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFL 239
           M+AILVSIEMGQFTHVTSYV+KAEQ PE LEP+  AKLRCA+GLAHLE +KYKLAARKFL
Sbjct: 180 MNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFL 239

Query: 240 EVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELI 299
           +V P+LGNSYNEVIA QD+ATYGGLCALASFDR+ELK KVIDN+NFRNFLELVP+VRELI
Sbjct: 240 DVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELI 299

Query: 300 NDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMA 359
           NDFYSSRYASCL+YL +LK+NLLLDIHLHDHV+TLYDQIR KALIQYT PFVSVDL  MA
Sbjct: 300 NDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMA 359

Query: 360 NAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDV 419
           +AFKTSV+G+EKELEALITDNQIQARIDSHNKILYARHADQRNATFQ+VLQ G+EFD+DV
Sbjct: 360 DAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDV 419

Query: 420 RAMLLRANLLKHEYNVRAARKL 441
           RAMLLRANLLKHEY+ R+ARKL
Sbjct: 420 RAMLLRANLLKHEYHARSARKL 441

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex. In the complex, it plays a central role in CSN assembly.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q54QX3\|CSN1_DICDI COP9 signalosome complex subunit 1 OS=Dictyostelium discoideum GN=csn1 PE=1 SV=1	Back alignment and function description

>sp\|Q6NRT5\|CSN1_XENLA COP9 signalosome complex subunit 1 OS=Xenopus laevis GN=csn1 PE=2 SV=1	Back alignment and function description

>sp\|Q13098\|CSN1_HUMAN COP9 signalosome complex subunit 1 OS=Homo sapiens GN=GPS1 PE=1 SV=4	Back alignment and function description

>sp\|Q99LD4\|CSN1_MOUSE COP9 signalosome complex subunit 1 OS=Mus musculus GN=Gps1 PE=1 SV=1	Back alignment and function description

>sp\|P97834\|CSN1_RAT COP9 signalosome complex subunit 1 OS=Rattus norvegicus GN=Gps1 PE=1 SV=1	Back alignment and function description

>sp\|Q9VVU5\|CSN1_DROME COP9 signalosome complex subunit 1b OS=Drosophila melanogaster GN=CSN1b PE=2 SV=1	Back alignment and function description

>sp\|Q5BD89\|CSN1_EMENI COP9 signalosome complex subunit 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnA PE=1 SV=2	Back alignment and function description

>sp\|Q7RXQ1\|CSN1_NEUCR COP9 signalosome complex subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-1 PE=1 SV=1	Back alignment and function description

>sp\|O94308\|CSN1_SCHPO COP9 signalosome complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		441
255541470		433	cop9 signalosome complex subunit, putati	0.972	0.990	0.904	0.0
225453732		441	PREDICTED: COP9 signalosome complex subu	0.995	0.995	0.852	0.0
449432185		450	PREDICTED: COP9 signalosome complex subu	0.997	0.977	0.848	0.0
356505043		444	PREDICTED: COP9 signalosome complex subu	1.0	0.993	0.833	0.0
147780280		451	hypothetical protein VITISV_025856 [Viti	0.995	0.973	0.833	0.0
271278821		440	Cop11 protein [Carica papaya]	0.995	0.997	0.852	0.0
356520465		446	PREDICTED: COP9 signalosome complex subu	1.0	0.988	0.834	0.0
224130120		436	predicted protein [Populus trichocarpa]	0.977	0.988	0.836	0.0
224063977		436	predicted protein [Populus trichocarpa]	0.975	0.986	0.831	0.0
18411857		441	COP9 signalosome complex subunit 1 [Arab	0.997	0.997	0.809	0.0

>gi\|255541470\|ref\|XP_002511799.1\| cop9 signalosome complex subunit, putative [Ricinus communis] gi\|223548979\|gb\|EEF50468.1\| cop9 signalosome complex subunit, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/429 (90%), Positives = 415/429 (96%)

Query: 13  EEICSNGGEESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRM 72
           +EI +NGGE ++R RPIISGEQLD+EAYA LY GRTKITRL+FIADHCD  +MQLEALRM
Sbjct: 5   DEIYANGGESTSRNRPIISGEQLDIEAYAGLYTGRTKITRLLFIADHCDNPTMQLEALRM 64

Query: 73  AYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRKEKLENELNAYRTN 132
           AY+EIKKGENTQLFREVV+KIDGRLGPNY+MD  WCD+VDRRAEQRKE+LENELNAYRTN
Sbjct: 65  AYEEIKKGENTQLFREVVQKIDGRLGPNYSMDNTWCDTVDRRAEQRKERLENELNAYRTN 124

Query: 133 LIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQF 192
           LIKESIRMGYNDFGDFYYAHGALG+AFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQF
Sbjct: 125 LIKESIRMGYNDFGDFYYAHGALGEAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQF 184

Query: 193 THVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEV 252
           THVTSYVSKAEQTPEAL+P+T+AKLRCAAGLAHLEARKYKLAARKFLEV P+LGNSY EV
Sbjct: 185 THVTSYVSKAEQTPEALDPITVAKLRCAAGLAHLEARKYKLAARKFLEVAPELGNSYTEV 244

Query: 253 IAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDFYSSRYASCLD 312
           IA QDVATYGGLCALASF+R ELK+KVIDN+NFRNFLELVPEVRELI+DFYSS YASCLD
Sbjct: 245 IAPQDVATYGGLCALASFERTELKNKVIDNLNFRNFLELVPEVRELIHDFYSSHYASCLD 304

Query: 313 YLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKE 372
           YLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAG+EKE
Sbjct: 305 YLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGLEKE 364

Query: 373 LEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHE 432
           LEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTG+EFD+DVRAMLLRANL+KHE
Sbjct: 365 LEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGNEFDRDVRAMLLRANLIKHE 424

Query: 433 YNVRAARKL 441
           YN+RA+RKL
Sbjct: 425 YNLRASRKL 433

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225453732\|ref\|XP_002272895.1\| PREDICTED: COP9 signalosome complex subunit 1 [Vitis vinifera] gi\|296089065\|emb\|CBI38768.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449432185\|ref\|XP_004133880.1\| PREDICTED: COP9 signalosome complex subunit 1-like [Cucumis sativus] gi\|449480140\|ref\|XP_004155810.1\| PREDICTED: COP9 signalosome complex subunit 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356505043\|ref\|XP_003521302.1\| PREDICTED: COP9 signalosome complex subunit 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|147780280\|emb\|CAN74681.1\| hypothetical protein VITISV_025856 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|271278821\|emb\|CAY85529.1\| Cop11 protein [Carica papaya]	Back alignment and taxonomy information

>gi\|356520465\|ref\|XP_003528882.1\| PREDICTED: COP9 signalosome complex subunit 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|224130120\|ref\|XP_002320757.1\| predicted protein [Populus trichocarpa] gi\|222861530\|gb\|EEE99072.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224063977\|ref\|XP_002301330.1\| predicted protein [Populus trichocarpa] gi\|222843056\|gb\|EEE80603.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi|18411857|ref|NP_567109.1| COP9 signalosome complex subunit 1 [Arabidopsis thaliana] gi|20981686|sp|P45432.2|CSN1_ARATH RecName: Full=COP9 signalosome complex subunit 1; Short=CSN complex subunit 1; AltName: Full=Constitutive photomorphogenesis protein 11; AltName: Full=Protein FUSCA 6 gi|13430766|gb|AAK26005.1|AF360295_1 putative FUSCA protein FUS6 [Arabidopsis thaliana] gi|18056653|gb|AAL58100.1|AF395057_1 CSN complex subunit 1 [Arabidopsis thaliana] gi|15293245|gb|AAK93733.1| putative FUSCA protein FUS6 [Arabidopsis thaliana] gi|332646639|gb|AEE80160.1| COP9 signalosome complex subunit 1 [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		441
TAIR\|locus:2098851		441	FUS6 "FUSCA 6" [Arabidopsis th	0.997	0.997	0.809	3.1e-193
DICTYBASE\|DDB_G0283587		458	csn1 "COP9 signalosome complex	0.968	0.932	0.471	7.5e-105
FB\|FBgn0027057		525	CSN1b "COP9 complex homolog su	0.761	0.64	0.492	3.4e-94
UNIPROTKB\|F1NB10		487	GPS1 "Uncharacterized protein"	0.820	0.743	0.486	1.3e-86
UNIPROTKB\|F1NJQ7		491	GPS1 "Uncharacterized protein"	0.820	0.737	0.486	1.3e-86
ZFIN\|ZDB-GENE-041111-240		490	gps1 "G protein pathway suppre	0.820	0.738	0.490	1.3e-86
MGI\|MGI:2384801		471	Gps1 "G protein pathway suppre	0.820	0.768	0.486	5.4e-86
UNIPROTKB\|F1P996		433	GPS1 "Uncharacterized protein"	0.820	0.836	0.486	5.4e-86
UNIPROTKB\|C9JFE4		471	GPS1 "G protein pathway suppre	0.820	0.768	0.484	1.1e-85
RGD\|621532		471	Gps1 "G protein pathway suppre	0.820	0.768	0.484	1.1e-85

TAIR\|locus:2098851 FUS6 "FUSCA 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1872 (664.0 bits), Expect = 3.1e-193, P = 3.1e-193
 Identities = 358/442 (80%), Positives = 403/442 (91%)

Query:     1 MEPEDEQSNSMMEEICSNGGEESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADHC 60
             ME ++E S  MME +C+NGGEE++  RPIISGE LD+EAYA+LY+GRTKI RL+FIA+HC
Sbjct:     1 MERDEEASGPMME-MCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHC 59

Query:    61 D-IASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRK 119
                 ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  Y MD AWC++VDRRAEQ+K
Sbjct:    60 GGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKK 119

Query:   120 EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMC 179
              KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LGDAFK+Y+RTRDYCTT+KHIIHMC
Sbjct:   120 VKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMC 179

Query:   180 MSAILVSIEMGQFTHVTSYVSKAEQTPEALEPVTIAKLRCAAGLAHLEARKYKLAARKFL 239
             M+AILVSIEMGQFTHVTSYV+KAEQ PE LEP+  AKLRCA+GLAHLE +KYKLAARKFL
Sbjct:   180 MNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFL 239

Query:   240 EVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELI 299
             +V P+LGNSYNEVIA QD+ATYGGLCALASFDR+ELK KVIDN+NFRNFLELVP+VRELI
Sbjct:   240 DVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELI 299

Query:   300 NDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMA 359
             NDFYSSRYASCL+YL +LK+NLLLDIHLHDHV+TLYDQIR KALIQYT PFVSVDL  MA
Sbjct:   300 NDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMA 359

Query:   360 NAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDV 419
             +AFKTSV+G+EKELEALITDNQIQARIDSHNKILYARHADQRNATFQ+VLQ G+EFD+DV
Sbjct:   360 DAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDV 419

Query:   420 RAMLLRANLLKHEYNVRAARKL 441
             RAMLLRANLLKHEY+ R+ARKL
Sbjct:   420 RAMLLRANLLKHEYHARSARKL 441

GO:0005634 "nucleus" evidence=ISM;ISS;IDA

GO:0005515 "protein binding" evidence=IPI

GO:0008180 "signalosome" evidence=TAS;IPI

GO:0009640 "photomorphogenesis" evidence=RCA;TAS

GO:0000338 "protein deneddylation" evidence=TAS

GO:0006461 "protein complex assembly" evidence=IDA

GO:0006972 "hyperosmotic response" evidence=IEP

GO:0009646 "response to absence of light" evidence=IEP

GO:0009651 "response to salt stress" evidence=IEP

GO:0010388 "cullin deneddylation" evidence=RCA;IMP

GO:0005829 "cytosol" evidence=IDA

GO:0000003 "reproduction" evidence=RCA

GO:0006325 "chromatin organization" evidence=RCA

GO:0007062 "sister chromatid cohesion" evidence=RCA

GO:0007131 "reciprocal meiotic recombination" evidence=RCA

GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;RCA

GO:0009845 "seed germination" evidence=RCA

GO:0009880 "embryonic pattern specification" evidence=RCA

GO:0009909 "regulation of flower development" evidence=RCA

GO:0009933 "meristem structural organization" evidence=RCA

GO:0010072 "primary shoot apical meristem specification" evidence=RCA

GO:0010090 "trichome morphogenesis" evidence=RCA

GO:0010162 "seed dormancy process" evidence=RCA

GO:0010182 "sugar mediated signaling pathway" evidence=RCA

GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA

GO:0010431 "seed maturation" evidence=RCA

GO:0010564 "regulation of cell cycle process" evidence=RCA

GO:0010638 "positive regulation of organelle organization" evidence=RCA

GO:0016567 "protein ubiquitination" evidence=RCA

GO:0016571 "histone methylation" evidence=RCA

GO:0016579 "protein deubiquitination" evidence=RCA

GO:0019915 "lipid storage" evidence=RCA

GO:0033044 "regulation of chromosome organization" evidence=RCA

GO:0045595 "regulation of cell differentiation" evidence=RCA

GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA

GO:0048366 "leaf development" evidence=RCA

GO:0048825 "cotyledon development" evidence=RCA

GO:0050826 "response to freezing" evidence=RCA

GO:0051301 "cell division" evidence=RCA

DICTYBASE\|DDB_G0283587 csn1 "COP9 signalosome complex subunit 1" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

FB\|FBgn0027057 CSN1b "COP9 complex homolog subunit 1 b" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NB10 GPS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NJQ7 GPS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041111-240 gps1 "G protein pathway suppressor 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:2384801 Gps1 "G protein pathway suppressor 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P996 GPS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|C9JFE4 GPS1 "G protein pathway suppressor 1, isoform CRA_b" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|621532 Gps1 "G protein pathway suppressor 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q13098	CSN1_HUMAN	No assigned EC number	0.4535	0.9229	0.8289	yes	no
Q54QX3	CSN1_DICDI	No assigned EC number	0.4864	0.9070	0.8733	yes	no
P45432	CSN1_ARATH	No assigned EC number	0.8099	0.9977	0.9977	yes	no
Q99LD4	CSN1_MOUSE	No assigned EC number	0.4576	0.9229	0.8641	yes	no
P68352	CSN1_BRAOL	No assigned EC number	0.9459	0.0816	0.9729	N/A	no
P97834	CSN1_RAT	No assigned EC number	0.4553	0.9229	0.8641	yes	no
Q5BD89	CSN1_EMENI	No assigned EC number	0.3614	0.9682	0.8574	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00026238001	SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (441 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00036331001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (329 aa)	•	•	•		0.880
	GSVIVG00020552001	SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (424 aa)	•	•	•		0.861
	GSVIVG00014641001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (397 aa)	•	•	•		0.847
	GSVIVG00023341001	SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (433 aa)	•	•	•	•	0.847
	GSVIVG00019091001	SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (259 aa)	•	•	•		0.729
	GSVIVG00003356001	SubName- Full=Chromosome undetermined scaffold_142, whole genome shotgun sequence; (310 aa)	•	•	•		0.709
	GSVIVG00028385001	SubName- Full=Chromosome chr10 scaffold_43, whole genome shotgun sequence; (1089 aa)	•	•	•		0.578
	GSVIVG00013117001	SubName- Full=Chromosome undetermined scaffold_437, whole genome shotgun sequence; (180 aa)		•	•		0.496
	GSVIVG00024530001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (454 aa)	•				0.495
	GSVIVG00031512001	SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (76 aa)		•	•		0.462

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		441
pfam10602		174	pfam10602, RPN7, 26S proteasome subunit RPN7	2e-64
COG5187		412	COG5187, RPN7, 26S proteasome regulatory complex c	9e-20
pfam01399		100	pfam01399, PCI, PCI domain	2e-18
smart00753		88	smart00753, PAM, PCI/PINT associated module	1e-14
smart00088		88	smart00088, PINT, motif in proteasome subunits, In	1e-14
COG5159		421	COG5159, RPN6, 26S proteasome regulatory complex c	8e-07

>gnl\|CDD\|220821 pfam10602, RPN7, 26S proteasome subunit RPN7	Back alignment and domain information

 Score =  204 bits (522), Expect = 2e-64
 Identities = 69/176 (39%), Positives = 98/176 (55%), Gaps = 3/176 (1%)

Query: 104 DEAWCDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYV 163
           DEAW + + ++ E+  E+L+ EL   + NL KE IR    D  + Y   G L +A K+Y 
Sbjct: 1   DEAWVEELRKKNEEELEELDAELKDAKENLGKEEIRRALLDLAEHYAKIGDLENALKAYS 60

Query: 164 RTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEALEP-VTIAKLRCAAG 222
           R R+YCT+  H I MC++ I V I    + HV+ Y+ KA+   E         +L+   G
Sbjct: 61  RAREYCTSLGHKIDMCLNLIRVGIFFNDWDHVSKYIEKAKSLIEKGGDWERRNRLKVYEG 120

Query: 223 LAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSK 278
           LA L  R +K AA+ FL+      +   E+I+ +DVA YG LCALAS DR +LK K
Sbjct: 121 LALLAIRDFKEAAKLFLDSLSTFTS--TELISYEDVAIYGVLCALASLDRVDLKKK 174

RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins. Length = 174

>gnl\|CDD\|227514 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|216479 pfam01399, PCI, PCI domain	Back alignment and domain information

>gnl\|CDD\|214803 smart00753, PAM, PCI/PINT associated module	Back alignment and domain information

>gnl\|CDD\|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15	Back alignment and domain information

>gnl\|CDD\|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		441
KOG0686		466	consensus COP9 signalosome, subunit CSN1 [Posttran	100.0
KOG0687		393	consensus 26S proteasome regulatory complex, subun	100.0
COG5187		412	RPN7 26S proteasome regulatory complex component,	100.0
KOG2758		432	consensus Translation initiation factor 3, subunit	100.0
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	100.0
KOG1463		411	consensus 26S proteasome regulatory complex, subun	99.96
COG5159		421	RPN6 26S proteasome regulatory complex component [	99.94
KOG1464		440	consensus COP9 signalosome, subunit CSN2 [Posttran	99.93
KOG1498		439	consensus 26S proteasome regulatory complex, subun	99.81
PF01399		105	PCI: PCI domain; InterPro: IPR000717 A homology do	99.74
COG5071		439	RPN5 26S proteasome regulatory complex component [	99.72
KOG1497		399	consensus COP9 signalosome, subunit CSN4 [Posttran	99.68
smart00088		88	PINT motif in proteasome subunits, Int-6, Nip-1 an	99.49
smart00753		88	PAM PCI/PINT associated module.	99.49
KOG2908		380	consensus 26S proteasome regulatory complex, subun	99.31
KOG2581		493	consensus 26S proteasome regulatory complex, subun	99.15
PF09440		133	eIF3_N: eIF3 subunit 6 N terminal domain; InterPro	99.09
KOG2582		422	consensus COP9 signalosome, subunit CSN3 [Posttran	98.67
KOG1076		843	consensus Translation initiation factor 3, subunit	98.41
KOG2753		378	consensus Uncharacterized conserved protein, conta	98.3
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	97.58
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.41
COG5600		413	Transcription-associated recombination protein [DN	97.23
PF10255		404	Paf67: RNA polymerase I-associated factor PAF67; I	97.09
KOG2688		394	consensus Transcription-associated recombination p	97.09
KOG2072		988	consensus Translation initiation factor 3, subunit	96.97
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	96.87
PF10075		143	PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro	96.8
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	96.55
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	96.32
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	96.3
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	96.21
PF09756		188	DDRGK: DDRGK domain; InterPro: IPR019153 This is a	95.93
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	95.75
PRK11788		389	tetratricopeptide repeat protein; Provisional	95.74
PF12688		120	TPR_5: Tetratrico peptide repeat	95.67
PF09012		69	FeoC: FeoC like transcriptional regulator; InterPr	95.23
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	95.16
TIGR02552		135	LcrH_SycD type III secretion low calcium response	94.92
PF03399		204	SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I	94.9
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	94.87
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	94.73
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	94.66
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	94.65
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	94.47
KOG3677		525	consensus RNA polymerase I-associated factor - PAF	94.42
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	94.41
PF08220		57	HTH_DeoR: DeoR-like helix-turn-helix domain; Inter	94.26
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	94.23
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	94.05
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	93.98
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	93.95
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	93.94
PRK15331		165	chaperone protein SicA; Provisional	93.92
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	93.89
KOG2003		840	consensus TPR repeat-containing protein [General f	93.79
KOG1861		540	consensus Leucine permease transcriptional regulat	93.76
PRK11788		389	tetratricopeptide repeat protein; Provisional	93.71
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	93.55
PRK10803		263	tol-pal system protein YbgF; Provisional	93.26
PRK15359		144	type III secretion system chaperone protein SscB;	93.26
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	92.83
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	92.8
KOG3054		299	consensus Uncharacterized conserved protein [Funct	92.74
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	92.64
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	92.57
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	92.41
KOG2796		366	consensus Uncharacterized conserved protein [Funct	92.28
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	92.2
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	92.16
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	92.15
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	92.05
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	91.89
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	91.6
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	91.53
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	91.44
PRK15431		78	ferrous iron transport protein FeoC; Provisional	91.4
smart00345		60	HTH_GNTR helix_turn_helix gluconate operon transcr	91.32
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	91.19
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	91.17
PRK10370		198	formate-dependent nitrite reductase complex subuni	91.17
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	91.15
KOG0547		606	consensus Translocase of outer mitochondrial membr	91.02
PRK12370		553	invasion protein regulator; Provisional	90.76
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	90.55
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	90.46
PF08279		55	HTH_11: HTH domain; InterPro: IPR013196 Winged hel	89.88
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	89.77
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	89.52
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	89.42
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	89.4
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	88.96
smart00420		53	HTH_DEOR helix_turn_helix, Deoxyribose operon repr	88.58
PRK11189		296	lipoprotein NlpI; Provisional	88.46
PRK10803		263	tol-pal system protein YbgF; Provisional	88.39
PF13428		44	TPR_14: Tetratricopeptide repeat	88.35
PRK14574		822	hmsH outer membrane protein; Provisional	88.17
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	88.17
KOG1126		638	consensus DNA-binding cell division cycle control	87.84
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	87.45
PRK12370		553	invasion protein regulator; Provisional	87.2
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	87.19
KOG1125		579	consensus TPR repeat-containing protein [General f	87.15
PF13371		73	TPR_9: Tetratricopeptide repeat	86.85
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	86.85
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	86.61
PF13512		142	TPR_18: Tetratricopeptide repeat	86.57
KOG1586		288	consensus Protein required for fusion of vesicles	86.43
PF00392		64	GntR: Bacterial regulatory proteins, gntR family;	86.27
COG1849		90	Uncharacterized protein conserved in archaea [Func	86.24
PF08784		102	RPA_C: Replication protein A C terminal; InterPro:	85.81
KOG3785		557	consensus Uncharacterized conserved protein [Funct	85.68
KOG2376		652	consensus Signal recognition particle, subunit Srp	85.57
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	85.44
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	85.42
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	85.22
PRK11189		296	lipoprotein NlpI; Provisional	85.13
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	84.95
PF13412		48	HTH_24: Winged helix-turn-helix DNA-binding; PDB:	84.46
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	84.3
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	83.76
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	83.56
COG4105		254	ComL DNA uptake lipoprotein [General function pred	83.54
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	83.35
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	83.33
PF09743		272	DUF2042: Uncharacterized conserved protein (DUF204	83.29
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	83.06
KOG1585		308	consensus Protein required for fusion of vesicles	83.0
PF03704		146	BTAD: Bacterial transcriptional activator domain;	82.07
COG4700		251	Uncharacterized protein conserved in bacteria cont	82.0
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	82.0
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	81.92
KOG2076		895	consensus RNA polymerase III transcription factor	81.89
PRK10411		240	DNA-binding transcriptional activator FucR; Provis	81.87
PF11817		247	Foie-gras_1: Foie gras liver health family 1; Inte	81.82
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	81.81
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	81.67
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	81.66
PRK10434		256	srlR DNA-bindng transcriptional repressor SrlR; Pr	81.52
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	81.46
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	81.3
PRK04424		185	fatty acid biosynthesis transcriptional regulator;	80.63
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	80.54
PRK04841		903	transcriptional regulator MalT; Provisional	80.52
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	80.22

>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=8.3e-86  Score=641.09  Aligned_cols=434  Identities=49%  Similarity=0.811  Sum_probs=403.0

Q ss_pred             CCCCccccchhhhhhhhcCCCCCCCCCccccC-CcCCHHHHhhccCchhhHHHHHHHHhcCCCchhHHHHHHHHHHHHHh
Q 013559            1 MEPEDEQSNSMMEEICSNGGEESARTRPIISG-EQLDVEAYASLYQGRTKITRLMFIADHCDIASMQLEALRMAYDEIKK   79 (441)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~-~~~Dl~~y~~~y~g~~~i~rL~fi~~~~~~~~~~~~a~~~~~~~lk~   79 (441)
                      |+...+-++||+.+........  .+.-.+.. -++|+|+|.++|.|+.+|-||.|||+||  |.++.+|+++|++++|+
T Consensus         1 mp~~~~a~~pm~~d~~~~~~~~--~N~ee~~~~leidie~yA~~Y~g~~~i~RllfIA~~c--p~Lr~~Al~~Ai~~vk~   76 (466)
T KOG0686|consen    1 MPAAEQAVEPMQIDREPTPEDI--ENDEELQLVLEIDIEAYAASYEGRNRILRLLFIARHC--PDLRVEALRMAIDEVKE   76 (466)
T ss_pred             CCchhhcCccccccccCCCccC--CChHHHHhcccchHHHHHHhcccHHHHHHHHHHHHhC--chHHHHHHHHHHHHHHh
Confidence            6667778888885333321111  11111111 2389999999999999999999999999  99999999999999999


Q ss_pred             -cCChHHHHHHHH--HhhccCC-----------CCCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHhHH
Q 013559           80 -GENTQLFREVVK--KIDGRLG-----------PNYAMDEAWCDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDF  145 (441)
Q Consensus        80 -t~~~~~Y~~~~~--~l~~~~~-----------~~~~~D~~~~~~~~~~~~~~~~~Le~el~~~~~n~~~esir~~~~~l  145 (441)
                       |.+++.|.++++  ++.+.+|           ...+.|.+|+++...+..+++++|+.||+.||+|+||||||+++.++
T Consensus        77 ~t~nv~ly~~l~~~~k~~~~L~~~~~~~~~~~~e~~~~D~~WvE~~~~~a~~~le~L~~eLk~yK~n~iKEsiRra~~Dl  156 (466)
T KOG0686|consen   77 DTYNVDLYQELFNASKIQGELGRAPFKNPQLGFEGYLLDEKWVETNNKKAVLKLEKLDNELKSYKDNLIKESIRRALEDL  156 (466)
T ss_pred             cCcchhHHHHHHHHHHhcchhhcCCCCCccccccccccchHHHHHhhHHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHH
Confidence             999999999999  7776654           25788999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHhhhcCchhHHHHHHHHHHHHHHhcCHHHHHhHHHHHhcccc---cCChhhhhhHHHHHH
Q 013559          146 GDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFTHVTSYVSKAEQTPE---ALEPVTIAKLRCAAG  222 (441)
Q Consensus       146 a~~~~~~Gd~~~A~~~~~~~r~~~~~~~~~~~~~l~~i~~~i~~~~~~~~~~~~~ka~~~~~---~~d~~~~~~l~~~~g  222 (441)
                      |+||++||+++.|+++|.++|+|||+.+|.++||+++|+++|+.|||.||..+++||++.++   ........+++|+.|
T Consensus       157 ~dhy~~cG~l~~Alr~YsR~RdYCTs~khvInm~ln~i~VSI~~~nw~hv~sy~~~A~st~~~~~~~~q~v~~kl~C~ag  236 (466)
T KOG0686|consen  157 GDHYLDCGQLDNALRCYSRARDYCTSAKHVINMCLNLILVSIYMGNWGHVLSYISKAESTPDANENLAQEVPAKLKCAAG  236 (466)
T ss_pred             HHHHHHhccHHHHHhhhhhhhhhhcchHHHHHHHHHHHHHHHhhcchhhhhhHHHHHHhCchhhhhHHHhcCcchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999985   334567789999999


Q ss_pred             HHhcccccHHHHHHHHHhcCcCCCCCchhhhcHHHHHHHHHHHHHhcCChHHHHHhcccCHhhHhhhccchHHHHHHHHH
Q 013559          223 LAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRELINDF  302 (441)
Q Consensus       223 l~~l~~r~y~~Aa~~Fl~~~~t~~~~~~el~s~~d~~~Y~~l~al~s~~R~eLk~~vl~~~~~~~~le~~p~~~~ll~~f  302 (441)
                      ++++..|+|+.|+.+|+.+..+..+ ++|++++.|+++|++||||+||+|.+|+..|++|.+|+.|++.+|.++++|.+|
T Consensus       237 La~L~lkkyk~aa~~fL~~~~~~~d-~~~ivtpsdv~iYggLcALAtfdr~~Lk~~vi~n~~Fk~flel~Pqlr~il~~f  315 (466)
T KOG0686|consen  237 LANLLLKKYKSAAKYFLLAEFDHCD-YPEIVTPSDVAIYGGLCALATFDRQDLKLNVIKNESFKLFLELEPQLREILFKF  315 (466)
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCccC-ccceecchhhHHHHhhHhhccCCHHHHHHHHHcchhhhhHHhcChHHHHHHHHH
Confidence            9999999999999999999988776 899999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCHHHHHHHHHHhHHhhhhchhHHHHHHHHHHHHHHHHHHHhccccccccHHhHHHHcCCChHHHHHHHHHHHHcCcc
Q 013559          303 YSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQI  382 (441)
Q Consensus       303 ~~~~y~~~~~~L~~~~~~l~~D~~L~~h~~~l~~~iR~~~i~qy~~pYs~I~L~~mA~~fg~s~~~~E~~L~~LI~~g~L  382 (441)
                      |+++|..|++.|.++++.+++|+||++||+.|+..||.|++.||+.||++++++.||.+||+|+.++|++|.+||.+|+|
T Consensus       316 y~sky~~cl~~L~~~k~~llLD~yLaphVd~Ly~~IR~r~llqy~~py~s~~m~~mA~af~~sv~~le~~l~~LI~~~~i  395 (466)
T KOG0686|consen  316 YSSKYASCLELLREIKPRLLLDMYLAPHVDNLYSLIRNRALLQYLSPYSSADMSKMAEAFNTSVAILESELLELILEGKI  395 (466)
T ss_pred             hhhhHHHHHHHHHHhccceeechhcchhHHHHHHHHHHhhHHHhcCccccchHHHHHHHhcccHHHHHHHHHHHHHccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEecCCCCeEEEecCCchhHHHHHHHHHHhhHHHHHHHHHHHHHHHhccceeccCC
Q 013559          383 QARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAMLLRANLLKHEYNVRAAR  439 (441)
Q Consensus       383 ~akID~~~gvv~~~~~d~r~~~~~~~i~~~~~~~~~~~~l~lR~~~~~~~~~v~~~~  439 (441)
                      +||||+++|+|++.+.++++++++++.-.|+.+.+.++++++|+.++.+.+.+++.+
T Consensus       396 ~~rIDs~~ki~~~~~~~~en~~fe~~~~~~~~~~~~~kal~lr~~~~~~~~ht~s~~  452 (466)
T KOG0686|consen  396 SGRIDSHNKILYARDADSENATFERVLPMGKRSQLEAKALLLRAALLKNKIHTKSLP  452 (466)
T ss_pred             heeeccccceeeecccccccchhhhcchhhHHHHHHHHHHHHHHHHHhccccCCCcc
Confidence            999999999999999999999999999999999999999999999999999998754

>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins	Back alignment and domain information

>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15	Back alignment and domain information

>smart00753 PAM PCI/PINT associated module	Back alignment and domain information

>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09440 eIF3_N: eIF3 subunit 6 N terminal domain; InterPro: IPR019010 This entry represents the N-terminal domain of subunit 6 (or e) (eIF3e) of the translation initiation factor eIF3	Back alignment and domain information

>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 []	Back alignment and domain information

>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>KOG3677 consensus RNA polymerase I-associated factor - PAF67 [Translation, ribosomal structure and biogenesis; Transcription]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1861 consensus Leucine permease transcriptional regulator [Transcription]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG3054 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK15431 ferrous iron transport protein FeoC; Provisional	Back alignment and domain information

>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities	Back alignment and domain information

>COG1849 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A)	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PRK10411 DNA-binding transcriptional activator FucR; Provisional	Back alignment and domain information

>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease []	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		441
4b4t_R		429	Near-Atomic Resolution Structural Model Of The Yeas		2e-15
4b4t_Q		434	Near-Atomic Resolution Structural Model Of The Yeas		4e-05
3txm_A		394	Crystal Structure Of Rpn6 From Drosophila Melanogas		7e-05

>pdb|4B4T|R Chain R, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 429

Back alignment and structure

Iteration: 1

Score = 80.1 bits (196), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 55/189 (29%), Positives = 92/189 (48%), Gaps = 9/189 (4%) Query: 233 LAARKFLEVGPDLGNSYN-----EVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRN 287 LA R F E L +S E+ + + +ATY + L + +R +LKSKVID+ + Sbjct: 219 LAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLS 278 Query: 288 FLEL---VPEVRELINDFYSSRYASCLDYLGNLKANLLLDI-HLHDHVETLYDQIRNKAL 343 + + + L Y+S YAS YL AN+L+ +L+ H + ++R K Sbjct: 279 LISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVY 338 Query: 344 IQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNA 403 Q + ++ L MA+AF SVA ++ +L I + Q+ ID N I+ D +NA Sbjct: 339 AQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNA 398 Query: 404 TFQRVLQTG 412 + +++ G Sbjct: 399 QYHLLVKQG 407

PyMOL of 4b4t

>pdb|4B4T|Q Chain Q, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434

Back alignment and structure

>pdb|3TXM|A Chain A, Crystal Structure Of Rpn6 From Drosophila Melanogaster, Gd(3+) Complex Length = 394

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		441
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	8e-46
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394	Back alignment and structure

 Score =  162 bits (410), Expect = 8e-46
 Identities = 50/316 (15%), Positives = 109/316 (34%), Gaps = 7/316 (2%)

Query: 116 EQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHI 175
           +   E  + E   +    ++  +   Y D   +  A        +   +  D       +
Sbjct: 83  KDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDD----KNLL 138

Query: 176 IHMCMSAILVSIEMGQFTHVTSYVSKAEQTPEAL--EPVTIAKLRCAAGLAHLEARKYKL 233
           + + +        +       + ++ A  T  A+   P     L   +G+ H    +   
Sbjct: 139 VEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFK 198

Query: 234 AARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVP 293
            A  +     +  +S + V A      Y  LC +      ++   V   +        + 
Sbjct: 199 TAFSYFYEAFEGFDSVDSVKALT-SLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDID 257

Query: 294 EVRELINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSV 353
            ++ +    +    A     L   K  L  D+ +  H+ TLYD +  + L +   P+  V
Sbjct: 258 AMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRV 317

Query: 354 DLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGS 413
            +  +A + +  +  +EK+L  +I D +    +D    +L        + T++RVL+T  
Sbjct: 318 QVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQ 377

Query: 414 EFDQDVRAMLLRANLL 429
              + V  +  +A  L
Sbjct: 378 SMGKVVDTLYQKAKKL 393

PyMOL of 3txn

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		441
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	100.0
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	100.0
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.97
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	99.96
4b4t_O		393	26S proteasome regulatory subunit RPN9; hydrolase,	99.77
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	99.54
1ufm_A		84	COP9 complex subunit 4; helix-turn-helix, structur	99.49
3t5x_A		203	PCI domain-containing protein 2; PCI, mRNA nuclear	99.49
3t5v_B		455	Nuclear mRNA export protein THP1; PCI, mRNA nuclea	99.23
3chm_A		169	COP9 signalosome complex subunit 7; heat/ARM repea	98.4
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	97.9
4b0z_A		229	RPN12, 26S proteasome regulatory subunit RPN12; pr	97.79
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	97.74
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	97.65
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	97.53
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	97.53
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	97.49
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	97.46
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	97.46
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	97.45
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	97.44
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	97.43
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	97.42
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	97.41
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	97.4
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	97.35
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	97.32
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	97.32
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	97.31
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.3
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.2
3u4t_A		272	TPR repeat-containing protein; structural genomics	97.2
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	97.19
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	97.15
1wi9_A		72	Protein C20ORF116 homolog; helix-turn-helix motif,	97.05
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	97.02
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	97.0
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	96.94
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	96.91
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	96.87
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	96.86
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	96.85
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	96.84
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	96.84
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	96.81
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	96.81
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	96.79
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	96.78
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	96.76
2l6j_A		111	TPR repeat-containing protein associated with HSP;	96.72
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	96.7
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	96.66
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	96.66
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	96.65
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	96.64
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	96.62
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	96.53
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	96.52
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	96.51
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	96.48
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	96.47
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	96.44
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	96.43
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	96.42
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	96.39
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	96.3
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	96.29
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	96.29
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	96.28
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	96.26
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	96.26
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	96.21
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	96.19
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	96.14
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	96.11
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	96.1
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	96.09
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	96.07
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	96.04
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	95.98
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	95.92
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	95.91
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	95.9
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	95.83
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	95.83
3u4t_A		272	TPR repeat-containing protein; structural genomics	95.8
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	95.79
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	95.77
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	95.75
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	95.63
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	95.6
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	95.53
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	95.53
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	95.51
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	95.49
4g1t_A		472	Interferon-induced protein with tetratricopeptide	95.48
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	95.46
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	95.45
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	95.41
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	95.39
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	95.36
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	95.33
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	95.3
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	95.27
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	95.24
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	95.2
4b4t_T		274	26S proteasome regulatory subunit RPN12; hydrolase	95.16
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	95.12
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	94.99
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	94.98
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	94.92
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	94.88
1rz4_A		226	Eukaryotic translation initiation factor 3 subuni;	94.81
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	94.69
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	94.69
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	94.67
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	94.59
3k9i_A		117	BH0479 protein; putative protein binding protein,	94.56
2gw1_A		514	Mitochondrial precursor proteins import receptor;	94.56
3k9i_A		117	BH0479 protein; putative protein binding protein,	94.55
1xn7_A		78	Hypothetical protein YHGG; alpha+beta, GFT structu	94.53
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	94.35
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	94.29
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	94.23
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	94.18
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	94.11
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	94.03
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	93.89
2k02_A		87	Ferrous iron transport protein C; FEOC, iron-sulfu	93.85
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	93.74
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	93.73
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	93.72
2gw1_A		514	Mitochondrial precursor proteins import receptor;	93.47
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	93.46
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	93.39
2kat_A		115	Uncharacterized protein; NESG, structure, structur	93.24
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	93.03
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	93.0
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	92.8
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	92.79
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	92.78
2jt1_A		77	PEFI protein; solution structure, winged helix-tur	92.75
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	92.7
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	92.61
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	92.59
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	92.28
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	92.21
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	92.18
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	92.13
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	92.11
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	92.07
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	92.07
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	91.59
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	91.57
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	91.53
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	91.43
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	91.37
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	91.35
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	91.24
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	91.22
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	91.15
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	90.85
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	90.82
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	90.8
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	90.65
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	90.46
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	90.38
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	90.38
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	90.2
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	90.04
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	89.93
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	89.83
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	89.18
1qgp_A		77	Protein (double stranded RNA adenosine deaminase);	89.18
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	88.77
1qbj_A		81	Protein (double-stranded RNA specific adenosine D	88.75
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	88.61
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	88.34
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	88.23
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	88.1
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	87.43
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	86.99
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	86.67
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	86.52
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	86.45
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	86.26
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	85.9
3tqn_A		113	Transcriptional regulator, GNTR family; regulatory	85.54
2heo_A		67	Z-DNA binding protein 1; protein DLM1-Z-DNA comple	85.28
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	85.23
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	83.94
3by6_A		126	Predicted transcriptional regulator; structural ge	83.79
2b0l_A		102	GTP-sensing transcriptional pleiotropic repressor;	83.5
4g1t_A		472	Interferon-induced protein with tetratricopeptide	82.76
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	82.55
3neu_A		125	LIN1836 protein; structural genomics, PSI-2, prote	82.42
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	82.13
1sfx_A		109	Conserved hypothetical protein AF2008; structural	82.09
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	81.45
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	81.11
2htj_A		81	P fimbrial regulatory protein KS71A; winged helix-	80.91
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	80.57
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	80.19

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

Probab=100.00  E-value=7.5e-66  Score=532.26  Aligned_cols=373  Identities=19%  Similarity=0.289  Sum_probs=310.8

Q ss_pred             hHHHHHHHHhcCC-CchhHHHHHHHHHHHHHhcCChHHHHHHHHHhhccCC--------------CCCcCCHHHHHHHHH
Q 013559           49 KITRLMFIADHCD-IASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLG--------------PNYAMDEAWCDSVDR  113 (441)
Q Consensus        49 ~i~rL~fi~~~~~-~~~~~~~a~~~~~~~lk~t~~~~~Y~~~~~~l~~~~~--------------~~~~~D~~~~~~~~~  113 (441)
                      .+.++.|+..+.. .+..+.++++.+++.+|+++|+|+|+.+|+.+....+              ...++|++|++.++.
T Consensus        25 ~la~~~f~l~~~~~~~~~~~~~~~~l~~~ik~~~ma~~y~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~  104 (429)
T 4b4t_R           25 EVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCK  104 (429)
T ss_dssp             -----------------CHHHHHHHHHHHHHHTCCHHHHHHHHHHSCCCCSCCSSCSHHHHHHHHHTTTTCCSSCTTTTC
T ss_pred             HHHHHHHHhcCCCCChhhHHHHHHHHHHHHHHhCCHHHHHHHHHHHhhcccchhhhhhhhhhhhhhcchHHHHHHHHHHH
Confidence            3567788776542 2567889999999999999999999999998763211              024789999999999


Q ss_pred             HHHHHHHHHHHHHHHHHh-hhhHHHHHhHHhHHHHHHHHcCCHHHHHHHHHHHHhhhcCchhHHHHHHHHHHHHHHhcCH
Q 013559          114 RAEQRKEKLENELNAYRT-NLIKESIRMGYNDFGDFYYAHGALGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQF  192 (441)
Q Consensus       114 ~~~~~~~~Le~el~~~~~-n~~~esir~~~~~la~~~~~~Gd~~~A~~~~~~~r~~~~~~~~~~~~~l~~i~~~i~~~~~  192 (441)
                      .|..++++|++.++.+++ +.++.++|+++.+||+||+++||+++|.++|.+++++|++++|+++++|+++|++++.+||
T Consensus       105 ~n~~~l~~l~~~~~~~~~~~~~e~e~~~~~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~kid~~l~~irl~l~~~d~  184 (429)
T 4b4t_R          105 KNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQ  184 (429)
T ss_dssp             CSSCCHHHHHHHHHHHHHCCSCCCCCSSCCHHHHHHHHHHCCCTTHHHHHHHHHHHHTCCCSHHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHHHHHHHHHHHHhhccccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhccH
Confidence            999999999999999866 6777789999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhHHHHHhcccc-cCChhhhhhHHHHHHHHhcccccHHHHHHHHHhcCcCCCCCchhhhcHHHHHHHHHHHHHhcCC
Q 013559          193 THVTSYVSKAEQTPE-ALEPVTIAKLRCAAGLAHLEARKYKLAARKFLEVGPDLGNSYNEVIAAQDVATYGGLCALASFD  271 (441)
Q Consensus       193 ~~~~~~~~ka~~~~~-~~d~~~~~~l~~~~gl~~l~~r~y~~Aa~~Fl~~~~t~~~~~~el~s~~d~~~Y~~l~al~s~~  271 (441)
                      .++..+++|++..++ ++||.+++++++|.|+++++.|+|.+|+++|++++.+++  +.+.+++.++++|++||++++++
T Consensus       185 ~~~~~~~~ka~~~~~~~~d~~~~~~lk~~~gl~~l~~r~f~~Aa~~f~e~~~t~~--~~e~~~~~~~~~y~~l~al~~~~  262 (429)
T 4b4t_R          185 LYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFT--SIELTSYESIATYASVTGLFTLE  262 (429)
T ss_dssp             HHHHHHHHHHHHHHTTCCCTHHHHHHHHHHHHGGGGTSCHHHHHHHHHHHHHHSC--CSCHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHhhhcCCCHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHhccCC--ccchhhHHHHHHHHHHHHHhcCC
Confidence            999999999999887 789999999999999999999999999999999999886  67899999999999999999999


Q ss_pred             hHHHHHhcccCHhhHhhhccchHH---HHHHHHHhcCCHHHHHHHH-HHhHHhhhhchhHHHHHHHHHHHHHHHHHHHhc
Q 013559          272 RAELKSKVIDNVNFRNFLELVPEV---RELINDFYSSRYASCLDYL-GNLKANLLLDIHLHDHVETLYDQIRNKALIQYT  347 (441)
Q Consensus       272 R~eLk~~vl~~~~~~~~le~~p~~---~~ll~~f~~~~y~~~~~~L-~~~~~~l~~D~~L~~h~~~l~~~iR~~~i~qy~  347 (441)
                      |++++.+|+++++++.+++.+|.+   .+++.+|++++|..|++.+ ......+..|+|+++|++.|+++||.+++.||+
T Consensus       263 r~~l~~~v~~~~~~~~~l~~~p~~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~d~~l~~h~~~l~~~ir~~~l~q~~  342 (429)
T 4b4t_R          263 RTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLL  342 (429)
T ss_dssp             HHHHHHSSSSSHHHHHGGGSHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHSTTTTTCTTSTTTHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCHHHHhhccCChhHHHHHHHHHHHHhccHHHHHHHHHHHHHhhhccCHHHHHHHHHHHHHHHHHHHHHHh
Confidence            999999999999999999988865   5679999999999998865 556778999999999999999999999999999


Q ss_pred             cccccccHHhHHHHcCCChHHHHHHHHHHHHcCccceEecCCCCeEEEecCCchhHHHHHHHHHHhhHHHHHHHHH
Q 013559          348 HPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRAML  423 (441)
Q Consensus       348 ~pYs~I~L~~mA~~fg~s~~~~E~~L~~LI~~g~L~akID~~~gvv~~~~~d~r~~~~~~~i~~~~~~~~~~~~l~  423 (441)
                      +||++|+|++||++||+|++++|++|++||.+|+|+||||+++|+|++++||+++++|+++|++||.+.++++.+-
T Consensus       343 ~~Ys~I~l~~mA~~l~~s~~~~E~~L~~lI~~g~l~akID~~~giv~~~~~d~~~~~y~~~i~~gd~Ll~riqkl~  418 (429)
T 4b4t_R          343 ESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYG  418 (429)
T ss_dssp             HTCSEEEHHHHHHHHTSCHHHHHHHHHHHHHHTSSCEEEETTTTEEEECC--------------------------
T ss_pred             HHhceeeHHHHHHHhCcCHHHHHHHHHHHHHcCCeEEEEcCCCCEEEECCCCchhHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999988763

PyMOL of 4b4t

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47	Back alignment and structure

>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens}	Back alignment and structure

>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii}	Back alignment and structure

>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni}	Back alignment and structure

>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua}	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50	Back alignment and structure

Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		441
d1ufma_		84	a.4.5.47 (A:) COP9 signalosome complex subunit 4,	6e-10

>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84	Back information, alignment and structure


class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 53.2 bits (128), Expect = 6e-10
 Identities = 10/77 (12%), Positives = 27/77 (35%)

Query: 329 DHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDS 388
                L   +    L+  +  + ++    +    +   A  EK    +IT+ ++   ID 
Sbjct: 7   GGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQ 66

Query: 389 HNKILYARHADQRNATF 405
            + I++    +    + 
Sbjct: 67  IDGIVHFETREASGPSS 83

PyMOL of d1ufma_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		441
d1ufma_		84	COP9 signalosome complex subunit 4, GSN4 {Mouse (M	99.46
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.28
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.37
d1wi9a_		72	Hypothetical protein C20orf116 homolog {Mouse (Mus	96.83
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	96.32
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	96.29
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	96.21
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	96.18
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	96.12
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	96.11
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	96.0
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	95.91
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	95.75
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	95.68
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	95.48
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	95.41
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	95.24
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	95.08
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	94.94
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	94.45
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	94.16
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	93.74
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	93.65
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	93.56
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	93.03
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	91.94
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	91.59
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	91.55
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	91.33
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	90.98
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	90.83
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	90.54
d2hs5a1		69	Putative transcriptional regulator RHA1_ro03477 {R	90.36
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	90.32
d3bwga1		78	Transcriptional regulator YydK {Bacillus subtilis	89.93
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	89.12
d2cfxa1		63	Transcriptional regulator LrpC {Bacillus subtilis	89.1
d1hw1a1		74	Fatty acid responsive transcription factor FadR, N	87.91
d2cg4a1		63	Regulatory protein AsnC {Escherichia coli [TaxId:	87.79
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	87.74
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	86.58
d1z05a1		71	Transcriptional regulator VC2007 N-terminal domain	85.72
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	84.66
d1i1ga1		60	LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]}	84.47
d1z6ra1		70	Mlc protein N-terminal domain {Escherichia coli [T	84.28
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	82.88
d1j5ya1		65	Putative transcriptional regulator TM1602, N-termi	82.13
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	81.21
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	80.88
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	80.45
d1k78a1		63	Pax-5 {Human (Homo sapiens) [TaxId: 9606]}	80.16

>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.46  E-value=3.9e-14  Score=110.18  Aligned_cols=67  Identities=15%  Similarity=0.242  Sum_probs=60.8

Q ss_pred             HHHHHHHHHHHHhccccccccHHhHHHHcCCChHHHHHHHHHHHHcCccceEecCCCCeEEEecCCc
Q 013559          334 LYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQ  400 (441)
Q Consensus       334 l~~~iR~~~i~qy~~pYs~I~L~~mA~~fg~s~~~~E~~L~~LI~~g~L~akID~~~gvv~~~~~d~  400 (441)
                      |.++++...+..+-++|++|+|+.||+.||++++++|.+|++||.+|+|+||||+++|+|++..++.
T Consensus        12 L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~   78 (84)
T d1ufma_          12 LDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA   78 (84)
T ss_dssp             CCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSC
T ss_pred             HHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCc
Confidence            4566777777788888999999999999999999999999999999999999999999999987754

PyMOL of d1ufma_

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure