Citrus Sinensis ID: 013560
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 441 | 2.2.26 [Sep-21-2011] | |||||||
| Q9R0X4 | 439 | Acyl-coenzyme A thioester | yes | no | 0.696 | 0.699 | 0.340 | 9e-44 | |
| Q9Y305 | 439 | Acyl-coenzyme A thioester | yes | no | 0.723 | 0.726 | 0.331 | 1e-42 | |
| Q3SWX2 | 437 | Acyl-coenzyme A thioester | yes | no | 0.718 | 0.725 | 0.338 | 8e-42 | |
| Q32MW3 | 439 | Acyl-coenzyme A thioester | yes | no | 0.696 | 0.699 | 0.331 | 4e-41 | |
| Q8WXI4 | 607 | Acyl-coenzyme A thioester | no | no | 0.603 | 0.438 | 0.246 | 6e-08 | |
| O00154 | 380 | Cytosolic acyl coenzyme A | no | no | 0.344 | 0.4 | 0.289 | 6e-08 | |
| Q91V12 | 381 | Cytosolic acyl coenzyme A | no | no | 0.342 | 0.396 | 0.294 | 1e-07 | |
| Q64559 | 381 | Cytosolic acyl coenzyme A | no | no | 0.342 | 0.396 | 0.294 | 2e-07 | |
| P0A0Q7 | 174 | Protein VdlD OS=Helicobac | yes | no | 0.276 | 0.701 | 0.292 | 3e-07 | |
| P0A0Q8 | 174 | Protein VdlD OS=Helicobac | yes | no | 0.276 | 0.701 | 0.292 | 3e-07 |
| >sp|Q9R0X4|ACOT9_MOUSE Acyl-coenzyme A thioesterase 9, mitochondrial OS=Mus musculus GN=Acot9 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 178 bits (451), Expect = 9e-44, Method: Compositional matrix adjust.
Identities = 112/329 (34%), Positives = 174/329 (52%), Gaps = 22/329 (6%)
Query: 86 SRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDLDALAGTISVKHCSDDDSMTRPLLLV 145
S +L TD LR++Y N VR G++LEDLD+L + H + + PL +V
Sbjct: 85 SYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTKMSPLSIV 144
Query: 146 TASVDKIAL-KKSISVDIDLKIVGAVIWVGRSSIEIQLEVIQSTKEVSDTSDSVVLTANF 204
T VDKI + K S+S + D+K G V WVG +S+E+++++ Q +D VL A F
Sbjct: 145 TVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTSMEVKMKMFQLH---NDEKYWPVLDATF 201
Query: 205 IFVARDSKTGKAAPVNRLSPQTEREKSLFEEAE---------ARSKLRKRKTGGDRRELD 255
+ VARDS+ A VN L P+ + E+ LF++ E + S L K + R +
Sbjct: 202 VMVARDSENKGPAFVNPLIPENKEEEELFKQGELNKSRRIAFSTSSLLKVAPSSEERNI- 260
Query: 256 NGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQQRNIHGRIFGGFLML 315
++ L + + I + ++ + DT+L++ IC PQ+RN+ RIFGGFLM
Sbjct: 261 ---IHELFLTTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMR 317
Query: 316 RAFELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTELENPDQPLINIE 375
+A+ELA++TA +F G P + VD + F +PV+VG L S V +T+ I +
Sbjct: 318 KAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQ-----DNYIQVR 372
Query: 376 VVAHVTRPEFRSSEVSNTFYFTFTVSKAV 404
V + V+ + R +N F+FTF K V
Sbjct: 373 VHSEVSSLDSREHMTTNVFHFTFMSEKEV 401
|
Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs. Mus musculus (taxid: 10090) EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: - |
| >sp|Q9Y305|ACOT9_HUMAN Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens GN=ACOT9 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q3SWX2|ACOT9_BOVIN Acyl-coenzyme A thioesterase 9, mitochondrial OS=Bos taurus GN=ACOT9 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q32MW3|ACO10_MOUSE Acyl-coenzyme A thioesterase 10, mitochondrial OS=Mus musculus GN=Acot10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8WXI4|ACO11_HUMAN Acyl-coenzyme A thioesterase 11 OS=Homo sapiens GN=ACOT11 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O00154|BACH_HUMAN Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens GN=ACOT7 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q91V12|BACH_MOUSE Cytosolic acyl coenzyme A thioester hydrolase OS=Mus musculus GN=Acot7 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q64559|BACH_RAT Cytosolic acyl coenzyme A thioester hydrolase OS=Rattus norvegicus GN=Acot7 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|P0A0Q7|VDLD_HELPY Protein VdlD OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0A0Q8|VDLD_HELPJ Protein VdlD OS=Helicobacter pylori (strain J99) GN=vdlD PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 441 | ||||||
| 255583385 | 452 | acyl-CoA thioesterase, putative [Ricinus | 1.0 | 0.975 | 0.850 | 0.0 | |
| 224131994 | 443 | predicted protein [Populus trichocarpa] | 0.997 | 0.993 | 0.815 | 0.0 | |
| 224065314 | 446 | predicted protein [Populus trichocarpa] | 1.0 | 0.988 | 0.816 | 0.0 | |
| 145334781 | 437 | thioesterase family protein [Arabidopsis | 0.961 | 0.970 | 0.8 | 0.0 | |
| 15238956 | 438 | thioesterase family protein [Arabidopsis | 0.961 | 0.968 | 0.800 | 0.0 | |
| 356568541 | 454 | PREDICTED: LOW QUALITY PROTEIN: acyl-coe | 0.965 | 0.938 | 0.795 | 0.0 | |
| 356531846 | 448 | PREDICTED: acyl-coenzyme A thioesterase | 0.954 | 0.939 | 0.793 | 0.0 | |
| 225469156 | 444 | PREDICTED: acyl-coenzyme A thioesterase | 0.986 | 0.979 | 0.798 | 0.0 | |
| 297795489 | 429 | thioesterase family protein [Arabidopsis | 0.961 | 0.988 | 0.795 | 0.0 | |
| 359497081 | 443 | PREDICTED: acyl-coenzyme A thioesterase | 0.986 | 0.981 | 0.768 | 0.0 |
| >gi|255583385|ref|XP_002532453.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223527843|gb|EEF29939.1| acyl-CoA thioesterase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 765 bits (1976), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 381/448 (85%), Positives = 404/448 (90%), Gaps = 7/448 (1%)
Query: 1 MEFNSSSPRTIPVVSTFASPF--GSSSPAL--NEDPKTNRKPISLWPGMYHSPVTNALWE 56
MEFNSSSP+TIPVVSTFA+PF +SSP L N++ RKPI+LWPGMYHSPVTNALWE
Sbjct: 1 MEFNSSSPKTIPVVSTFANPFDNNNSSPLLQVNDNSHQTRKPIALWPGMYHSPVTNALWE 60
Query: 57 ARSKIFERLLDPPKDAPPQSELLTKTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKL 116
ARSKIFERLLDPPKDAPPQSELLTKT QSRTSILYNFS+D ILREQYRDPWNEVRIGKL
Sbjct: 61 ARSKIFERLLDPPKDAPPQSELLTKTPKQSRTSILYNFSSDYILREQYRDPWNEVRIGKL 120
Query: 117 LEDLDALAGTISVKHCSDDDSMTRPLLLVTASVDKIALKKSISVDIDLKIVGAVIWVGRS 176
LEDLDALAGTISVKHCSDDDS TRPLLLVTASVDKI LKK ISVDIDLKIVG+VIWVGRS
Sbjct: 121 LEDLDALAGTISVKHCSDDDSTTRPLLLVTASVDKIVLKKPISVDIDLKIVGSVIWVGRS 180
Query: 177 SIEIQLEVIQSTKEVSDTSDSVVLTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEA 236
SIEIQL+VIQ T+E SD DSV LTANFIFVARDSKTGKAAPVNRLSP+TE EK LFEEA
Sbjct: 181 SIEIQLDVIQFTEEGSDAPDSVALTANFIFVARDSKTGKAAPVNRLSPETEEEKLLFEEA 240
Query: 237 EARSKLRKRKTGGDRRELDNGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALI 296
EARSKLRKRK +R+E + GEVNRLEALLAEGR+ CDMPALADRNSILLRDTRLEN+LI
Sbjct: 241 EARSKLRKRKRVDERKESETGEVNRLEALLAEGRIFCDMPALADRNSILLRDTRLENSLI 300
Query: 297 CQPQQRNIHGRIFGGFLMLRAFELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFK 356
CQPQQRNIHGRIFGGFLM RAFELAFSTAYAFAGL+P FLEVDHVDFLRPVDVGDFLR K
Sbjct: 301 CQPQQRNIHGRIFGGFLMHRAFELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLK 360
Query: 357 SCVLYTELENPDQPLINIEVVAHVTRPEFRSSEVSNTFYFTFTV---SKAVTNGFRIRNV 413
SCVLYTELENP+QPLINIEVVAHVTRPE RSSEVSNTFYFTFTV +KA+ NGFRIRNV
Sbjct: 361 SCVLYTELENPEQPLINIEVVAHVTRPELRSSEVSNTFYFTFTVRSEAKAMKNGFRIRNV 420
Query: 414 VPGTQEEARHILERMDAKALQLSKGVSK 441
VP T+EEAR ILER+DA+ LQ SK K
Sbjct: 421 VPATEEEARRILERIDAETLQSSKTFPK 448
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224131994|ref|XP_002321229.1| predicted protein [Populus trichocarpa] gi|222862002|gb|EEE99544.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224065314|ref|XP_002301770.1| predicted protein [Populus trichocarpa] gi|222843496|gb|EEE81043.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|145334781|ref|NP_001078736.1| thioesterase family protein [Arabidopsis thaliana] gi|332008277|gb|AED95660.1| thioesterase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15238956|ref|NP_199648.1| thioesterase family protein [Arabidopsis thaliana] gi|8978341|dbj|BAA98194.1| unnamed protein product [Arabidopsis thaliana] gi|53749132|gb|AAU90051.1| At5g48370 [Arabidopsis thaliana] gi|55733743|gb|AAV59268.1| At5g48370 [Arabidopsis thaliana] gi|110742181|dbj|BAE99018.1| hypothetical protein [Arabidopsis thaliana] gi|332008276|gb|AED95659.1| thioesterase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356568541|ref|XP_003552469.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A thioesterase 9, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531846|ref|XP_003534487.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225469156|ref|XP_002274516.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297795489|ref|XP_002865629.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata] gi|297311464|gb|EFH41888.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359497081|ref|XP_002264355.2| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 441 | ||||||
| TAIR|locus:2156258 | 438 | AT5G48370 [Arabidopsis thalian | 0.961 | 0.968 | 0.800 | 2.1e-178 | |
| TAIR|locus:2054487 | 455 | AT2G30720 [Arabidopsis thalian | 0.886 | 0.859 | 0.663 | 1.1e-135 | |
| DICTYBASE|DDB_G0286507 | 632 | DDB_G0286507 "putative acyl-Co | 0.736 | 0.514 | 0.373 | 1.9e-51 | |
| DICTYBASE|DDB_G0292458 | 588 | DDB_G0292458 [Dictyostelium di | 0.866 | 0.649 | 0.317 | 7.4e-50 | |
| ZFIN|ZDB-GENE-051113-136 | 425 | acot9.2 "acyl-CoA thioesterase | 0.723 | 0.750 | 0.343 | 2.2e-43 | |
| MGI|MGI:1928939 | 439 | Acot9 "acyl-CoA thioesterase 9 | 0.775 | 0.779 | 0.336 | 1.2e-42 | |
| UNIPROTKB|Q9Y305 | 439 | ACOT9 "Acyl-coenzyme A thioest | 0.734 | 0.738 | 0.339 | 3.6e-41 | |
| MGI|MGI:1928940 | 439 | Acot10 "acyl-CoA thioesterase | 0.730 | 0.733 | 0.333 | 6.8e-40 | |
| UNIPROTKB|Q3SWX2 | 437 | ACOT9 "Acyl-coenzyme A thioest | 0.718 | 0.725 | 0.341 | 8.7e-40 | |
| CGD|CAL0003675 | 507 | orf19.5293 [Candida albicans ( | 0.643 | 0.560 | 0.333 | 6.5e-39 |
| TAIR|locus:2156258 AT5G48370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1732 (614.8 bits), Expect = 2.1e-178, P = 2.1e-178
Identities = 349/436 (80%), Positives = 377/436 (86%)
Query: 6 SSPRTIPVVSTFASPFGSSSPALNEDPKTNRKPISLWPGMYHSPVTNALWEARSKIFERL 65
+SPR I VVSTFASP +S P RKP+SLWPGMYHSPVT ALWEARSKIFE L
Sbjct: 2 NSPRPISVVSTFASPSSTSDPT--------RKPLSLWPGMYHSPVTTALWEARSKIFESL 53
Query: 66 LDPPKDAPPQSELLTKTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDLDALAG 125
LDPPKDAPPQS+LLT+T S SRT+I Y FSTD ILREQYRDPWNEVRIG LLEDLDALAG
Sbjct: 54 LDPPKDAPPQSQLLTRTPSHSRTTIFYPFSTDFILREQYRDPWNEVRIGILLEDLDALAG 113
Query: 126 TISVKHCSDDDSMTRPLLLVTASVDKIALKKSISVDIDLKIVGAVIWVGRSSIEIQLEVI 185
TISVKHCSDDDS TRPLLLVTASV KI LKK I VDIDLKIV +VIWVGRSSIEIQLEV+
Sbjct: 114 TISVKHCSDDDSTTRPLLLVTASVHKIVLKKPICVDIDLKIVASVIWVGRSSIEIQLEVM 173
Query: 186 QST-KEVSDTSDSVVLTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEAEARSKLRK 244
QS K+V +SDSV LTANFIFVARDSKTGKAAP+NRLSP+TE EK LFEEAEAR+ LRK
Sbjct: 174 QSELKDVKASSDSVALTANFIFVARDSKTGKAAPINRLSPETEVEKLLFEEAEARNNLRK 233
Query: 245 RKTGGDRRELDNGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQQRNI 304
+K GGDRRE D+GE +LEA LAEGR+ DMPALADRNSILL+DTRLEN+LICQPQQRNI
Sbjct: 234 KKRGGDRREFDHGECKKLEAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNI 293
Query: 305 HGRIFGGFLMLRAFELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTEL 364
HGRIFGGFLM RAFELAFSTAY FAGL+P FLEVDHVDFLRPVDVGDFLRFKSCVLYT+L
Sbjct: 294 HGRIFGGFLMHRAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQL 353
Query: 365 ENPDQPLINIEVVAHVTRPEFRSSEVSNTFYFTFTV---SKAVTNGFRIRNVVPGTQEEA 421
+ D PLINIEVVAHVT PE RSSEVSNTFYF FTV +KA NGF++RNVVP T+EEA
Sbjct: 354 DKQDCPLINIEVVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEA 413
Query: 422 RHILERMDAKALQLSK 437
RHILERMDA+AL+ SK
Sbjct: 414 RHILERMDAEALKSSK 429
|
|
| TAIR|locus:2054487 AT2G30720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286507 DDB_G0286507 "putative acyl-CoA thioester hydrolase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292458 DDB_G0292458 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051113-136 acot9.2 "acyl-CoA thioesterase 9.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1928939 Acot9 "acyl-CoA thioesterase 9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y305 ACOT9 "Acyl-coenzyme A thioesterase 9, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1928940 Acot10 "acyl-CoA thioesterase 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SWX2 ACOT9 "Acyl-coenzyme A thioesterase 9, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003675 orf19.5293 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.2 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | fgenesh4_pg.C_LG_XIV001138 | acyl-CoA thioesterase (EC-3.1.2.2) (443 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 441 | |||
| PLN02647 | 437 | PLN02647, PLN02647, acyl-CoA thioesterase | 0.0 | |
| cd03442 | 123 | cd03442, BFIT_BACH, Brown fat-inducible thioestera | 1e-28 | |
| cd03442 | 123 | cd03442, BFIT_BACH, Brown fat-inducible thioestera | 1e-26 | |
| COG1607 | 157 | COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabo | 2e-17 | |
| COG1607 | 157 | COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabo | 2e-08 | |
| cd03440 | 100 | cd03440, hot_dog, The hotdog fold was initially id | 1e-04 | |
| pfam03061 | 79 | pfam03061, 4HBT, Thioesterase superfamily | 1e-04 | |
| cd03440 | 100 | cd03440, hot_dog, The hotdog fold was initially id | 0.004 |
| >gnl|CDD|215349 PLN02647, PLN02647, acyl-CoA thioesterase | Back alignment and domain information |
|---|
Score = 840 bits (2173), Expect = 0.0
Identities = 361/437 (82%), Positives = 385/437 (88%), Gaps = 2/437 (0%)
Query: 1 MEFNSSSPRTIPVVSTFASPFGSSSPALNEDPKTNRKPISLWPGMYHSPVTNALWEARSK 60
EF S+SPR IPVVSTFASP S + + RKP+SLWPGMYHSPVTNALWEARS
Sbjct: 1 PEFASNSPRPIPVVSTFASPSLSPGNGSIDAGSSTRKPLSLWPGMYHSPVTNALWEARSS 60
Query: 61 IFERLLDPPKDAPPQSELLTKTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDL 120
IFERLLDPPKDAPPQSELLTKT SQSRTSILY FS+D ILREQYR+PWNEVRIGKLLEDL
Sbjct: 61 IFERLLDPPKDAPPQSELLTKTPSQSRTSILYKFSSDFILREQYRNPWNEVRIGKLLEDL 120
Query: 121 DALAGTISVKHCSDDDSMTRPLLLVTASVDKIALKKSISVDIDLKIVGAVIWVGRSSIEI 180
DALAGTISVKHCSDDDS TRPLLLVTASVDKI LKK I VD+DLKIVGAV WVGRSS+EI
Sbjct: 121 DALAGTISVKHCSDDDSTTRPLLLVTASVDKIVLKKPIRVDVDLKIVGAVTWVGRSSMEI 180
Query: 181 QLEVIQSTKEVSDTSDSVVLTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEAEARS 240
QLEVIQ TK+ S+TSDSV LTANF FVARDSKTGK+APVNRLSP+TE EK LFEEAEAR+
Sbjct: 181 QLEVIQPTKDESNTSDSVALTANFTFVARDSKTGKSAPVNRLSPETEEEKLLFEEAEARN 240
Query: 241 KLRKRKTGGDRRELDNGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQ 300
KLRK+K G +RE +NGE RLEALLAEGRV CDMPALADRNSIL+RDTRLEN+LICQPQ
Sbjct: 241 KLRKKKRGEQKREFENGEAERLEALLAEGRVFCDMPALADRNSILIRDTRLENSLICQPQ 300
Query: 301 QRNIHGRIFGGFLMLRAFELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVL 360
QRNIHGRIFGGFLM RAFELAFSTAYAFAGL P FLEVDHVDFLRPVDVGDFLRFKSCVL
Sbjct: 301 QRNIHGRIFGGFLMRRAFELAFSTAYAFAGLRPYFLEVDHVDFLRPVDVGDFLRFKSCVL 360
Query: 361 YTELENPDQPLINIEVVAHVTRPEFRSSEVSNTFYFTFTV--SKAVTNGFRIRNVVPGTQ 418
YTELEN +QPLIN+EVVAHVTRPE RSSEVSNTFYFTFTV A+ NGF+IRNVVP T+
Sbjct: 361 YTELENSEQPLINVEVVAHVTRPELRSSEVSNTFYFTFTVRPEAAMKNGFKIRNVVPATE 420
Query: 419 EEARHILERMDAKALQL 435
EEAR ILERMDA+ L
Sbjct: 421 EEARRILERMDAEHLVS 437
|
Length = 437 |
| >gnl|CDD|239526 cd03442, BFIT_BACH, Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >gnl|CDD|239526 cd03442, BFIT_BACH, Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >gnl|CDD|224523 COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224523 COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >gnl|CDD|217345 pfam03061, 4HBT, Thioesterase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 441 | |||
| PLN02647 | 437 | acyl-CoA thioesterase | 100.0 | |
| KOG2763 | 357 | consensus Acyl-CoA thioesterase [Lipid transport a | 100.0 | |
| COG1607 | 157 | Acyl-CoA hydrolase [Lipid metabolism] | 100.0 | |
| COG1607 | 157 | Acyl-CoA hydrolase [Lipid metabolism] | 100.0 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 99.96 | |
| PRK10694 | 133 | acyl-CoA esterase; Provisional | 99.96 | |
| PRK10694 | 133 | acyl-CoA esterase; Provisional | 99.92 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 99.73 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 99.72 | |
| KOG2763 | 357 | consensus Acyl-CoA thioesterase [Lipid transport a | 99.71 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 99.47 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 99.45 | |
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 99.42 | |
| PRK10254 | 137 | thioesterase; Provisional | 99.39 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 99.38 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 99.37 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 99.35 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 99.35 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 99.34 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 99.31 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 99.29 | |
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 99.27 | |
| PRK10254 | 137 | thioesterase; Provisional | 99.27 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 99.27 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 99.26 | |
| TIGR00051 | 117 | acyl-CoA thioester hydrolase, YbgC/YbaW family. Th | 99.25 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 99.24 | |
| PF13279 | 121 | 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E | 99.19 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 99.17 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 99.12 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 99.07 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 99.07 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 99.03 | |
| KOG3328 | 148 | consensus HGG motif-containing thioesterase [Gener | 99.03 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 99.02 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 98.92 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 98.91 | |
| TIGR02447 | 138 | yiiD_Cterm thioesterase domain, putative. This fam | 98.87 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 98.7 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 98.54 | |
| PLN02370 | 419 | acyl-ACP thioesterase | 98.53 | |
| TIGR02447 | 138 | yiiD_Cterm thioesterase domain, putative. This fam | 98.52 | |
| KOG3328 | 148 | consensus HGG motif-containing thioesterase [Gener | 98.52 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 98.45 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 98.44 | |
| PF01643 | 261 | Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 | 98.4 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 98.36 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 98.3 | |
| PF13279 | 121 | 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E | 98.22 | |
| PF14539 | 132 | DUF4442: Domain of unknown function (DUF4442); PDB | 98.22 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 98.2 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 98.13 | |
| TIGR00051 | 117 | acyl-CoA thioester hydrolase, YbgC/YbaW family. Th | 98.06 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 98.06 | |
| TIGR00189 | 271 | tesB acyl-CoA thioesterase II. Subunit: homotetram | 97.84 | |
| PRK00006 | 147 | fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review | 97.81 | |
| PF09500 | 144 | YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In | 97.81 | |
| PF14539 | 132 | DUF4442: Domain of unknown function (DUF4442); PDB | 97.77 | |
| cd01288 | 131 | FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier | 97.71 | |
| PRK10526 | 286 | acyl-CoA thioesterase II; Provisional | 97.62 | |
| KOG4781 | 237 | consensus Uncharacterized conserved protein [Funct | 97.54 | |
| cd03445 | 94 | Thioesterase_II_repeat2 Thioesterase II (TEII) is | 97.42 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 97.38 | |
| PRK00006 | 147 | fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review | 97.38 | |
| cd03445 | 94 | Thioesterase_II_repeat2 Thioesterase II (TEII) is | 97.32 | |
| cd01288 | 131 | FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier | 97.25 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 97.21 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 97.16 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 96.9 | |
| TIGR01750 | 140 | fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd | 96.86 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 96.82 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 96.72 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 96.69 | |
| PLN02864 | 310 | enoyl-CoA hydratase | 96.61 | |
| KOG4781 | 237 | consensus Uncharacterized conserved protein [Funct | 96.49 | |
| cd00493 | 131 | FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr | 96.42 | |
| PF09500 | 144 | YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In | 96.4 | |
| PF07977 | 138 | FabA: FabA-like domain; InterPro: IPR013114 Fatty | 96.3 | |
| TIGR01750 | 140 | fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd | 96.22 | |
| TIGR00189 | 271 | tesB acyl-CoA thioesterase II. Subunit: homotetram | 96.1 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 96.01 | |
| cd00493 | 131 | FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr | 95.88 | |
| COG1946 | 289 | TesB Acyl-CoA thioesterase [Lipid metabolism] | 95.83 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 95.83 | |
| cd03450 | 149 | NodN NodN (nodulation factor N) contains a single | 95.66 | |
| cd03441 | 127 | R_hydratase_like (R)-hydratase [(R)-specific enoyl | 95.64 | |
| cd03446 | 140 | MaoC_like MoaC_like Similar to the MaoC (monoamine | 95.64 | |
| cd03447 | 126 | FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t | 95.61 | |
| PRK13188 | 464 | bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl | 95.51 | |
| PF01575 | 122 | MaoC_dehydratas: MaoC like domain; InterPro: IPR00 | 95.48 | |
| cd03455 | 123 | SAV4209 SAV4209 is a Streptomyces avermitilis prot | 95.42 | |
| cd01287 | 150 | FabA FabA, beta-hydroxydecanoyl-acyl carrier prote | 95.42 | |
| KOG3016 | 294 | consensus Acyl-CoA thioesterase [Lipid transport a | 95.39 | |
| cd01289 | 138 | FabA_like Domain of unknown function, appears to b | 94.94 | |
| cd01289 | 138 | FabA_like Domain of unknown function, appears to b | 94.75 | |
| cd03452 | 142 | MaoC_C MaoC_C The C-terminal hot dog fold of the M | 94.71 | |
| PRK10526 | 286 | acyl-CoA thioesterase II; Provisional | 94.67 | |
| PRK13188 | 464 | bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl | 94.42 | |
| cd03446 | 140 | MaoC_like MoaC_like Similar to the MaoC (monoamine | 94.25 | |
| cd03454 | 140 | YdeM YdeM is a Bacillus subtilis protein that belo | 93.89 | |
| PF07977 | 138 | FabA: FabA-like domain; InterPro: IPR013114 Fatty | 93.8 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 93.71 | |
| COG0764 | 147 | FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca | 93.65 | |
| cd03441 | 127 | R_hydratase_like (R)-hydratase [(R)-specific enoyl | 93.6 | |
| cd03453 | 127 | SAV4209_like SAV4209_like. Similar in sequence to | 93.59 | |
| cd03455 | 123 | SAV4209 SAV4209 is a Streptomyces avermitilis prot | 93.32 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 92.75 | |
| COG2030 | 159 | MaoC Acyl dehydratase [Lipid metabolism] | 92.68 | |
| COG3884 | 250 | FatA Acyl-ACP thioesterase [Lipid metabolism] | 92.56 | |
| PF01643 | 261 | Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 | 92.46 | |
| COG0764 | 147 | FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca | 92.4 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 92.08 | |
| PRK13691 | 166 | (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro | 91.68 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 91.15 | |
| PRK08190 | 466 | bifunctional enoyl-CoA hydratase/phosphate acetylt | 90.41 | |
| cd03454 | 140 | YdeM YdeM is a Bacillus subtilis protein that belo | 90.26 | |
| PLN02370 | 419 | acyl-ACP thioesterase | 90.03 | |
| PRK13691 | 166 | (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro | 89.92 | |
| cd03447 | 126 | FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t | 89.68 | |
| cd03452 | 142 | MaoC_C MaoC_C The C-terminal hot dog fold of the M | 89.4 | |
| KOG3016 | 294 | consensus Acyl-CoA thioesterase [Lipid transport a | 89.22 | |
| COG5496 | 130 | Predicted thioesterase [General function predictio | 88.96 | |
| PF03756 | 132 | AfsA: A-factor biosynthesis hotdog domain; InterPr | 88.62 | |
| cd03453 | 127 | SAV4209_like SAV4209_like. Similar in sequence to | 88.4 | |
| cd03448 | 122 | HDE_HSD HDE_HSD The R-hydratase-like hot dog fold | 88.18 | |
| PF01575 | 122 | MaoC_dehydratas: MaoC like domain; InterPro: IPR00 | 88.0 | |
| cd03450 | 149 | NodN NodN (nodulation factor N) contains a single | 87.6 | |
| TIGR01749 | 169 | fabA beta-hydroxyacyl-[acyl carrier protein] dehyd | 86.44 | |
| PF13452 | 132 | MaoC_dehydrat_N: N-terminal half of MaoC dehydrata | 86.41 | |
| PRK05174 | 172 | 3-hydroxydecanoyl-(acyl carrier protein) dehydrata | 85.4 | |
| PRK13693 | 142 | (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro | 85.35 | |
| PRK11563 | 675 | bifunctional aldehyde dehydrogenase/enoyl-CoA hydr | 84.77 | |
| TIGR02278 | 663 | PaaN-DH phenylacetic acid degradation protein paaN | 84.13 | |
| COG1946 | 289 | TesB Acyl-CoA thioesterase [Lipid metabolism] | 83.95 | |
| cd01287 | 150 | FabA FabA, beta-hydroxydecanoyl-acyl carrier prote | 82.4 | |
| PRK08190 | 466 | bifunctional enoyl-CoA hydratase/phosphate acetylt | 81.6 | |
| COG3884 | 250 | FatA Acyl-ACP thioesterase [Lipid metabolism] | 80.63 |
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.2e-106 Score=826.63 Aligned_cols=434 Identities=83% Similarity=1.228 Sum_probs=412.7
Q ss_pred CCCCCCCCcccccccccCCCCCCCCCCCCCCCcccccccccCCcccccchhhHHHHHhhHhhhhcCCCCCCCCCCCcCCC
Q 013560 1 MEFNSSSPRTIPVVSTFASPFGSSSPALNEDPKTNRKPISLWPGMYHSPVTNALWEARSKIFERLLDPPKDAPPQSELLT 80 (441)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lw~~r~~~~~~~~~~~~~~~~~~~l~~ 80 (441)
+++++++++|||++|++++|.+.......|....+|||++|||||||||||++||++|++++|+..+++.++++|.+|+.
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~ 80 (437)
T PLN02647 1 PEFASNSPRPIPVVSTFASPSLSPGNGSIDAGSSTRKPLSLWPGMYHSPVTNALWEARSSIFERLLDPPKDAPPQSELLT 80 (437)
T ss_pred CCCCCCCCCcceeeecccCcccCCCCcccCCCccccCccccCCccccChHHHHHHHHHHHHhhhccCcccccCccccccc
Confidence 47899999999999999999888777778888889999999999999999999999999999998888889999999999
Q ss_pred cCCCCCeeEEEEcccCCcccCccccCCCCcccHhHHHHHHHHHHHHHHHHhcCCCCCCCCCceEEEEEEeeEEEccCCCC
Q 013560 81 KTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDLDALAGTISVKHCSDDDSMTRPLLLVTASVDKIALKKSISV 160 (441)
Q Consensus 81 r~~~dS~~~~~~p~~sd~~lr~~~~N~~G~v~gG~lLe~lD~~A~~~a~rh~~~~~~~~~p~~~VTasvD~i~F~~Pi~~ 160 (441)
|+|++|++++.+||++|..|+++|+|++|+||||+||+|||.+|+++|++||+.+++.+.|+.+|||+||+|+|++|+++
T Consensus 81 k~~~~S~~~~~~~~~~d~~l~~~y~N~~G~l~gG~LLe~mD~~A~~~A~rh~~~~~~~~~p~~vVTAsVD~i~F~~Pi~~ 160 (437)
T PLN02647 81 KTPSQSRTSILYKFSSDFILREQYRNPWNEVRIGKLLEDLDALAGTISVKHCSDDDSTTRPLLLVTASVDKIVLKKPIRV 160 (437)
T ss_pred cccccceEEEEEecCCchhhchhhcCCCCcEeHhHHHHHHHHHHHHHHHHHhCCCcccCCcceEEEEEECcEEEcCCCcC
Confidence 99999999999999999999999999999999999999999999999999999867788888999999999999999999
Q ss_pred CCEEEEEEEEEEEcccEEEEEEEEEEccccccCCCceEEEEEEEEEEEeeCCCCceeeccccCCCCHHHHHHHHHHHHHH
Q 013560 161 DIDLKIVGAVIWVGRSSIEIQLEVIQSTKEVSDTSDSVVLTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEAEARS 240 (441)
Q Consensus 161 gd~l~i~~~V~~vGrSSmeV~v~v~~~~~~~~~~~~~~v~~a~ft~Va~D~~~~kp~pVp~l~p~t~~E~~l~~~a~~r~ 240 (441)
|++|++.|+|+|+|+|||||.++|++++.+..++...++++|+|||||+|+++|||+|||+|+|+|++|+++|++|++|+
T Consensus 161 g~~v~l~g~Vt~vGrSSMEV~v~V~~~~~~~~~~~~~~~~~a~FtfVA~D~~~gkp~pVp~l~pete~Ek~~~e~a~~R~ 240 (437)
T PLN02647 161 DVDLKIVGAVTWVGRSSMEIQLEVIQPTKDESNTSDSVALTANFTFVARDSKTGKSAPVNRLSPETEEEKLLFEEAEARN 240 (437)
T ss_pred CcEEEEEEEEEEecCCeEEEEEEEEEccccCCCCcEEEEEEEEEEEEEEcCCCCCeeeCCCCCCCCHHHHHHHHHHHHHH
Confidence 99999999999999999999999999864334567789999999999999878999999999999999999999999999
Q ss_pred HHHHHHhcCCCCCCCchhHHHHHHHHHhcccccCCCCcccCCceeecCCeEEEEEEeCCCCCCCCCCCcHHHHHHHHHHH
Q 013560 241 KLRKRKTGGDRRELDNGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQQRNIHGRIFGGFLMLRAFEL 320 (441)
Q Consensus 241 ~~R~~~~~~~~~~~~~~e~~~l~~l~~~~~~~~~~p~~~~~~~v~~~dt~~~~~~~v~P~~~N~~G~vfGG~lm~~ade~ 320 (441)
++|+++|.+....++++|.++||+||.+++.++++|.++|+|++||++|++++.++|+|+|+|.||+||||+||+||||+
T Consensus 241 ~~Rk~~r~~~~~~~~~~e~~~l~~l~~~~~~~~~~p~l~~~~~v~m~dT~~~~~~iv~P~d~N~~g~iFGG~LM~~~De~ 320 (437)
T PLN02647 241 KLRKKKRGEQKREFENGEAERLEALLAEGRVFCDMPALADRNSILIRDTRLENSLICQPQQRNIHGRIFGGFLMRRAFEL 320 (437)
T ss_pred HHHHHHHHhhcccCCchHHHHHHHHHHhccccccCcccCCccceeccccceEEEEEeCccccCCCCcEeHHHHHHHHHHH
Confidence 99988887776666677899999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhcCCCcEEEEEceEEEcCccCcCcEEEEEEEEeeeeccCCCCCeEEEEEEEEEeeCCCcceeEEEEEEEEEEE
Q 013560 321 AFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTELENPDQPLINIEVVAHVTRPEFRSSEVSNTFYFTFTV 400 (441)
Q Consensus 321 A~~~A~~~~~~~~vt~~vd~i~F~~Pv~vGd~l~~~a~Vv~tg~~~~~~~~~~VeV~~~v~~~~~~~~~~~n~~~fTfv~ 400 (441)
||++|++|+++++||+++|+|+|++||++||+|+++|+|+|+|.+++++++|+|+|.|++.++++++++++|+|||||++
T Consensus 321 A~i~A~r~a~~~~vt~svd~v~F~~PV~vGdil~l~A~V~yt~~~s~g~~~i~veV~v~v~~~~~~~~~~~n~~~fTfva 400 (437)
T PLN02647 321 AFSTAYAFAGLRPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTELENSEQPLINVEVVAHVTRPELRSSEVSNTFYFTFTV 400 (437)
T ss_pred HHHHHHHHcCCceEEEEecceEecCccccCcEEEEEEEEEEEeEEecCceEEEEEEEEEEEcCCCCcceEEEEEEEEEEE
Confidence 99999999999999999999999999999999999999999999989999999999999999999998999999999999
Q ss_pred ecc--CCCCccCCccccCCHHHHHHHHHHHHHHHHh
Q 013560 401 SKA--VTNGFRIRNVVPGTQEEARHILERMDAKALQ 434 (441)
Q Consensus 401 ~d~--~~~~~~v~~v~P~t~~E~~~~~~a~~r~~~~ 434 (441)
.|+ +|+|.+||+|+|+||+|+++|+++.+|+.+.
T Consensus 401 ~d~~~~g~p~~Vp~V~P~T~eE~~~~~e~~~~~~~~ 436 (437)
T PLN02647 401 RPEAAMKNGFKIRNVVPATEEEARRILERMDAEHLV 436 (437)
T ss_pred eccccCCCCccCCeeecCCHHHHHHHHHhcCccccc
Confidence 987 7899999999999999999999999998764
|
|
| >KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1607 Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1607 Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PRK10694 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10694 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >TIGR02447 yiiD_Cterm thioesterase domain, putative | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >PLN02370 acyl-ACP thioesterase | Back alignment and domain information |
|---|
| >TIGR02447 yiiD_Cterm thioesterase domain, putative | Back alignment and domain information |
|---|
| >KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A | Back alignment and domain information |
|---|
| >PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00189 tesB acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein | Back alignment and domain information |
|---|
| >PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B | Back alignment and domain information |
|---|
| >cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway | Back alignment and domain information |
|---|
| >PRK10526 acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >KOG4781 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >PLN02864 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >KOG4781 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation | Back alignment and domain information |
|---|
| >PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein | Back alignment and domain information |
|---|
| >PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] | Back alignment and domain information |
|---|
| >TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ | Back alignment and domain information |
|---|
| >TIGR00189 tesB acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation | Back alignment and domain information |
|---|
| >COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain | Back alignment and domain information |
|---|
| >cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
| >PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes | Back alignment and domain information |
|---|
| >cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site | Back alignment and domain information |
|---|
| >KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) | Back alignment and domain information |
|---|
| >cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) | Back alignment and domain information |
|---|
| >cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein | Back alignment and domain information |
|---|
| >PRK10526 acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain | Back alignment and domain information |
|---|
| >cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function | Back alignment and domain information |
|---|
| >PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >cd03453 SAV4209_like SAV4209_like | Back alignment and domain information |
|---|
| >cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >COG2030 MaoC Acyl dehydratase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] | Back alignment and domain information |
|---|
| >COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function | Back alignment and domain information |
|---|
| >PLN02370 acyl-ACP thioesterase | Back alignment and domain information |
|---|
| >PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional | Back alignment and domain information |
|---|
| >cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
| >cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein | Back alignment and domain information |
|---|
| >KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5496 Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03756 AfsA: A-factor biosynthesis hotdog domain; InterPro: IPR005509 The AfsA family are key enzymes in A-factor biosynthesis, which is essential for streptomycin production and resistance | Back alignment and domain information |
|---|
| >cd03453 SAV4209_like SAV4209_like | Back alignment and domain information |
|---|
| >cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins | Back alignment and domain information |
|---|
| >PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes | Back alignment and domain information |
|---|
| >cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA | Back alignment and domain information |
|---|
| >PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A | Back alignment and domain information |
|---|
| >PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional | Back alignment and domain information |
|---|
| >PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN | Back alignment and domain information |
|---|
| >COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site | Back alignment and domain information |
|---|
| >PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated | Back alignment and domain information |
|---|
| >COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 441 | ||||
| 3sps_A | 169 | Crystal Structure Of Apo-Hexameric Acyl-Coa Thioest | 9e-12 | ||
| 1vpm_A | 169 | Crystal Structure Of Acyl-Coa Hydrolase (Np_241664. | 6e-11 | ||
| 2qq2_A | 193 | Crystal Structure Of C-Terminal Domain Of Human Acy | 3e-09 | ||
| 2q2b_A | 179 | Crystal Structure Of The C-Terminal Domain Of Mouse | 4e-09 | ||
| 3b7k_A | 333 | Human Acyl-Coenzyme A Thioesterase 12 Length = 333 | 3e-07 | ||
| 4ien_A | 163 | Crystal Structure Of Acyl-coa Hydrolase From Neisse | 2e-06 |
| >pdb|3SPS|A Chain A, Crystal Structure Of Apo-Hexameric Acyl-Coa Thioesterase Length = 169 | Back alignment and structure |
|
| >pdb|1VPM|A Chain A, Crystal Structure Of Acyl-Coa Hydrolase (Np_241664.1) From Bacillus Halodurans At 1.66 A Resolution Length = 169 | Back alignment and structure |
| >pdb|2QQ2|A Chain A, Crystal Structure Of C-Terminal Domain Of Human Acyl-Coa Thioesterase 7 Length = 193 | Back alignment and structure |
| >pdb|2Q2B|A Chain A, Crystal Structure Of The C-Terminal Domain Of Mouse Acyl-Coa Thioesterase 7 Length = 179 | Back alignment and structure |
| >pdb|3B7K|A Chain A, Human Acyl-Coenzyme A Thioesterase 12 Length = 333 | Back alignment and structure |
| >pdb|4IEN|A Chain A, Crystal Structure Of Acyl-coa Hydrolase From Neisseria Meningitidis Fam18 Length = 163 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Length = 333 | Back alignment and structure |
|---|
Score = 265 bits (679), Expect = 4e-86
Identities = 67/358 (18%), Positives = 126/358 (35%), Gaps = 37/358 (10%)
Query: 68 PPKDAPPQSELLTKTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDLDALAGTI 127
S ++ + E+ G+LL+ +D A
Sbjct: 6 HHSSGVDLGTENLYFQSMGEVV------MSQAIQPAHATARGELSAGQLLKWIDTTACLA 59
Query: 128 SVKHCSDDDSMTRPLLLVTASVDKIALKKSISVDIDLKIVGAVIWVGRSSIEIQLEVIQS 187
+ KH + VTASVD I +++ V + I V +S+EI ++V+
Sbjct: 60 AEKHA--------GVSCVTASVDDIQFEETARVGQVITIKAKVTRAFSTSMEISIKVMV- 110
Query: 188 TKEVSDTSDSVVLTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEAEARSKLRKRKT 247
+++ + +V A FVA+ + + ++ TE++ A R K+R +
Sbjct: 111 -QDMLTGIEKLVSVAFSTFVAKPV-GKEKIHLKPVTLLTEQDHVEHNLAAERRKVRLQHE 168
Query: 248 GGDRRELDNGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQQRNIHGR 307
+ L+ E D+ + ++ R T +++ + P N HG
Sbjct: 169 ------------DTFNNLMKESSKFDDLIFDEEEGAVSTRGTSVQSIELVLPPHANHHGN 216
Query: 308 IFGGFLMLRAFELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTELENP 367
FGG +M +A +A P VD F P VGD L F + V T
Sbjct: 217 TFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNT----- 271
Query: 368 DQPLINIEVVAHVTRPEFRSS---EVSNTFYFTFTVSKAVTNGFRIRNVVPGTQEEAR 422
Q + + V + + N+ + + + N + P ++++ R
Sbjct: 272 FQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFR 329
|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Length = 333 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Length = 179 | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Length = 179 | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Length = 174 | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Length = 174 | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Length = 169 | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Length = 169 | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Length = 288 | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Length = 288 | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Length = 288 | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Length = 151 | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Length = 151 | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Length = 153 | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Length = 153 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Length = 133 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Length = 133 | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Length = 137 | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Length = 137 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 441 | |||
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 100.0 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 100.0 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 99.97 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 99.97 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 99.96 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 99.96 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.95 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.94 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 99.94 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 99.93 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 99.93 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.93 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.93 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 99.93 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 99.9 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 99.81 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 99.8 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 99.79 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 99.78 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 99.78 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 99.76 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 99.76 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 99.71 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 99.64 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 99.6 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 99.58 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 99.58 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 99.58 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 99.56 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 99.56 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 99.56 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 99.55 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 99.55 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 99.55 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 99.55 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 99.54 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 99.54 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 99.53 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 99.53 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 99.52 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 99.52 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 99.52 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 99.51 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 99.51 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 99.5 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 99.5 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 99.49 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 99.49 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 99.49 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 99.48 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 99.48 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 99.48 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 99.48 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 99.47 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 99.47 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 99.47 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 99.46 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 99.46 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 99.46 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 99.46 | |
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 99.45 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 99.45 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 99.45 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 99.45 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 99.45 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 99.45 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 99.44 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 99.44 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 99.44 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 99.44 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 99.43 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 99.43 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 99.43 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 99.43 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 99.43 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 99.43 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 99.43 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 99.42 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 99.42 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 99.41 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 99.4 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 99.4 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 99.4 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 99.4 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 99.4 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 99.39 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 99.39 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 99.39 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 99.39 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 99.37 | |
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 99.36 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 99.35 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 99.35 | |
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 99.34 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 99.34 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 99.34 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 99.34 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 99.33 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 99.33 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 99.33 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 99.32 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 99.31 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 99.31 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 99.3 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 99.3 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 99.28 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 99.27 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 99.25 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 99.25 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 99.22 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 99.17 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 99.14 | |
| 4a0z_A | 190 | Transcription factor FAPR; lipid homeostasis; HET: | 99.12 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 99.11 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 99.09 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 99.09 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 99.08 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 99.08 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 99.06 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 99.04 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 99.03 | |
| 2f3x_A | 157 | Transcription factor FAPR; 'HOT-DOG' fold / malony | 99.03 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 99.01 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 98.99 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 98.97 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 98.97 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 98.96 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 98.95 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 98.94 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 98.93 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 98.92 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 98.89 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 98.89 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 98.87 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 98.86 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 98.86 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 98.82 | |
| 3lmb_A | 165 | Uncharacterized protein; protein OLEI01261, unknow | 98.8 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 98.74 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 98.73 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 98.73 | |
| 4a0z_A | 190 | Transcription factor FAPR; lipid homeostasis; HET: | 98.7 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 98.48 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 98.45 | |
| 2f3x_A | 157 | Transcription factor FAPR; 'HOT-DOG' fold / malony | 98.38 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 98.34 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 98.28 | |
| 3lmb_A | 165 | Uncharacterized protein; protein OLEI01261, unknow | 98.19 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 98.0 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 97.96 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 97.9 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 97.88 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 97.84 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 97.83 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 97.74 | |
| 2cf2_C | 342 | Fatty acid synthase, DH domain; transferase, fatty | 97.72 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 97.7 | |
| 4e3e_A | 352 | MAOC domain protein dehydratase; structural genomi | 97.7 | |
| 4h4g_A | 160 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 97.57 | |
| 3u0a_A | 285 | Acyl-COA thioesterase II TESB2; structural genomic | 97.52 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 97.48 | |
| 3rd7_A | 286 | Acyl-COA thioesterase; seattle structur genomics c | 97.44 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 97.41 | |
| 4i83_A | 152 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; | 97.4 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 97.33 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 97.3 | |
| 1u1z_A | 168 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd | 97.28 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 97.26 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 97.22 | |
| 1u1z_A | 168 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd | 97.2 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 97.17 | |
| 1z6b_A | 154 | Pffabz, fatty acid synthesis protein; malaria, bet | 97.14 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 97.11 | |
| 1z6b_A | 154 | Pffabz, fatty acid synthesis protein; malaria, bet | 97.03 | |
| 2gll_A | 171 | FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d | 97.01 | |
| 4h4g_A | 160 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 96.86 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 96.86 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 96.85 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 96.78 | |
| 2gll_A | 171 | FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d | 96.74 | |
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 96.7 | |
| 4i83_A | 152 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; | 96.69 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 96.63 | |
| 1tbu_A | 118 | Peroxisomal acyl-coenzyme A thioester hydrolase 1; | 96.53 | |
| 1tbu_A | 118 | Peroxisomal acyl-coenzyme A thioester hydrolase 1; | 96.34 | |
| 1c8u_A | 285 | Acyl-COA thioesterase II; internal repeats, hydrol | 96.34 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 96.3 | |
| 2c2i_A | 151 | RV0130; hotdog, hydratase, lyase, structural prote | 96.3 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 96.29 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 96.19 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 96.18 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 96.17 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 96.1 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 96.1 | |
| 3esi_A | 129 | Uncharacterized protein; protein from erwinia caro | 95.83 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 95.8 | |
| 4e3e_A | 352 | MAOC domain protein dehydratase; structural genomi | 95.64 | |
| 1c8u_A | 285 | Acyl-COA thioesterase II; internal repeats, hydrol | 95.49 | |
| 3u0a_A | 285 | Acyl-COA thioesterase II TESB2; structural genomic | 95.38 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 95.26 | |
| 3k67_A | 159 | Putative dehydratase AF1124; hypothetical protein | 95.24 | |
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 95.15 | |
| 3rd7_A | 286 | Acyl-COA thioesterase; seattle structur genomics c | 95.12 | |
| 2c2i_A | 151 | RV0130; hotdog, hydratase, lyase, structural prote | 94.84 | |
| 3esi_A | 129 | Uncharacterized protein; protein from erwinia caro | 94.76 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 94.69 | |
| 3q62_A | 175 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 94.6 | |
| 4b0b_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 94.36 | |
| 3k67_A | 159 | Putative dehydratase AF1124; hypothetical protein | 94.32 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 93.94 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 93.84 | |
| 2cf2_C | 342 | Fatty acid synthase, DH domain; transferase, fatty | 93.65 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 92.93 | |
| 4b8u_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 88.18 | |
| 3q62_A | 175 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 85.12 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 84.02 |
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=8.9e-58 Score=459.81 Aligned_cols=314 Identities=21% Similarity=0.227 Sum_probs=238.8
Q ss_pred CCcCCCCCeeEEEEcccCCcccCccccCCCCcccHhHHHHHHHHHHHHHHHHhcCCCCCCCCCceEEEEEEeeEEEccCC
Q 013560 79 LTKTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDLDALAGTISVKHCSDDDSMTRPLLLVTASVDKIALKKSI 158 (441)
Q Consensus 79 ~~r~~~dS~~~~~~p~~sd~~lr~~~~N~~G~v~gG~lLe~lD~~A~~~a~rh~~~~~~~~~p~~~VTasvD~i~F~~Pi 158 (441)
..-.+.+++.++.+ .+++.|+|++|+||||.||+|+|.+++++|++|++. .+||+++|+|+|++|+
T Consensus 17 ~~~~~~~~~~~~~~------~v~~~~~n~~G~v~gG~~l~~~D~aa~~~a~~~~~~--------~~vta~~~~i~F~~P~ 82 (333)
T 3b7k_A 17 NLYFQSMGEVVMSQ------AIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGV--------SCVTASVDDIQFEETA 82 (333)
T ss_dssp -----CCSEEEEEE------ECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHHHSS--------CEEEEEECCEECSCCC
T ss_pred EEEEecCCEEEEEE------EcCHHHcCCCCcEeHHHHHHHHHHHHHHHHHHHcCC--------ceEEEEEeeEEEecCC
Confidence 34455677777654 578899999999999999999999999999999875 6999999999999999
Q ss_pred CCCCEEEEEEEEEEEcccEEEEEEEEEEccccccCCCceEEEEEEEEEEEeeCCCCceeeccccCCCCHHHHHHHHHHHH
Q 013560 159 SVDIDLKIVGAVIWVGRSSIEIQLEVIQSTKEVSDTSDSVVLTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEAEA 238 (441)
Q Consensus 159 ~~gd~l~i~~~V~~vGrSSmeV~v~v~~~~~~~~~~~~~~v~~a~ft~Va~D~~~~kp~pVp~l~p~t~~E~~l~~~a~~ 238 (441)
++|++|++.++|+|+|+|||++.+++++++. .++...++++|.||||++|. ++||+|||+++|+|++|+++|+.|++
T Consensus 83 ~~gd~l~v~a~V~~~G~sS~~v~~~v~~~~~--~~~~~~~~a~a~~t~V~vd~-~~kp~~vP~~~~~t~~e~~~~~~a~~ 159 (333)
T 3b7k_A 83 RVGQVITIKAKVTRAFSTSMEISIKVMVQDM--LTGIEKLVSVAFSTFVAKPV-GKEKIHLKPVTLLTEQDHVEHNLAAE 159 (333)
T ss_dssp BTTEEEEEEEEEEEECSSEEEEEEEEEEEET--TTCCEEEEEEEEEEEEECCS-CC--CCCCCCCCCSHHHHHHHHHHHH
T ss_pred CCCCEEEEEEEEEEecCceEEEEEEEEEecC--CCCceEEEEEEEEEEEEECC-CCCccCCCCcCCCCHHHHHHHHHHHH
Confidence 9999999999999999999999999998762 34456899999999999995 89999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCCCCchhHHHHHHHHHhcccccCCCCcccCCceeecCCeEEEEEEeCCCCCCCCCCCcHHHHHHHHH
Q 013560 239 RSKLRKRKTGGDRRELDNGEVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQQRNIHGRIFGGFLMLRAF 318 (441)
Q Consensus 239 r~~~R~~~~~~~~~~~~~~e~~~l~~l~~~~~~~~~~p~~~~~~~v~~~dt~~~~~~~v~P~~~N~~G~vfGG~lm~~ad 318 (441)
|+++|++++.. +++++.++..+.+++...+++.+||+++++++.+.++|+|+|.+|++|||++|+|+|
T Consensus 160 r~~~r~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~n~~G~v~GG~~~~~~D 227 (333)
T 3b7k_A 160 RRKVRLQHEDT------------FNNLMKESSKFDDLIFDEEEGAVSTRGTSVQSIELVLPPHANHHGNTFGGQIMAWME 227 (333)
T ss_dssp HHHHHHHCCCC-------------------------------------CCCCEEEEEECCGGGBCTTCBBCHHHHHHHHH
T ss_pred HHHHHHHhhhh------------hHHHhhhcccccccccccCCCcccccCcEEEEEEEeChHHcCcCCcccHHHHHHHHH
Confidence 99888764321 344555555444555456778999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhcCCCcEEEEEceEEEcCccCcCcEEEEEEEEeeeeccCCCCCeEEEEEEEEEeeC---CCcceeEEEEEE
Q 013560 319 ELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTELENPDQPLINIEVVAHVTRP---EFRSSEVSNTFY 395 (441)
Q Consensus 319 e~A~~~A~~~~~~~~vt~~vd~i~F~~Pv~vGd~l~~~a~Vv~tg~~~~~~~~~~VeV~~~v~~~---~~~~~~~~n~~~ 395 (441)
++++++|.+++++.++|+++++|+|++|+++||+|+++|+|+++|++ ++.+++.+++.+. ..++..++++++
T Consensus 228 ~a~~~~a~~~~~~~~vtv~~~~i~F~~Pv~~Gd~l~~~a~v~~~g~~-----s~~v~v~v~~~~~~~~~~~~~~~~a~a~ 302 (333)
T 3b7k_A 228 TVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQT-----CVEVGVRVEAFDCQEWAEGRGRHINSAF 302 (333)
T ss_dssp HHHHHHHHTSBSSCCEEEEECCEECCSCCBTTCEEEEEEEEEEEETT-----EEEEEEEEEEECHHHHHHTCCEEEEEEE
T ss_pred HHHHHHHHHHcCCCcEEEEEeeeEEcCcccCCCEEEEEEEEEEECCC-----EEEEEEEEEEEeccCCCCCcEEEEEEEE
Confidence 99999999999999999999999999999999999999999999984 7888887877642 234567899999
Q ss_pred EEEEEeccCCCCccCCccccCCHHHHHHHHH
Q 013560 396 FTFTVSKAVTNGFRIRNVVPGTQEEARHILE 426 (441)
Q Consensus 396 fTfv~~d~~~~~~~v~~v~P~t~~E~~~~~~ 426 (441)
|||+++|+.|+|.++|+++|+|++|+++|.+
T Consensus 303 ~t~V~vd~~~kp~~iP~~~p~t~~e~~~~~~ 333 (333)
T 3b7k_A 303 LIYNAADDKENLITFPRIQPISKDDFRRYRG 333 (333)
T ss_dssp EEEECTTCGGGBC------------------
T ss_pred EEEEEECCCCCEecCCCCCCCCHHHHHHhhC
Confidence 9999999889999999999999999999964
|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A | Back alignment and structure |
|---|
| >2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* | Back alignment and structure |
|---|
| >4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* | Back alignment and structure |
|---|
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
| >4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 | Back alignment and structure |
|---|
| >1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 | Back alignment and structure |
|---|
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* | Back alignment and structure |
|---|
| >4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 | Back alignment and structure |
|---|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A | Back alignment and structure |
|---|
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} | Back alignment and structure |
|---|
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A | Back alignment and structure |
|---|
| >4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* | Back alignment and structure |
|---|
| >3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 441 | ||||
| d1vpma_ | 155 | d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus | 7e-24 | |
| d1vpma_ | 155 | d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus | 9e-19 | |
| d1y7ua1 | 164 | d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Baci | 5e-22 | |
| d1y7ua1 | 164 | d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Baci | 3e-19 | |
| d2gvha2 | 116 | d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase A | 4e-16 | |
| d2gvha2 | 116 | d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase A | 7e-14 | |
| d1ylia1 | 142 | d.38.1.1 (A:11-152) Putative acyl-coa thioester hy | 7e-16 | |
| d1ylia1 | 142 | d.38.1.1 (A:11-152) Putative acyl-coa thioester hy | 6e-15 | |
| d2gvha1 | 135 | d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR | 8e-15 | |
| d2gvha1 | 135 | d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR | 2e-12 | |
| d2hboa1 | 142 | d.38.1.5 (A:12-153) Hypothetical protein CC3309 {C | 6e-04 | |
| d2f0xa1 | 136 | d.38.1.5 (A:3-138) Hypothetical protein Them2 {Hum | 0.002 |
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Length = 155 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: 4HBT-like domain: Acyl-CoA hydrolase BH0798 species: Bacillus halodurans [TaxId: 86665]
Score = 95.1 bits (236), Expect = 7e-24
Identities = 46/167 (27%), Positives = 80/167 (47%), Gaps = 17/167 (10%)
Query: 80 TKTSSQSRTSILYNFSTDDILREQYRDPWNEVRIGKLLEDLDALAGTISVKHCSDDDSMT 139
+ +SRT ++ + + GK+L +D +A ++KH +
Sbjct: 3 SYPVERSRTI------QTRLVLPPDTNHLGTIFGGKVLAYIDEIAALTAMKHANSA---- 52
Query: 140 RPLLLVTASVDKIALKKSISVDIDLKIVGAVIWVGRSSIEIQLEVIQSTKEVSDTSDSVV 199
+VTAS+D + K S +V L++ G V GR+S+E+ + V + ++
Sbjct: 53 ----VVTASIDSVDFKSSATVGDALELEGFVTHTGRTSMEVYVRVHS--NNLLTGERTLT 106
Query: 200 LTANFIFVARDSKTGKAAPVNRLSPQTEREKSLFEEAEARSKLRKRK 246
+ VA D ++GK PV ++ PQTE EK L+E A AR + RK++
Sbjct: 107 TESFLTMVAVD-ESGKPKPVPQVEPQTEEEKRLYETAPARKENRKKR 152
|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Length = 155 | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Length = 164 | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Length = 164 | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 116 | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 116 | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Length = 142 | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Length = 142 | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 135 | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 135 | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Length = 142 | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 441 | |||
| d1y7ua1 | 164 | Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: | 100.0 | |
| d1vpma_ | 155 | Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta | 100.0 | |
| d1y7ua1 | 164 | Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: | 100.0 | |
| d1vpma_ | 155 | Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta | 100.0 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 99.97 | |
| d2gvha2 | 116 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 99.97 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 99.97 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 99.97 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 99.95 | |
| d2gvha2 | 116 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 99.95 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 99.58 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 99.56 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 99.54 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 99.53 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 99.5 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 99.48 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 99.46 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 99.46 | |
| d2alia1 | 130 | Hypothetical protein PA2801 {Pseudomonas aeruginos | 99.45 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 99.45 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 99.44 | |
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 99.43 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 99.43 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 99.43 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 99.42 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 99.4 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 99.4 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 99.4 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 99.4 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 99.39 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 99.39 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 99.39 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 99.38 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 99.36 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 99.35 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 99.35 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 99.34 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 99.33 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 99.32 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 99.3 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 99.3 | |
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 99.29 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 99.25 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 99.24 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 99.21 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 99.19 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 99.18 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 99.16 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 99.08 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 99.05 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 99.03 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 98.97 | |
| d1sh8a_ | 153 | Hypothetical protein PA5026 {Pseudomonas aeruginos | 98.78 | |
| d1sh8a_ | 153 | Hypothetical protein PA5026 {Pseudomonas aeruginos | 98.68 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 98.63 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 98.62 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 98.61 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 98.54 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 98.42 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 98.41 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 98.35 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 98.32 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 98.32 | |
| d2alia1 | 130 | Hypothetical protein PA2801 {Pseudomonas aeruginos | 98.22 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 98.2 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 98.2 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 98.18 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 98.16 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 98.13 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 98.13 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 98.09 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 98.08 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 97.99 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 97.93 | |
| d1u1za_ | 145 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo | 97.49 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 97.37 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 97.25 | |
| d1z6ba1 | 146 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria | 97.01 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 96.92 | |
| d2bi0a2 | 152 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 96.83 | |
| d2c2ia1 | 149 | Hypothetical protein Rv0130 {Mycobacterium tubercu | 96.57 | |
| d1tbua1 | 104 | Peroxisomal long-chain acyl-CoA thioesterase 1, TE | 96.45 | |
| d2q78a1 | 130 | Uncharacterized protein TM0581 {Thermotoga maritim | 96.3 | |
| d1tbua1 | 104 | Peroxisomal long-chain acyl-CoA thioesterase 1, TE | 96.3 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 96.11 | |
| d1z6ba1 | 146 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria | 96.1 | |
| d1q6wa_ | 151 | Monoamine oxidase regulatory protein {Archaeon Arc | 96.1 | |
| d1iq6a_ | 132 | (R)-specific enoyl-CoA hydratase {Aeromonas caviae | 96.05 | |
| d1c8ua1 | 114 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 95.99 | |
| d1u1za_ | 145 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo | 95.75 | |
| d1c8ua1 | 114 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 95.6 | |
| d1iq6a_ | 132 | (R)-specific enoyl-CoA hydratase {Aeromonas caviae | 95.11 | |
| d1q6wa_ | 151 | Monoamine oxidase regulatory protein {Archaeon Arc | 94.75 | |
| d2bi0a2 | 152 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 94.7 | |
| d2b3na1 | 154 | Hypothetical protein AF1124 {Archaeon Archaeoglobu | 94.55 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 94.55 | |
| d2q78a1 | 130 | Uncharacterized protein TM0581 {Thermotoga maritim | 94.53 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 94.12 | |
| d2c2ia1 | 149 | Hypothetical protein Rv0130 {Mycobacterium tubercu | 94.03 | |
| d2b3na1 | 154 | Hypothetical protein AF1124 {Archaeon Archaeoglobu | 94.02 | |
| d1pn2a2 | 124 | 2-enoyl-coa hydratase domain of multifunctional pe | 91.82 | |
| d1s9ca1 | 126 | 2-enoyl-coa hydratase domain of multifunctional pe | 88.81 | |
| d1pn2a2 | 124 | 2-enoyl-coa hydratase domain of multifunctional pe | 87.14 | |
| d1pn2a1 | 148 | 2-enoyl-coa hydratase domain of multifunctional pe | 86.63 | |
| d1s9ca2 | 154 | 2-enoyl-coa hydratase domain of multifunctional pe | 86.34 | |
| d1s9ca2 | 154 | 2-enoyl-coa hydratase domain of multifunctional pe | 86.23 |
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: 4HBT-like domain: Acyl-coa hydrolase BC2038 species: Bacillus cereus [TaxId: 1396]
Probab=100.00 E-value=1e-37 Score=281.38 Aligned_cols=152 Identities=20% Similarity=0.210 Sum_probs=145.2
Q ss_pred ceeecCCeEEEEEEeCCCCCCCCCCCcHHHHHHHHHHHHHHHHHhhcCCCcEEEEEceEEEcCccCcCcEEEEEEEEeee
Q 013560 283 SILLRDTRLENALICQPQQRNIHGRIFGGFLMLRAFELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYT 362 (441)
Q Consensus 283 ~v~~~dt~~~~~~~v~P~~~N~~G~vfGG~lm~~ade~A~~~A~~~~~~~~vt~~vd~i~F~~Pv~vGd~l~~~a~Vv~t 362 (441)
..++++|++.++..|+|+|+|+||++|||+||+|+|++|+++|++|+++.++|+++|+|+|++|+++||+|.++|+|+|+
T Consensus 2 ~k~~~es~~~~~~~V~P~~~N~~G~l~GG~ll~~~D~~a~~~a~~~~~~~~vtasvd~i~F~~Pv~~Gd~l~~~a~V~~~ 81 (164)
T d1y7ua1 2 GKTANESRVFKTSRVFPTDLNDHNTLFGGKILSEMDMVASISASRHSRKECVTASMDWVDFLHPVRSSDCVSYESFVIWT 81 (164)
T ss_dssp EEEGGGGCEEEEEECCGGGBCTTSSBCHHHHHHHHHHHHHHHHHHHHCSEEEEEEECCCCCCSCCCTTCEEEEEEEEEEE
T ss_pred CccccCceeEEEEEEChHHcCCCCceeHHHHHHHHHHHHHHHHHHHcCCCCceEEEeeEEEeeccCCCceEEEEEEEeec
Confidence 36789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eccCCCCCeEEEEEEEEEeeCCCcceeEEEEEEEEEEEeccCCCCccCCccccCCHHHHHHHHHHHHHHHHhhhhcc
Q 013560 363 ELENPDQPLINIEVVAHVTRPEFRSSEVSNTFYFTFTVSKAVTNGFRIRNVVPGTQEEARHILERMDAKALQLSKGV 439 (441)
Q Consensus 363 g~~~~~~~~~~VeV~~~v~~~~~~~~~~~n~~~fTfv~~d~~~~~~~v~~v~P~t~~E~~~~~~a~~r~~~~~~~~~ 439 (441)
|+ +||.|.|.++..++.+++..+++.++||||++|++|+|.+||+++|+|++|+++|++|++|++.|+.++.
T Consensus 82 G~-----tS~~V~v~v~~~~~~~~~~~~~~~a~ftfVavd~~g~p~~vp~l~p~t~eE~~~~~~a~~r~~~R~~r~~ 153 (164)
T d1y7ua1 82 GR-----TSMEVFVKVVSEYLISGEKRIAATSFVTFVALSKENNPVPVPRVIPDTEEEKESHRIAVLRAEQRHIRKA 153 (164)
T ss_dssp CS-----SEEEEEEEEEEECTTTCCEEEEEEEEEEEEEECTTSCBCCCCEEECCSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CC-----ceEEEEEEEEEEeCCCCcEEEEEEEEEEEEEECCCCCeeeCCccCCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence 98 4899999999999888888999999999999999999999999999999999999999999999887764
|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} | Back information, alignment and structure |
|---|
| >d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} | Back information, alignment and structure |
|---|
| >d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|