Citrus Sinensis ID: 013669
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 438 | ||||||
| 357486631 | 443 | SNF1-related protein kinase regulatory s | 0.997 | 0.986 | 0.716 | 1e-176 | |
| 225424926 | 444 | PREDICTED: SNF1-related protein kinase r | 1.0 | 0.986 | 0.772 | 1e-171 | |
| 255558196 | 443 | AMP-activated protein kinase, gamma regu | 0.997 | 0.986 | 0.743 | 1e-165 | |
| 224140801 | 443 | predicted protein [Populus trichocarpa] | 0.997 | 0.986 | 0.720 | 1e-165 | |
| 356500477 | 443 | PREDICTED: SNF1-related protein kinase r | 0.997 | 0.986 | 0.720 | 1e-161 | |
| 449434819 | 442 | PREDICTED: SNF1-related protein kinase r | 0.995 | 0.986 | 0.752 | 1e-161 | |
| 356498190 | 443 | PREDICTED: SNF1-related protein kinase r | 0.997 | 0.986 | 0.734 | 1e-160 | |
| 145327199 | 476 | Cystathionine beta-synthase (CBS) protei | 0.997 | 0.918 | 0.702 | 1e-158 | |
| 42563087 | 447 | Cystathionine beta-synthase (CBS) protei | 0.997 | 0.977 | 0.702 | 1e-158 | |
| 297841713 | 447 | CBS domain-containing protein [Arabidops | 0.997 | 0.977 | 0.700 | 1e-156 |
| >gi|357486631|ref|XP_003613603.1| SNF1-related protein kinase regulatory subunit gamma [Medicago truncatula] gi|355514938|gb|AES96561.1| SNF1-related protein kinase regulatory subunit gamma [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 623 bits (1606), Expect = e-176, Method: Compositional matrix adjust.
Identities = 318/444 (71%), Positives = 376/444 (84%), Gaps = 7/444 (1%)
Query: 1 MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGR---- 56
MA +E + ++LS CD YFE IQSRKKLP +LQETLT +FA+IPV SFP VPGG+
Sbjct: 1 MAHEQEVRTSTQLSKCDRYFETIQSRKKLPQTLQETLTDSFAKIPVSSFPGVPGGKVVEI 60
Query: 57 --DTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAA 114
DT + +AVKILSE NIL+APVK PDA SDW++RYLGI+DYSAIILWV+E+AELAA
Sbjct: 61 LADTPVGEAVKILSESNILAAPVKDPDAGIGSDWRDRYLGIIDYSAIILWVMESAELAAV 120
Query: 115 AFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAP 174
A S GTATAAGVG GTVGALGA+ALG TGPAA+AGLT AA GAAV GG+AA+K KDAP
Sbjct: 121 ALSAGTATAAGVGAGTVGALGAIALGATGPAAIAGLTAAAVGAAVVGGVAADKTMAKDAP 180
Query: 175 TAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRN 234
AA+ L EDFYKVILQEEPFKSTTVRSI+KSYRWAPF+PVA + +ML+VLLLLSKYRLRN
Sbjct: 181 QAANNLGEDFYKVILQEEPFKSTTVRSILKSYRWAPFVPVAKNSAMLTVLLLLSKYRLRN 240
Query: 235 VPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSN 294
VP+IEPG DI N+ITQSAV+QGLEGC+GRDWFD IA++P++DLGLPFMS+D+VI+IQSN
Sbjct: 241 VPVIEPGKADIVNFITQSAVIQGLEGCRGRDWFDCIAARPMADLGLPFMSADKVISIQSN 300
Query: 295 ELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFRQLTVRDFMN 354
ELILEAFK M+DN IGG+PVVEG K IVGN+SIRDIR+LLLKPE+FSNFR LTV DFM
Sbjct: 301 ELILEAFKIMRDNQIGGLPVVEGPAKTIVGNLSIRDIRYLLLKPEIFSNFRNLTVMDFMK 360
Query: 355 AVVPTTPDSGKVNPPITCKLESTLGSVIHSLASKSVHRIYVVAGEEAEVVGVITLRDVIS 414
+V + +SGKV PITCK ++TL SVIH+LAS+S+HRIY V G++ +VVGVITLRDVIS
Sbjct: 361 KIVSASYESGKVTRPITCKPDATLQSVIHTLASQSIHRIYTVNGQD-QVVGVITLRDVIS 419
Query: 415 CFIFEPPNHLDNYFGFSVKDLLNQ 438
CFI EP H D+Y+GF+VK++LNQ
Sbjct: 420 CFITEPDYHFDDYYGFAVKEMLNQ 443
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225424926|ref|XP_002277342.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Vitis vinifera] gi|296086419|emb|CBI32008.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255558196|ref|XP_002520125.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223540617|gb|EEF42180.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224140801|ref|XP_002323767.1| predicted protein [Populus trichocarpa] gi|222866769|gb|EEF03900.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356500477|ref|XP_003519058.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449434819|ref|XP_004135193.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] gi|449478452|ref|XP_004155322.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356498190|ref|XP_003517936.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|145327199|ref|NP_001077801.1| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] gi|332196856|gb|AEE34977.1| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42563087|ref|NP_564975.2| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] gi|75262290|sp|Q9CAR3.1|KINGL_ARATH RecName: Full=SNF1-related protein kinase regulatory subunit gamma-1-like; AltName: Full=AKIN subunit gamma-1-like; AltName: Full=CBS domain-containing protein CBSCBS2 gi|12325233|gb|AAG52563.1|AC010675_11 hypothetical protein; 77242-78931 [Arabidopsis thaliana] gi|190684768|gb|ACE82595.1| At1g69800 [Arabidopsis thaliana] gi|222424344|dbj|BAH20128.1| AT1G69800 [Arabidopsis thaliana] gi|332196855|gb|AEE34976.1| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297841713|ref|XP_002888738.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334579|gb|EFH64997.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 438 | ||||||
| TAIR|locus:2114475 | 424 | KING1 "AT3G48530" [Arabidopsis | 0.559 | 0.577 | 0.350 | 1.4e-56 | |
| DICTYBASE|DDB_G0288201 | 313 | DDB_G0288201 [Dictyostelium di | 0.442 | 0.619 | 0.229 | 2.3e-09 | |
| DICTYBASE|DDB_G0278953 | 359 | DDB_G0278953 "CBS (cystathioni | 0.463 | 0.565 | 0.223 | 1.9e-07 | |
| DICTYBASE|DDB_G0275177 | 304 | sigI "CBS (cystathionine-beta- | 0.351 | 0.506 | 0.266 | 8.9e-07 | |
| UNIPROTKB|Q48IU0 | 146 | PSPPH_2494 "CBS domain protein | 0.132 | 0.397 | 0.409 | 0.00085 |
| TAIR|locus:2114475 KING1 "AT3G48530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 441 (160.3 bits), Expect = 1.4e-56, Sum P(2) = 1.4e-56
Identities = 88/251 (35%), Positives = 145/251 (57%)
Query: 183 DFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDXXXXXXXXXXKYRLRNVPIIEPGT 242
+F++V+ E +K+T VR I ++RWAPFL + ++ KY+++++P+++ G
Sbjct: 163 NFFEVLTSSELYKNTKVRDISGTFRWAPFLALQKENSFLTMLLLLSKYKMKSIPVVDLGV 222
Query: 243 PDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFK 302
I+N ITQS V+ L C G WF+ + +S++GLP MS D +I I +E +L+AFK
Sbjct: 223 AKIENIITQSGVIHMLAECAGLLWFEDWGIKTLSEVGLPIMSKDHIIKIYEDEPVLQAFK 282
Query: 303 RMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFRQLTVRDFMNAVVPTTPD 362
M+ IGGIPV+E +K VGN+S+RD++ LL PE++ ++R +T ++F+ +V
Sbjct: 283 LMRRKRIGGIPVIERNSEKPVGNISLRDVQFLLTAPEIYHDYRSITTKNFLVSVREHLEK 342
Query: 363 SGKVNPPI-----TCKLESTLGSVIHSLASKSVHRIYXXXXXXXXXXXXITLRDVISCFI 417
G + PI C TL +I L ++ +HRIY ITLRD+I+ +
Sbjct: 343 CGDTSAPIMSGVIACTKNHTLKELILMLDAEKIHRIYVVDDFGNLEGL-ITLRDIIARLV 401
Query: 418 FEPPNHLDNYF 428
EP + ++F
Sbjct: 402 HEPSGYFGDFF 412
|
|
| DICTYBASE|DDB_G0288201 DDB_G0288201 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0278953 DDB_G0278953 "CBS (cystathionine-beta-synthase) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0275177 sigI "CBS (cystathionine-beta-synthase) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48IU0 PSPPH_2494 "CBS domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 438 | |||
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 7e-43 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 2e-16 | |
| cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after | 5e-14 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 6e-12 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 1e-11 | |
| cd04609 | 110 | cd04609, CBS_pair_PALP_assoc2, This cd contains tw | 2e-11 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 5e-11 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 9e-10 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 3e-09 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 4e-09 | |
| cd04601 | 110 | cd04601, CBS_pair_IMPDH, This cd contains two tand | 6e-09 | |
| COG3620 | 187 | COG3620, COG3620, Predicted transcriptional regula | 7e-09 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 1e-08 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 2e-08 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 5e-08 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 9e-08 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 1e-07 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 1e-07 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 3e-07 | |
| cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after | 6e-07 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 6e-07 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 9e-07 | |
| cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after | 1e-06 | |
| cd04595 | 110 | cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con | 2e-06 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 2e-06 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 9e-06 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 1e-05 | |
| cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con | 1e-05 | |
| cd04635 | 122 | cd04635, CBS_pair_22, The CBS domain, named after | 1e-05 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 2e-05 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 2e-05 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 2e-05 | |
| PRK05567 | 486 | PRK05567, PRK05567, inosine 5'-monophosphate dehyd | 2e-05 | |
| cd04621 | 135 | cd04621, CBS_pair_8, The CBS domain, named after h | 2e-05 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 3e-05 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 4e-05 | |
| cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after | 6e-05 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 7e-05 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 1e-04 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 1e-04 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 2e-04 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 2e-04 | |
| cd04610 | 107 | cd04610, CBS_pair_ParBc_assoc, This cd contains tw | 2e-04 | |
| COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regula | 2e-04 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 3e-04 | |
| cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after h | 3e-04 | |
| TIGR01302 | 450 | TIGR01302, IMP_dehydrog, inosine-5'-monophosphate | 3e-04 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 5e-04 | |
| cd04641 | 120 | cd04641, CBS_pair_28, The CBS domain, named after | 5e-04 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 8e-04 | |
| cd04626 | 111 | cd04626, CBS_pair_13, The CBS domain, named after | 9e-04 | |
| cd04621 | 135 | cd04621, CBS_pair_8, The CBS domain, named after h | 0.001 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 0.001 | |
| cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after h | 0.001 | |
| cd04626 | 111 | cd04626, CBS_pair_13, The CBS domain, named after | 0.001 | |
| cd04643 | 116 | cd04643, CBS_pair_30, The CBS domain, named after | 0.001 | |
| cd04596 | 108 | cd04596, CBS_pair_DRTGG_assoc, This cd contains tw | 0.001 | |
| cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after | 0.002 | |
| PRK13875 | 440 | PRK13875, PRK13875, conjugal transfer protein TrbL | 0.002 | |
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 0.002 | |
| PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent i | 0.002 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 0.002 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 0.002 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 0.003 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 0.003 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 0.004 | |
| cd04632 | 128 | cd04632, CBS_pair_19, The CBS domain, named after | 0.004 |
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Score = 146 bits (371), Expect = 7e-43
Identities = 55/130 (42%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
Query: 286 DEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR 345
+V++I S+E +L+AFK M+ NNI G+PVV+ + K++GN+S D++ LLL P+ +R
Sbjct: 1 SKVVSIDSDERVLDAFKLMRKNNISGLPVVDEK-GKLIGNISASDLKGLLLSPDDLLLYR 59
Query: 346 QLTVRDFMNAVVPTTPDSGKVNPPITCKLESTLGSVIHSLASKSVHRIYVVAGEEAEVVG 405
+T ++ T D K P ITC STL VI L + VHR++VV EE + +G
Sbjct: 60 TITFKELSEKF--TDSDGVKSRPLITCTPSSTLKEVITKLVANKVHRVWVV-DEEGKPIG 116
Query: 406 VITLRDVISC 415
VITL D+IS
Sbjct: 117 VITLTDIISI 126
|
CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 126 |
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|226147 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239998 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239998 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240014 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 438 | |||
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.97 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.77 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.71 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.65 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.63 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.6 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.58 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.58 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.58 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.57 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.56 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.56 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.53 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.52 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.52 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.52 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.52 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.52 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.51 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.5 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.5 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.5 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.5 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.5 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.5 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.49 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.49 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.49 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.48 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.48 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.48 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.48 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.48 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.48 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.48 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.47 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.47 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.47 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.47 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.47 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.47 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.47 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.47 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.47 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.47 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.46 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.46 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.46 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.46 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.45 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.45 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.45 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.45 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.45 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.44 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.44 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.44 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.44 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.44 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.44 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.43 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.43 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.43 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.42 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.42 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.42 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.42 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.41 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.41 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.41 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.41 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.41 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.4 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.4 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.4 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.39 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.39 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.39 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.39 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.38 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.38 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.38 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.38 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.38 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.38 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.38 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.38 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.37 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.37 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.37 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.37 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.37 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.37 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.37 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.37 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.36 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.36 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.35 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.35 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.35 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.35 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.35 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.35 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.34 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.34 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.34 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.34 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.34 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.34 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.34 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.33 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.33 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.33 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.33 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.33 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.33 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.32 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.32 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.31 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.31 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.31 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.31 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.3 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.3 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.3 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.29 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.29 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.29 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.29 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.28 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.28 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.28 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.28 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.28 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.27 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.27 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.27 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.27 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.27 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.27 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.27 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.27 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.27 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.26 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.26 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.26 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.26 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.25 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.25 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.23 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.23 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.23 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.23 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.23 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.23 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.22 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.21 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.21 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.21 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.21 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.2 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.2 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.18 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.17 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.15 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.15 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.14 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.12 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.11 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.11 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.09 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.08 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.08 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.06 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.05 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.04 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.02 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.02 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.98 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.97 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.97 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 98.9 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.82 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.75 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.71 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 98.7 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.66 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.65 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.6 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.36 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.35 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.24 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.21 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.15 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.99 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.94 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.72 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.72 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.59 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.52 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.97 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.38 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 95.01 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 94.84 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 93.53 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 92.58 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 86.59 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 86.02 |
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=99.97 E-value=9.1e-30 Score=251.75 Aligned_cols=294 Identities=26% Similarity=0.379 Sum_probs=241.3
Q ss_pred CCCHHHHHHHHHHcCCccCceecCCCCCCCCcccceeEEeehhHHHHHHHHhhHHhhhhcccccccccccCCcccccchh
Q 013669 57 DTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGA 136 (438)
Q Consensus 57 ~~sv~~A~~~l~~~~i~~~PV~d~~~~~~~~~~~~~iGiv~~~di~~~~l~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~ 136 (438)
..++.+|+..|..+.++++||+|... ++++|++++.|++..++..+...
T Consensus 84 ~~~v~~a~~~l~~~~~~~~p~~~~~~-------~~~~g~~~~~d~i~~~~~~~~~~------------------------ 132 (381)
T KOG1764|consen 84 KLSVKKAFNALVQNGVRAAPLWDSKK-------QQFVGMLTITDFITVLLRYYKSK------------------------ 132 (381)
T ss_pred CCcHHHHHHHHHhhceeeeccccCcc-------ceeEEEEEHHHHHHHHHHhhccC------------------------
Confidence 89999999999999999999999987 79999999999999877654210
Q ss_pred hhccCCCcchhhhhhHHHhhhhhhccccccccCCCCCccccccccchhhhhhhccCCCCCCchhhhccccCCCCceEEeC
Q 013669 137 LALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVAT 216 (438)
Q Consensus 137 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~~~~~~~~v~di~~~~~~~~~i~v~~ 216 (438)
...+....+..........+..+.....+++++.+.+
T Consensus 133 -------------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~p 169 (381)
T KOG1764|consen 133 -------------------------------------------SSLDNIEVLEDSQLSKRREVECLLKETLKPPFVSISP 169 (381)
T ss_pred -------------------------------------------CcHHHHhhhhhhhccccchhhhhhccccCCCceeecC
Confidence 0112222232233333344555555556677799999
Q ss_pred CCCHHHHHHHHHhCCCCEEEEEcCCCCCEEEEEeHHHHHHHhhcCCCCCcccccccCCccccccCCCCCCCceEEcCCCc
Q 013669 217 DDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNEL 296 (438)
Q Consensus 217 ~~sl~~al~~m~~~~i~~lpVvd~~~~~v~Giit~~Di~~~l~~~~~~~~~~~l~~~~v~~l~l~~m~~~~vv~v~~~~~ 296 (438)
..++.++...+.+++++++||.|.+.+++.+++|+..|++++..+.+.-++..+..+++.+++++.+. ++..+..+++
T Consensus 170 ~~s~l~~~~~l~~~~~~rvpv~d~~~~~v~~ilt~~rIl~~l~~~~~~~~~~~~l~~s~~dl~ig~~~--~i~~i~~~~~ 247 (381)
T KOG1764|consen 170 ESSLLDAVLLLIKSRIHRVPVIDPETGEVLYILTQRRILKFLWLNGRLLPLPSLLSKSLSDLGIGTWS--NIASISEDTP 247 (381)
T ss_pred cHHHHHHHHHHHhCCccceeeecccccceeeehhHHHHHHHHHHhhcccccHHHhhCCHHHhCcchhh--hheeecCCCc
Confidence 99999999999999999999999666899999999999999998866666778889999999887554 6999999999
Q ss_pred HHHHHHHHHHcCCceEeEEeCCCCeEEEEEeHHHHHHHhcCCccccccccCc-HHHHhcccCCCCCCCCCCCCCeEeCCC
Q 013669 297 ILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFRQLT-VRDFMNAVVPTTPDSGKVNPPITCKLE 375 (438)
Q Consensus 297 l~~a~~~m~~~~~~~lpVvd~~~~~lvGiIs~~Dl~~~l~~~~~~~~~~~~~-v~~~m~~~~~~~~~~~~~~~~~~v~~~ 375 (438)
+.+|+++|.+++++++||++. .|+.+|+++..|+..+........ ...+ +.+..... ..+..++++|+++
T Consensus 248 v~~al~~m~~~~is~lpvV~~-~g~~v~~~s~~Dv~~l~~~~~~~~--~~~~~l~~~~~~~------~~~~~~vvtc~~~ 318 (381)
T KOG1764|consen 248 VIEALKIMSERRISALPVVDE-NGKKVGNYSRFDVIHLAREGTYNN--LDLSCLSEALSHR------PIRFEGVVTCRPT 318 (381)
T ss_pred HHHHHHHHHhcCcCcceEEcC-CCceecceehhhhhhhhhcCccCc--cchhHHHHHhhhc------ccccCccEEEeec
Confidence 999999999999999999998 777799999999999987654422 1233 55555431 1233468999999
Q ss_pred CCHHHHHHHHHhCCCCEEEEEeCCCCeEEEEEeHHHHHHHhhcCCCCcccccchhhHHHhh
Q 013669 376 STLGSVIHSLASKSVHRIYVVAGEEAEVVGVITLRDVISCFIFEPPNHLDNYFGFSVKDLL 436 (438)
Q Consensus 376 ~tL~ea~~~m~~~~i~~l~VVd~~g~~lvGvIT~~DIl~~l~~e~~~~~~~~~~~~~~~~~ 436 (438)
+||.+++.+|..+++||+||||++| +++|+||++||+.++..+|.+++...+++......
T Consensus 319 ssL~~vi~~lv~~~vHRl~VVd~~~-~l~GvvSLsDil~~l~~~p~~~~~~~~~~~~~~~~ 378 (381)
T KOG1764|consen 319 STLAEVIDKLVAHRVHRLWVVDEDG-VLVGVISLSDILSYLVLTPSGGTPDAPSSSMSTSE 378 (381)
T ss_pred chHHHHHHHHHhcCceEEEEEcCCC-cEEEEeeHHHHHHHHHhCccCCCCCCcCccccccC
Confidence 9999999999999999999999998 99999999999999999999999998887665443
|
|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 438 | |||
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 4e-44 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 5e-22 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 1e-17 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 6e-13 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 4e-42 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 1e-12 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 8e-10 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 5e-09 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 2e-36 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 8e-15 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 2e-11 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 4e-32 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 3e-07 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 1e-29 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 8e-07 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 2e-04 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 9e-23 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-21 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-17 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 5e-13 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 9e-21 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 6e-12 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-20 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 1e-19 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-10 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-19 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 2e-08 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 8e-04 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 2e-19 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 5e-12 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 3e-19 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 4e-19 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 3e-10 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 7e-19 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 2e-12 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 1e-18 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 4e-10 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 2e-18 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 8e-10 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 1e-05 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 2e-18 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 4e-09 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 3e-18 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-08 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 5e-18 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 1e-09 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 5e-18 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 2e-09 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 8e-06 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 8e-18 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 4e-07 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 9e-18 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 4e-10 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 1e-17 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 4e-09 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 3e-05 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 3e-17 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 1e-10 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 6e-17 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 7e-16 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 4e-08 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 4e-15 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 3e-08 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 6e-05 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 5e-15 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 6e-09 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 9e-15 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 1e-06 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 2e-12 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 6e-07 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 9e-12 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 4e-11 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 3e-05 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 9e-10 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-09 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 4e-09 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 2e-08 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 3e-07 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 6e-07 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 6e-07 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 1e-06 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 2e-06 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 2e-05 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 1e-04 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 2e-04 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 5e-04 |
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
Score = 155 bits (394), Expect = 4e-44
Identities = 42/245 (17%), Positives = 101/245 (41%), Gaps = 12/245 (4%)
Query: 179 RLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPII 238
R ++ I + E K T R + + P + ++ + S+ + L + ++ +P+I
Sbjct: 96 RYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVI 155
Query: 239 EPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELIL 298
+P + + +T +++ L+ S+ + +L + + + +++ +
Sbjct: 156 DPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQI--GTYANIAMVRTTTPVY 213
Query: 299 EAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFRQLTVRDFMNAVVP 358
A + + +PVV+ ++ ++V S D+ +L + N ++V +
Sbjct: 214 VALGIFVQHRVSALPVVD-EKGRVVDIYSKFDVINLAAEK--TYNNLDVSVTKALQHRSH 270
Query: 359 TTPDSGKVNPPITCKLESTLGSVIHSLASKSVHRIYVVAGEEAEVVGVITLRDVISCFIF 418
+ C L TL ++I+ L VHR+ VV E V G+++L D++ +
Sbjct: 271 YFE------GVLKCYLHETLEAIINRLVEAEVHRLVVV-DEHDVVKGIVSLSDILQALVL 323
Query: 419 EPPNH 423
Sbjct: 324 TGGEK 328
|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 438 | |||
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 100.0 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 100.0 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.98 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.97 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.97 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.97 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.91 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.91 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.89 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.88 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.86 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.86 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.81 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.8 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.78 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.78 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.77 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.77 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.77 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.76 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.76 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.75 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.75 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.74 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.74 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.73 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.73 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.73 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.73 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.72 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.72 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.72 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.72 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.71 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.71 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.71 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.71 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.71 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.71 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.7 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.7 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.7 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.7 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.69 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.69 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.69 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.69 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.69 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.69 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.69 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.69 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.68 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.68 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.68 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.68 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.68 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.68 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.68 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.68 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.67 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.67 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.67 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.67 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.67 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.66 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.66 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.66 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.66 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.66 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.65 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.65 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.65 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.64 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.64 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.63 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.63 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.63 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.63 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.62 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.62 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.62 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.62 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.61 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.61 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.61 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.61 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.61 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.61 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.6 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.6 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.6 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.59 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.59 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.58 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.58 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.58 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.56 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.55 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.5 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.5 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.48 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.48 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.44 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.42 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.37 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.35 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.35 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.34 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.32 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.32 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.32 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.27 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.25 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.23 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.22 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.19 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.15 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.13 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.09 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.07 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.07 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.04 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.01 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.96 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.95 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.86 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.66 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.58 |
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-32 Score=263.23 Aligned_cols=253 Identities=20% Similarity=0.338 Sum_probs=207.8
Q ss_pred CCCCHHHHHHHHHHcCCccCceecCCCCCCCCcccceeEEeehhHHHHHHHHhhHHhhhhcccccccccccCCcccccch
Q 013669 56 RDTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALG 135 (438)
Q Consensus 56 ~~~sv~~A~~~l~~~~i~~~PV~d~~~~~~~~~~~~~iGiv~~~di~~~~l~~~~~~~~~~~~~~~~~~g~~~~~~~~~~ 135 (438)
+++|+.+|+++|.+++++++||+|++. ++++|++|..||+.++.......
T Consensus 19 ~~~sl~~a~~~m~~~~~~~lpV~d~~~-------~~~~Givt~~di~~~~~~~~~~~----------------------- 68 (280)
T 3kh5_A 19 PTTTIRKALMTMNENKYRRLPVVNAGN-------NKVVGIITSMDIVDFMGGGSKYN----------------------- 68 (280)
T ss_dssp TTSBHHHHHHHHHHHCCCEEEEECTTT-------CBEEEEEEHHHHHHHTTTSGGGH-----------------------
T ss_pred CCCcHHHHHHHHHhCCCcEeeEEECCC-------CeEEEEEEHHHHHHHhcccchhh-----------------------
Confidence 499999999999999999999999744 69999999999998742211000
Q ss_pred hhhccCCCcchhhhhhHHHhhhhhhccccccccCCCCCccccccccchhhhhhhccCCCCCCchhhhccccCCCCceEEe
Q 013669 136 ALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVA 215 (438)
Q Consensus 136 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~~~~~~~~v~di~~~~~~~~~i~v~ 215 (438)
+ .......+++..+ ..+++++|. .+++++.
T Consensus 69 --------------~-------------------------~~~~~~~~~~~~~-------~~~v~~im~----~~~~~v~ 98 (280)
T 3kh5_A 69 --------------L-------------------------IREKHERNFLAAI-------NEPVREIME----ENVITLK 98 (280)
T ss_dssp --------------H-------------------------HHTTSTTCHHHHT-------TSBGGGTSB----CSCCCEE
T ss_pred --------------h-------------------------hhhccccchhHHh-------hhhHHHhcC----CCCEEEC
Confidence 0 0000111222111 356999998 6899999
Q ss_pred CCCCHHHHHHHHHhCCCCEEEEEcCCCCCEEEEEeHHHHHHHhhcCCCCCcccccccCCccccccCCCCCCCceEEcCCC
Q 013669 216 TDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNE 295 (438)
Q Consensus 216 ~~~sl~~al~~m~~~~i~~lpVvd~~~~~v~Giit~~Di~~~l~~~~~~~~~~~l~~~~v~~l~l~~m~~~~vv~v~~~~ 295 (438)
+++++.+|+++|.+++++++||+|++ |+++|++|..|+++.+..... ...++.+ +|.+ ++.++.+++
T Consensus 99 ~~~~~~~a~~~~~~~~~~~~~Vvd~~-~~~~Givt~~dl~~~~~~~~~-------~~~~v~~----~m~~-~~~~v~~~~ 165 (280)
T 3kh5_A 99 ENADIDEAIETFLTKNVGGAPIVNDE-NQLISLITERDVIRALLDKID-------ENEVIDD----YITR-DVIVATPGE 165 (280)
T ss_dssp TTCBHHHHHHHHHHTTCSEEEEECTT-CBEEEEEEHHHHHHHHGGGSC-------TTCBSGG----GCBC-SCCCBCTTC
T ss_pred CCCCHHHHHHHHHhCCCCEEEEEcCC-CEEEEEEEHHHHHHHHhhcCC-------CCCCHHH----HhCC-CCeEECCCC
Confidence 99999999999999999999999987 899999999999998865421 2347888 7876 889999999
Q ss_pred cHHHHHHHHHHcCCceEeEEeCCCCeEEEEEeHHHHHHHhcCCcccc--------ccccCcHHHHhcccCCCCCCCCCCC
Q 013669 296 LILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFS--------NFRQLTVRDFMNAVVPTTPDSGKVN 367 (438)
Q Consensus 296 ~l~~a~~~m~~~~~~~lpVvd~~~~~lvGiIs~~Dl~~~l~~~~~~~--------~~~~~~v~~~m~~~~~~~~~~~~~~ 367 (438)
++.++++.|.+++++++||++ +|+++|+||.+|++..+.....+. .....++.++|..
T Consensus 166 ~l~~~~~~~~~~~~~~~~Vv~--~~~~~Givt~~dl~~~~~~~~~~~~~~~~~~~~~~~~~v~~~m~~------------ 231 (280)
T 3kh5_A 166 RLKDVARTMVRNGFRRLPVVS--EGRLVGIITSTDFIKLLGSDWAFNHMQTGNVREITNVRMEEIMKR------------ 231 (280)
T ss_dssp BHHHHHHHHHHHTCSEEEEEE--TTEEEEEEEHHHHHHHHTSHHHHHHHHSCCTHHHHHCBHHHHSBS------------
T ss_pred cHHHHHHHHHHcCCCEEEEEE--CCEEEEEEEHHHHHHHHhhhhhhhhhcccchhhhhCCcHHHHhcC------------
Confidence 999999999999999999995 799999999999999876432111 1245689999985
Q ss_pred CCeEeCCCCCHHHHHHHHHhCCCCEEEEEeCCCCeEEEEEeHHHHHHHh
Q 013669 368 PPITCKLESTLGSVIHSLASKSVHRIYVVAGEEAEVVGVITLRDVISCF 416 (438)
Q Consensus 368 ~~~~v~~~~tL~ea~~~m~~~~i~~l~VVd~~g~~lvGvIT~~DIl~~l 416 (438)
+++++++++++.+|++.|.+++++++||+|++| +++|+||.+||++++
T Consensus 232 ~~~~v~~~~~l~~a~~~m~~~~~~~l~Vvd~~g-~~~Givt~~dil~~l 279 (280)
T 3kh5_A 232 DVITAKEGDKLKKIAEIMVTNDIGALPVVDENL-RIKGIITEKDVLKYF 279 (280)
T ss_dssp SCCCBCTTCBHHHHHHHHHHHTCCEEEEECTTC-BEEEEEEHHHHGGGG
T ss_pred CCEEECCCCCHHHHHHHHHHCCCCEEEEECCCC-eEEEEEeHHHHHHhh
Confidence 889999999999999999999999999999987 999999999999876
|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 438 | ||||
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 6e-17 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 2e-08 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 2e-15 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 6e-08 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 4e-12 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 1e-11 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 3e-10 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 4e-10 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 2e-06 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 2e-09 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 3e-09 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 3e-09 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 4e-09 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 9e-09 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 2e-08 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 3e-08 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 2e-05 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 3e-08 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 2e-07 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 2e-07 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 6e-07 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 8e-07 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 1e-06 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 2e-06 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 1e-06 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 4e-06 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 4e-06 | |
| d1yava3 | 132 | d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac | 1e-05 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 1e-04 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 2e-04 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 0.003 |
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 75.6 bits (185), Expect = 6e-17
Identities = 19/129 (14%), Positives = 55/129 (42%)
Query: 285 SDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNF 344
S +++ ++ + +AF + N + P+ + +++ VG ++I D ++L + +
Sbjct: 22 SSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALV 81
Query: 345 RQLTVRDFMNAVVPTTPDSGKVNPPITCKLESTLGSVIHSLASKSVHRIYVVAGEEAEVV 404
+ + + P + ++L + SL +HR+ V+ E +
Sbjct: 82 QIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTL 141
Query: 405 GVITLRDVI 413
++T + ++
Sbjct: 142 YILTHKRIL 150
|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 438 | |||
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.81 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.8 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.8 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.8 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.8 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.79 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.79 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.78 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.78 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.77 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.77 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.77 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.77 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.77 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.76 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.76 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.75 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.75 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.75 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.75 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.75 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.75 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.74 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.74 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.74 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.73 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.73 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.73 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.73 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.72 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.71 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.71 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.71 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.69 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.68 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.68 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.68 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.67 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.66 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.66 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.66 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.65 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.65 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.65 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.65 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.65 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.64 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.64 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.61 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.6 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.59 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.58 |
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein ST2348 species: Sulfolobus tokodaii [TaxId: 111955]
Probab=99.81 E-value=1.8e-19 Score=149.47 Aligned_cols=124 Identities=23% Similarity=0.388 Sum_probs=111.9
Q ss_pred ccCCccccccCCCCCCCceEEcCCCcHHHHHHHHHHcCCceEeEEeCCCCeEEEEEeHHHHHHHhcCCccccccccCcHH
Q 013669 271 ASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFRQLTVR 350 (438)
Q Consensus 271 ~~~~v~~l~l~~m~~~~vv~v~~~~~l~~a~~~m~~~~~~~lpVvd~~~~~lvGiIs~~Dl~~~l~~~~~~~~~~~~~v~ 350 (438)
.+..|++ +|++ +++++.+++++.+|+++|.+++++++||++ +++++|++|.+|+++.+.+... ...++.
T Consensus 2 ~~~~V~d----~m~~-~~v~v~~~~tl~~a~~~m~~~~~~~~pV~d--~~~~~Givt~~dl~~~~~~~~~----~~~~v~ 70 (127)
T d2ef7a1 2 EEEIVKE----YMKT-QVISVTKDAKLNDIAKVMTEKNIGSVIVVD--GNKPVGIITERDIVKAIGKGKS----LETKAE 70 (127)
T ss_dssp CCCBGGG----TSBC-SCCEEETTCBHHHHHHHHHHHTCSEEEEEE--TTEEEEEEEHHHHHHHHHTTCC----TTCBGG
T ss_pred CccCHHH----hCCC-CCeEECCcCcHHHHHHHHHHcCCceEEeec--ccchhhhcchhHHHHHHHhhcc----ccchhh
Confidence 3457888 8987 899999999999999999999999999998 6899999999999998875332 356899
Q ss_pred HHhcccCCCCCCCCCCCCCeEeCCCCCHHHHHHHHHhCCCCEEEEEeCCCCeEEEEEeHHHHHHHhhc
Q 013669 351 DFMNAVVPTTPDSGKVNPPITCKLESTLGSVIHSLASKSVHRIYVVAGEEAEVVGVITLRDVISCFIF 418 (438)
Q Consensus 351 ~~m~~~~~~~~~~~~~~~~~~v~~~~tL~ea~~~m~~~~i~~l~VVd~~g~~lvGvIT~~DIl~~l~~ 418 (438)
++|.+ +++++++++++.+|++.|.+++++++||+|++| +++|+||..||++++..
T Consensus 71 ~~~~~------------~~~~v~~~~~l~~~~~~m~~~~~~~l~Vvd~~~-~lvGiit~~Dll~~i~~ 125 (127)
T d2ef7a1 71 EFMTA------------SLITIREDSPITGALALMRQFNIRHLPVVDDKG-NLKGIISIRDITRAIDD 125 (127)
T ss_dssp GTSEE------------CCCCEETTSBHHHHHHHHHHHTCSEEEEECTTS-CEEEEEEHHHHHHHHHH
T ss_pred hhhhh------------hccccccccchhHHHHHHHHcCceEEEEEeCCC-eEEEEEEHHHHHHHHHh
Confidence 99986 889999999999999999999999999999998 99999999999998864
|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|