Citrus Sinensis ID: 013706


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MQMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRLGI
ccccccHHHHHHHccccEEEHHHcccccccccccccccccccccHHHHHHcccHHHHHHHHHccccHHHHHcccccHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHHHHHccEEEEEcccccccccccccccHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHcccccccccccEEcccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHccccccHHHHccccHHHHHHHHHHHHHccc
ccccccccEEEcccccHHHHHHHHccccccHccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcHHHHcccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccHHHHHHccHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccccccEEEEEcHHccHHEccccHHHHHHHHHHHcccEEEEHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHccccccHccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHccc
mqmaqtplhvsagYNKAEIVKSLlewpgndkveLEAQnmygetplhmaaKNGCNEAAKLLLAHGAFIeakanngmtplHLSVWYSIRSEDYATVKTLLEYNadcsakdnegktpldhlsngpgsAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGlkvgarrpphmaflgnpgtgkTMVARILGRLLYMVGilptdrvtevqrtdlvgefvghtgpktRRRIKEaeggilfvdeayrlipmqkaddkdYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTkffhfndfnSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRRemngglvdpmlVNARENldlrlsfdcldtdeLRTITLEDLEAGLKLLLRLGI
mqmaqtplhvsagyNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSakdnegktpldhlsngpGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALglkvgarrpphmaflgnpgtgkTMVARILGRLLYMVGILPTDrvtevqrtdlvgefvghtgpktrrrikeaeggilFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRremngglvdpmlVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRLGI
MQMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITledleaglklllrlgI
***********AGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADC*************************LLLW***************************LSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIE*************GLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRL**
**MAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSN******************RKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGL*V*ARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPM******DYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRL**
MQMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRLGI
***AQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRKRRAL**CSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRLGI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGPGSAKLRELLLWHSEEQRxxxxxxxxxxxxxxxxxxxxxxxxxxxxHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLRLGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query438 2.2.26 [Sep-21-2011]
O22034286 Protein cfxQ homolog OS=C N/A no 0.452 0.692 0.408 5e-37
O22025293 Protein cfxQ homolog OS=C N/A no 0.452 0.675 0.403 6e-37
P49826291 Protein cfxQ homolog OS=O N/A no 0.442 0.666 0.409 2e-35
P51228301 Protein cfxQ homolog OS=P N/A no 0.452 0.657 0.412 2e-35
Q9TLY2301 Protein cfxQ homolog OS=C N/A no 0.452 0.657 0.393 1e-34
P95648309 Protein CbbX OS=Rhodobact yes no 0.621 0.880 0.350 2e-34
Q9MS99305 Protein cfxQ homolog OS=G N/A no 0.436 0.626 0.406 3e-34
Q1XDQ9300 Protein cfxQ homolog OS=P N/A no 0.452 0.66 0.398 5e-34
P27643322 Stage V sporulation prote yes no 0.426 0.580 0.388 9e-34
Q04540317 Protein CbxX, plasmid OS= yes no 0.415 0.574 0.416 1e-33
>sp|O22034|CFXQ2_CYACA Protein cfxQ homolog OS=Cyanidium caldarium GN=cfxQ PE=3 SV=1 Back     alignment and function desciption
 Score =  155 bits (392), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 85/208 (40%), Positives = 129/208 (62%), Gaps = 10/208 (4%)

Query: 148 SETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPP-HMAFLG 206
           ++ +  +D+L+ EL   +GL  +K ++R+ A  +L+D  R+ LGL   +  P  HM+F G
Sbjct: 12  TQIQQVLDDLDREL---IGLQAVKTRIREIAALLLVDRLRQKLGL--SSSNPGLHMSFTG 66

Query: 207 NPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGIL 266
           +PGTGKT VA  +  +LY +G +    +  V R DLVG+++GHT PKT++ +K A GG+L
Sbjct: 67  SPGTGKTTVATKMADILYRLGYIKKGHLITVTRDDLVGQYIGHTAPKTKQVLKNAMGGVL 126

Query: 267 FVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGK--VVVIFAGYSEPMKRVIASNEGFC 324
           F+DEAY L   +  +++DYG EA+E ++ VM+  +  +V+IFAGY E M R  ASN G  
Sbjct: 127 FIDEAYYL--YRPDNERDYGAEAIEILLQVMENQRDDLVIIFAGYKEKMDRFYASNPGLS 184

Query: 325 RRVTKFFHFNDFNSEELAKILHIKMNNQ 352
            RV    +F D+  EEL  I  I +  Q
Sbjct: 185 SRVANHVNFPDYTPEELLMIGKIMLQEQ 212




Necessary for the expression of RuBisCO.
Cyanidium caldarium (taxid: 2771)
>sp|O22025|CFXQ_CYAME Protein cfxQ homolog OS=Cyanidioschyzon merolae GN=cfxQ PE=3 SV=2 Back     alignment and function description
>sp|P49826|CFXQ_ODOSI Protein cfxQ homolog OS=Odontella sinensis GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|P51228|CFXQ_PORPU Protein cfxQ homolog OS=Porphyra purpurea GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|Q9TLY2|CFXQ1_CYACA Protein cfxQ homolog OS=Cyanidium caldarium GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|P95648|CBBX_RHOSH Protein CbbX OS=Rhodobacter sphaeroides GN=cbbX PE=1 SV=1 Back     alignment and function description
>sp|Q9MS99|CFXQ_GALSU Protein cfxQ homolog OS=Galdieria sulphuraria GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|Q1XDQ9|CFXQ_PORYE Protein cfxQ homolog OS=Porphyra yezoensis GN=cfxQ PE=3 SV=1 Back     alignment and function description
>sp|P27643|SP5K_BACSU Stage V sporulation protein K OS=Bacillus subtilis (strain 168) GN=spoVK PE=2 SV=3 Back     alignment and function description
>sp|Q04540|CBXXP_CUPNH Protein CbxX, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbxXP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
255546479481 Protein cbxX, chromosomal, putative [Ric 0.984 0.896 0.870 0.0
225445236484 PREDICTED: caseinolytic peptidase B prot 0.984 0.890 0.853 0.0
356531267484 PREDICTED: protein CbxX, chromosomal-lik 0.984 0.890 0.837 0.0
356520543480 PREDICTED: protein CbxX, chromosomal-lik 0.984 0.897 0.842 0.0
224119764478 predicted protein [Populus trichocarpa] 0.984 0.901 0.844 0.0
357500765479 Ankyrin repeat domain-containing protein 0.984 0.899 0.837 0.0
224143544477 predicted protein [Populus trichocarpa] 0.981 0.901 0.832 0.0
449459838479 PREDICTED: ESX-1 secretion system protei 0.984 0.899 0.830 0.0
9294047468 unnamed protein product [Arabidopsis tha 0.984 0.920 0.800 0.0
18404228481 AAA-type ATPase family protein / ankyrin 0.984 0.896 0.800 0.0
>gi|255546479|ref|XP_002514299.1| Protein cbxX, chromosomal, putative [Ricinus communis] gi|223546755|gb|EEF48253.1| Protein cbxX, chromosomal, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/431 (87%), Positives = 407/431 (94%)

Query: 3   MAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLA 62
           MAQTPLHVSAG N+AEIVK+LLEW G +KVELEA+NMYGETPLHMAAKNGCNEAA+LLLA
Sbjct: 49  MAQTPLHVSAGNNRAEIVKTLLEWQGPEKVELEAKNMYGETPLHMAAKNGCNEAARLLLA 108

Query: 63  HGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGP 122
           HGAF+E+KANNGMTPLHL+VWYSIRS+D++TVKTLLEYNADCSAKDNEG TP++HLS GP
Sbjct: 109 HGAFVESKANNGMTPLHLAVWYSIRSDDFSTVKTLLEYNADCSAKDNEGMTPMNHLSRGP 168

Query: 123 GSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGML 182
           GS KLR+LL WH +EQRKRRALEACSETKAKM+ELEN LSNIVGLHELKIQLRKWAKGML
Sbjct: 169 GSEKLRQLLQWHIDEQRKRRALEACSETKAKMEELENALSNIVGLHELKIQLRKWAKGML 228

Query: 183 LDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDL 242
           LDERR ALGLKVG RRPPHMAFLGNPGTGKTMVARILGRLL++VGILPTDRVTEVQRTDL
Sbjct: 229 LDERRMALGLKVGVRRPPHMAFLGNPGTGKTMVARILGRLLHLVGILPTDRVTEVQRTDL 288

Query: 243 VGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKV 302
           VGEFVGHTGPKTR++IKEAEGGILFVDEAYRLIPMQKADDKDYG+EALEEIMSVMD GKV
Sbjct: 289 VGEFVGHTGPKTRKKIKEAEGGILFVDEAYRLIPMQKADDKDYGLEALEEIMSVMDSGKV 348

Query: 303 VVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFK 362
           VVIFAGYS+PMKRVIASNEGFCRRVTKFF F+DF  E+LAKI+HIKMNNQ ED LLYGF 
Sbjct: 349 VVIFAGYSKPMKRVIASNEGFCRRVTKFFQFDDFTPEDLAKIIHIKMNNQEEDGLLYGFN 408

Query: 363 LHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTIT 422
           LHS CSM+AIA LIE++TTEKQR+EMNGGL D MLVNARENLD RL FDC+DT+ELRTIT
Sbjct: 409 LHSKCSMEAIAKLIERKTTEKQRKEMNGGLADTMLVNARENLDSRLDFDCIDTEELRTIT 468

Query: 423 LEDLEAGLKLL 433
           LEDLEAGL+LL
Sbjct: 469 LEDLEAGLRLL 479




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225445236|ref|XP_002280965.1| PREDICTED: caseinolytic peptidase B protein homolog [Vitis vinifera] gi|297738825|emb|CBI28070.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356531267|ref|XP_003534199.1| PREDICTED: protein CbxX, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|356520543|ref|XP_003528921.1| PREDICTED: protein CbxX, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|224119764|ref|XP_002331155.1| predicted protein [Populus trichocarpa] gi|222873238|gb|EEF10369.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357500765|ref|XP_003620671.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|355495686|gb|AES76889.1| Ankyrin repeat domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224143544|ref|XP_002324992.1| predicted protein [Populus trichocarpa] gi|222866426|gb|EEF03557.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459838|ref|XP_004147653.1| PREDICTED: ESX-1 secretion system protein EccA1-like [Cucumis sativus] gi|449498823|ref|XP_004160644.1| PREDICTED: ESX-1 secretion system protein EccA1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|9294047|dbj|BAB02004.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18404228|ref|NP_566752.1| AAA-type ATPase family protein / ankyrin repeat family protein [Arabidopsis thaliana] gi|13507553|gb|AAK28639.1|AF360342_1 putative rubisco expression protein [Arabidopsis thaliana] gi|15293291|gb|AAK93756.1| putative rubisco expression protein [Arabidopsis thaliana] gi|332643395|gb|AEE76916.1| AAA-type ATPase family protein / ankyrin repeat family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
TAIR|locus:2091702481 AT3G24530 [Arabidopsis thalian 0.956 0.871 0.804 3.3e-182
UNIPROTKB|Q81WX4318 spoVK "Stage V sporulation pro 0.440 0.606 0.386 3.2e-33
TIGR_CMR|BA_3839318 BA_3839 "stage V sporulation p 0.440 0.606 0.386 3.2e-33
UNIPROTKB|O53687631 eccA3 "ESX-3 secretion system 0.589 0.408 0.343 2.9e-32
UNIPROTKB|O69733573 eccA1 "ESX-1 secretion system 0.595 0.455 0.332 1.8e-31
TIGR_CMR|CHY_1391296 CHY_1391 "stage V sporulation 0.422 0.625 0.397 1.6e-29
ASPGD|ASPL0000069352 2310 AN7246 [Emericella nidulans (t 0.477 0.090 0.292 7e-18
UNIPROTKB|P63744610 eccA5 "ESX-5 secretion system 0.504 0.362 0.276 1.5e-15
UNIPROTKB|G4NES4703 MGG_11680 "AAA family ATPase" 0.5 0.311 0.293 5.9e-14
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.287 0.065 0.385 5.7e-11
TAIR|locus:2091702 AT3G24530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1768 (627.4 bits), Expect = 3.3e-182, P = 3.3e-182
 Identities = 337/419 (80%), Positives = 377/419 (89%)

Query:     3 MAQTPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLA 62
             M  TPLHVSAG    +IVK LL W G+DKVELEA N YGETPLHMAAKNGCNEAAKLLL 
Sbjct:    49 MYHTPLHVSAGNGNVDIVKYLLAWTGSDKVELEAMNTYGETPLHMAAKNGCNEAAKLLLE 108

Query:    63 HGAFIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDHLSNGP 122
              GAFIEAKA+NGMTPLHL+VWYSI +++ +TVKTLL++NADCSAKDNEG TPLDHL  G 
Sbjct:   109 SGAFIEAKASNGMTPLHLAVWYSITAKEISTVKTLLDHNADCSAKDNEGMTPLDHLPQGQ 168

Query:   123 GSAKLRELLLWHSEEQRKRRALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGML 182
             GS KLRELL W  +EQRKR ALE C +TKAKM+ LE+ELSNIVGL ELK QLRKWAKGML
Sbjct:   169 GSEKLRELLRWFLQEQRKRSALEQCGKTKAKMELLEDELSNIVGLSELKTQLRKWAKGML 228

Query:   183 LDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDL 242
             LDERR+ALGL +G RRPPHMAFLGNPGTGKTMVAR+LG+LL  VGILPTD+VTEVQRTDL
Sbjct:   229 LDERRRALGLNIGTRRPPHMAFLGNPGTGKTMVARVLGKLLNTVGILPTDKVTEVQRTDL 288

Query:   243 VGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGKV 302
             VGEFVGHTGPKTRR+I+EAEGGILFVDEAYRLIPMQKADDKDYG+EALEEIMSVMD GK+
Sbjct:   289 VGEFVGHTGPKTRRKIQEAEGGILFVDEAYRLIPMQKADDKDYGLEALEEIMSVMDTGKI 348

Query:   303 VVIFAGYSEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFK 362
             VVIFAGYSEPMKRVIASNEGFCRRVTKFF+F+DF+++ELA+ILHIKMNNQ ED+L YGF+
Sbjct:   349 VVIFAGYSEPMKRVIASNEGFCRRVTKFFNFSDFSAKELAQILHIKMNNQGEDTLFYGFR 408

Query:   363 LHSSCSMDAIAALIEKETTEKQRREMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTI 421
             LH SC++  IA+LIE ETTEKQR+EMNGGLVD +LVNARENLDLRLSF+C+DT+E+ TI
Sbjct:   409 LHESCTLQEIASLIEAETTEKQRKEMNGGLVDTLLVNARENLDLRLSFECVDTEEICTI 467




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0019538 "protein metabolic process" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
UNIPROTKB|Q81WX4 spoVK "Stage V sporulation protein K" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3839 BA_3839 "stage V sporulation protein K" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|O53687 eccA3 "ESX-3 secretion system protein EccA3" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|O69733 eccA1 "ESX-1 secretion system protein EccA1" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1391 CHY_1391 "stage V sporulation protein K" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ASPGD|ASPL0000069352 AN7246 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|P63744 eccA5 "ESX-5 secretion system protein EccA5" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|G4NES4 MGG_11680 "AAA family ATPase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
TIGR02881261 TIGR02881, spore_V_K, stage V sporulation protein 8e-49
CHL00181287 CHL00181, cbbX, CbbX; Provisional 1e-46
TIGR02880284 TIGR02880, cbbX_cfxQ, probable Rubsico expression 2e-46
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 2e-40
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-17
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-17
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-13
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-13
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-12
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-12
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-09
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 7e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-08
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 7e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-04
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 5e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-04
smart0024830 smart00248, ANK, ankyrin repeats 7e-04
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 8e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 0.001
TIGR02928365 TIGR02928, TIGR02928, orc1/cdc6 family replication 0.001
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.002
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.003
pfam13401124 pfam13401, AAA_22, AAA domain 0.003
pfam06309127 pfam06309, Torsin, Torsin 0.003
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 0.004
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
 Score =  166 bits (423), Expect = 8e-49
 Identities = 100/276 (36%), Positives = 147/276 (53%), Gaps = 21/276 (7%)

Query: 157 LENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVA 216
           +E ELS +VGL E+K  +++    + ++E+RK  GLK   ++  HM F GNPGTGKT VA
Sbjct: 1   VERELSRMVGLDEVKALIKEIYAWIQINEKRKEEGLKTS-KQVLHMIFKGNPGTGKTTVA 59

Query: 217 RILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEAEGGILFVDEAYRLIP 276
           RILG+L   + +L    + EV+R DLVGE++GHT  KTR  IK+A GG+LF+DEAY L  
Sbjct: 60  RILGKLFKEMNVLSKGHLIEVERADLVGEYIGHTAQKTREVIKKALGGVLFIDEAYSL-- 117

Query: 277 MQKADDKDYGIEALEEIMSVMDG--GKVVVIFAGYSEPMKRVIASNEGFCRRVTKFFHFN 334
             +  +KD+G EA++ ++  M+    + V+I AGYS+ M   ++ N G   R      F 
Sbjct: 118 -ARGGEKDFGKEAIDTLVKGMEDNRNEFVLILAGYSDEMDYFLSLNPGLRSRFPISIDFP 176

Query: 335 DFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQ--RREM-NGG 391
           D+  EEL +I   +M  + E  L          + +A   L E      Q   RE  N  
Sbjct: 177 DYTVEELMEIA-ERMVKEREYKL----------TEEAKWKLREHLYKVDQLSSREFSNAR 225

Query: 392 LVDPMLVNARENLDLR-LSFDCLDTDELRTITLEDL 426
            V  ++  A     +R L       ++L  +  EDL
Sbjct: 226 YVRNIIEKAIRRQAVRLLDKSDYSKEDLMLLKKEDL 261


Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group [Cellular processes, Sporulation and germination]. Length = 261

>gnl|CDD|177083 CHL00181, cbbX, CbbX; Provisional Back     alignment and domain information
>gnl|CDD|200217 TIGR02880, cbbX_cfxQ, probable Rubsico expression protein CbbX Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|148114 pfam06309, Torsin, Torsin Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 438
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
CHL00181287 cbbX CbbX; Provisional 100.0
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.98
CHL00195489 ycf46 Ycf46; Provisional 99.98
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.97
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.97
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.97
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.97
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.97
PRK03992389 proteasome-activating nucleotidase; Provisional 99.97
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.97
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.97
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.97
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.97
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.96
CHL00176 638 ftsH cell division protein; Validated 99.96
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.96
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.95
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.95
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.95
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.95
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.94
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.94
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.94
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.94
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.94
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.93
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.92
CHL00206 2281 ycf2 Ycf2; Provisional 99.92
KOG2028 554 consensus ATPase related to the helicase subunit o 99.89
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.88
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.88
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.87
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.87
COG2204464 AtoC Response regulator containing CheY-like recei 99.87
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.87
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.86
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.86
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.86
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.86
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.86
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.86
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.85
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.85
PRK13342 413 recombination factor protein RarA; Reviewed 99.85
COG1221403 PspF Transcriptional regulators containing an AAA- 99.84
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.84
PHA02791284 ankyrin-like protein; Provisional 99.84
PRK13341 725 recombination factor protein RarA/unknown domain f 99.84
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.84
PHA02741169 hypothetical protein; Provisional 99.84
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.83
PHA02859209 ankyrin repeat protein; Provisional 99.83
PHA02791284 ankyrin-like protein; Provisional 99.83
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.83
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.82
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.82
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.82
PRK11608326 pspF phage shock protein operon transcriptional ac 99.82
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.81
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.81
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.8
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.8
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.8
PF00004132 AAA: ATPase family associated with various cellula 99.8
PHA02875413 ankyrin repeat protein; Provisional 99.8
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.79
KOG0508 615 consensus Ankyrin repeat protein [General function 99.79
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.79
PRK15424538 propionate catabolism operon regulatory protein Pr 99.79
PHA02878477 ankyrin repeat protein; Provisional 99.79
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
PHA02878477 ankyrin repeat protein; Provisional 99.77
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.77
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.77
CHL00095 821 clpC Clp protease ATP binding subunit 99.77
PHA02874434 ankyrin repeat protein; Provisional 99.77
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.77
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.77
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.77
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.77
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.77
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.77
PRK10865 857 protein disaggregation chaperone; Provisional 99.77
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.77
PHA02875413 ankyrin repeat protein; Provisional 99.77
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.76
PLN03025319 replication factor C subunit; Provisional 99.76
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.76
KOG0510 929 consensus Ankyrin repeat protein [General function 99.76
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.76
PHA02874434 ankyrin repeat protein; Provisional 99.76
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 99.76
PHA02884300 ankyrin repeat protein; Provisional 99.76
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.75
PHA03100480 ankyrin repeat protein; Provisional 99.75
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.75
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.75
PHA02859209 ankyrin repeat protein; Provisional 99.75
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.75
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.75
PHA02946446 ankyin-like protein; Provisional 99.75
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.75
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.75
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.74
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.74
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.74
KOG0508615 consensus Ankyrin repeat protein [General function 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.74
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.74
PRK12402337 replication factor C small subunit 2; Reviewed 99.74
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.73
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.73
PHA03100480 ankyrin repeat protein; Provisional 99.73
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.73
PHA03095471 ankyrin-like protein; Provisional 99.73
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.73
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.73
PLN03192823 Voltage-dependent potassium channel; Provisional 99.73
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.73
PHA02743166 Viral ankyrin protein; Provisional 99.72
PHA03095471 ankyrin-like protein; Provisional 99.72
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.72
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.72
PHA02798489 ankyrin-like protein; Provisional 99.72
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.72
PRK04195 482 replication factor C large subunit; Provisional 99.72
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.72
PHA02795437 ankyrin-like protein; Provisional 99.71
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.71
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.71
KOG0514452 consensus Ankyrin repeat protein [General function 99.71
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.71
KOG0510 929 consensus Ankyrin repeat protein [General function 99.71
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.7
PHA02876682 ankyrin repeat protein; Provisional 99.7
PHA02946446 ankyin-like protein; Provisional 99.7
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.69
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.69
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.69
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.68
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.68
PHA02989494 ankyrin repeat protein; Provisional 99.68
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.68
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.68
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.68
PHA02989494 ankyrin repeat protein; Provisional 99.68
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.68
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.68
PHA02798489 ankyrin-like protein; Provisional 99.68
PHA02876682 ankyrin repeat protein; Provisional 99.67
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.67
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.67
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.67
PHA02544316 44 clamp loader, small subunit; Provisional 99.67
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.67
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.67
PHA02730 672 ankyrin-like protein; Provisional 99.67
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.66
CHL00095821 clpC Clp protease ATP binding subunit 99.66
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK08084235 DNA replication initiation factor; Provisional 99.66
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.66
PHA02730672 ankyrin-like protein; Provisional 99.66
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.66
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.65
PRK00440319 rfc replication factor C small subunit; Reviewed 99.65
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.65
PRK06893229 DNA replication initiation factor; Validated 99.65
PHA02795437 ankyrin-like protein; Provisional 99.65
PHA02736154 Viral ankyrin protein; Provisional 99.65
PRK10865857 protein disaggregation chaperone; Provisional 99.65
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.64
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.64
PLN03192823 Voltage-dependent potassium channel; Provisional 99.64
PHA02917 661 ankyrin-like protein; Provisional 99.64
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.63
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.63
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.63
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.62
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.62
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.62
PHA02917 661 ankyrin-like protein; Provisional 99.62
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.62
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.62
PRK12422445 chromosomal replication initiation protein; Provis 99.61
PRK00149450 dnaA chromosomal replication initiation protein; R 99.61
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.61
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.61
PRK15115444 response regulator GlrR; Provisional 99.61
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.61
PHA02741169 hypothetical protein; Provisional 99.6
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.6
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.6
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.59
PHA02884300 ankyrin repeat protein; Provisional 99.59
PRK08727233 hypothetical protein; Validated 99.59
PRK14088440 dnaA chromosomal replication initiation protein; P 99.59
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.59
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.58
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.57
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.56
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.56
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.56
PRK05642234 DNA replication initiation factor; Validated 99.55
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.55
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.55
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.55
PRK09087226 hypothetical protein; Validated 99.55
PRK06620214 hypothetical protein; Validated 99.54
PRK14087450 dnaA chromosomal replication initiation protein; P 99.54
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.53
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.53
PRK14086617 dnaA chromosomal replication initiation protein; P 99.53
PHA02792631 ankyrin-like protein; Provisional 99.53
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.52
smart00350509 MCM minichromosome maintenance proteins. 99.52
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.51
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.51
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.51
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
KOG0514452 consensus Ankyrin repeat protein [General function 99.48
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.48
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.47
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 99.46
PRK13531 498 regulatory ATPase RavA; Provisional 99.46
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.45
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
PRK09862506 putative ATP-dependent protease; Provisional 99.45
PRK09112351 DNA polymerase III subunit delta'; Validated 99.44
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.43
PHA02792631 ankyrin-like protein; Provisional 99.42
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.42
PRK13765 637 ATP-dependent protease Lon; Provisional 99.41
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
PHA02244383 ATPase-like protein 99.41
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.4
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.4
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.4
PRK07471365 DNA polymerase III subunit delta'; Validated 99.39
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.39
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.39
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.39
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.38
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 99.38
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.38
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.37
PRK07399314 DNA polymerase III subunit delta'; Validated 99.37
PRK05564313 DNA polymerase III subunit delta'; Validated 99.37
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.37
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.36
PF07726131 AAA_3: ATPase family associated with various cellu 99.36
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.34
PRK04132846 replication factor C small subunit; Provisional 99.34
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.33
COG0714329 MoxR-like ATPases [General function prediction onl 99.33
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.33
COG0593408 DnaA ATPase involved in DNA replication initiation 99.32
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.31
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.29
PRK08058329 DNA polymerase III subunit delta'; Validated 99.29
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.29
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.26
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.26
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.25
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.24
KOG1514 767 consensus Origin recognition complex, subunit 1, a 99.23
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.23
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.23
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 99.2
PRK05707328 DNA polymerase III subunit delta'; Validated 99.19
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.17
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.17
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.14
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.13
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.13
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 99.13
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.12
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.1
smart00382148 AAA ATPases associated with a variety of cellular 99.09
PRK08116268 hypothetical protein; Validated 99.06
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.06
PRK08769319 DNA polymerase III subunit delta'; Validated 99.05
PRK06964342 DNA polymerase III subunit delta'; Validated 99.04
PRK06871325 DNA polymerase III subunit delta'; Validated 98.98
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.97
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.97
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.95
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 98.94
PRK08699325 DNA polymerase III subunit delta'; Validated 98.94
PRK06090319 DNA polymerase III subunit delta'; Validated 98.93
PF13173128 AAA_14: AAA domain 98.93
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.93
PRK07993334 DNA polymerase III subunit delta'; Validated 98.92
PRK07952244 DNA replication protein DnaC; Validated 98.92
PRK12377248 putative replication protein; Provisional 98.89
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.87
PRK08181269 transposase; Validated 98.87
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 98.86
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.84
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.83
PRK06835329 DNA replication protein DnaC; Validated 98.8
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 98.79
PF1360630 Ank_3: Ankyrin repeat 98.79
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.78
KOG2170344 consensus ATPase of the AAA+ superfamily [General 98.75
PRK06526254 transposase; Provisional 98.74
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.74
PF05729166 NACHT: NACHT domain 98.73
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.73
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.69
PF1360630 Ank_3: Ankyrin repeat 98.67
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.67
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.67
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.66
PRK09183259 transposase/IS protein; Provisional 98.64
PRK05917290 DNA polymerase III subunit delta'; Validated 98.62
PRK06921266 hypothetical protein; Provisional 98.61
KOG0522 560 consensus Ankyrin repeat protein [General function 98.6
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.6
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.6
PRK08939306 primosomal protein DnaI; Reviewed 98.59
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.56
PRK07276290 DNA polymerase III subunit delta'; Validated 98.51
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.5
PRK14700 300 recombination factor protein RarA; Provisional 98.5
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.44
PRK05818261 DNA polymerase III subunit delta'; Validated 98.41
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.4
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.38
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.37
KOG0511516 consensus Ankyrin repeat protein [General function 98.35
PHA00729226 NTP-binding motif containing protein 98.35
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.34
PRK07132299 DNA polymerase III subunit delta'; Validated 98.34
KOG0482 721 consensus DNA replication licensing factor, MCM7 c 98.34
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.34
KOG0481729 consensus DNA replication licensing factor, MCM5 c 98.33
KOG2228408 consensus Origin recognition complex, subunit 4 [R 98.29
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.27
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.25
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.25
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.22
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.17
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.16
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 98.14
KOG2384223 consensus Major histocompatibility complex protein 98.13
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.12
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.12
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.12
KOG0511516 consensus Ankyrin repeat protein [General function 98.11
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.09
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 98.09
PRK08118167 topology modulation protein; Reviewed 98.07
KOG0522 560 consensus Ankyrin repeat protein [General function 98.06
PRK00771 437 signal recognition particle protein Srp54; Provisi 98.06
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 98.03
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.02
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 98.01
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.99
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.99
KOG0477 854 consensus DNA replication licensing factor, MCM2 c 97.98
PRK13695174 putative NTPase; Provisional 97.96
PRK10536262 hypothetical protein; Provisional 97.95
PRK04296190 thymidine kinase; Provisional 97.94
PHA02624647 large T antigen; Provisional 97.92
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.92
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.91
PRK07261171 topology modulation protein; Provisional 97.87
PF14516331 AAA_35: AAA-like domain 97.86
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.85
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.85
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.84
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.84
PRK15455 644 PrkA family serine protein kinase; Provisional 97.82
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.81
KOG2384223 consensus Major histocompatibility complex protein 97.8
PHA02774613 E1; Provisional 97.8
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.78
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 97.78
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.77
PRK11823 446 DNA repair protein RadA; Provisional 97.76
KOG0520975 consensus Uncharacterized conserved protein, conta 97.76
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.75
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.75
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.75
PRK14532188 adenylate kinase; Provisional 97.71
PTZ00088229 adenylate kinase 1; Provisional 97.71
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.7
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.7
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.69
PRK09376416 rho transcription termination factor Rho; Provisio 97.68
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 97.67
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 97.66
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.66
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 97.65
PRK00131175 aroK shikimate kinase; Reviewed 97.64
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.64
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.64
PLN02674244 adenylate kinase 97.63
PLN02200234 adenylate kinase family protein 97.63
PRK10867433 signal recognition particle protein; Provisional 97.6
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.6
PRK06581263 DNA polymerase III subunit delta'; Validated 97.6
cd01128249 rho_factor Transcription termination factor rho is 97.59
PRK13949169 shikimate kinase; Provisional 97.58
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.56
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.56
PRK05973237 replicative DNA helicase; Provisional 97.55
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.54
PF1324576 AAA_19: Part of AAA domain 97.53
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.52
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.52
PRK06067234 flagellar accessory protein FlaH; Validated 97.52
PRK06217183 hypothetical protein; Validated 97.51
PRK00625173 shikimate kinase; Provisional 97.5
KOG0520975 consensus Uncharacterized conserved protein, conta 97.5
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.5
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.49
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.47
PRK06547172 hypothetical protein; Provisional 97.47
PRK14529223 adenylate kinase; Provisional 97.46
PRK13947171 shikimate kinase; Provisional 97.45
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.45
PRK13808333 adenylate kinase; Provisional 97.45
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.45
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.44
PRK03839180 putative kinase; Provisional 97.43
PRK06762166 hypothetical protein; Provisional 97.42
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.41
PLN02459261 probable adenylate kinase 97.41
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.41
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.4
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 97.39
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.39
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.39
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.38
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.38
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 97.37
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.37
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.36
PRK13948182 shikimate kinase; Provisional 97.36
PRK04040188 adenylate kinase; Provisional 97.34
TIGR00959428 ffh signal recognition particle protein. This mode 97.34
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.33
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.33
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 97.33
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.32
COG1485367 Predicted ATPase [General function prediction only 97.31
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.29
smart00487201 DEXDc DEAD-like helicases superfamily. 97.29
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.29
PRK08233182 hypothetical protein; Provisional 97.28
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.28
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.27
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.26
PRK00279215 adk adenylate kinase; Reviewed 97.25
TIGR00767415 rho transcription termination factor Rho. Members 97.25
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.24
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.24
PTZ00202550 tuzin; Provisional 97.24
PRK14531183 adenylate kinase; Provisional 97.23
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.22
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.22
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.22
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.21
PRK14530215 adenylate kinase; Provisional 97.2
PRK14974336 cell division protein FtsY; Provisional 97.19
COG4619223 ABC-type uncharacterized transport system, ATPase 97.18
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 97.18
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.18
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.17
COG1855 604 ATPase (PilT family) [General function prediction 97.17
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.1e-42  Score=311.06  Aligned_cols=236  Identities=22%  Similarity=0.322  Sum_probs=204.9

Q ss_pred             HHHHhhhcChHHHHHHHHHHHHHhhhHHHHHhcCCCCCCCCCCceEEecCCCCCHHHHHHHHHHHHHHcCCcCCCCEEEe
Q 013706          158 ENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEV  237 (438)
Q Consensus       158 ~~~l~~i~G~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~GppGtGKT~la~~la~~l~~~~~~~~~~~~~~  237 (438)
                      ...+++++|.+..+++|++.   +..|..+++++..++..+|++||||||||||||++||++|+....       .|+.+
T Consensus       147 dvtY~dIGGL~~Qi~EirE~---VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~A-------tFIrv  216 (406)
T COG1222         147 DVTYEDIGGLDEQIQEIREV---VELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDA-------TFIRV  216 (406)
T ss_pred             CCChhhccCHHHHHHHHHHH---hcccccCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCc-------eEEEe
Confidence            45799999999777777765   888999999999999999999999999999999999999998776       99999


Q ss_pred             ecccccccccccchHHHHHHHHHcc---CcEEEEeCcccccCCCCCCC---chhHHHHHHHHHhhccC----CCEEEEEe
Q 013706          238 QRTDLVGEFVGHTGPKTRRRIKEAE---GGILFVDEAYRLIPMQKADD---KDYGIEALEEIMSVMDG----GKVVVIFA  307 (438)
Q Consensus       238 ~~~~~~~~~~g~~~~~~~~~~~~a~---~~il~iDEid~l~~~~~~~~---~~~~~~~~~~ll~~~~~----~~v~vi~~  307 (438)
                      .+++++.+|+|+..+.++++|..|+   +|||||||||++..+|..++   ....++++-+||.+||+    ++|-||+|
T Consensus       217 vgSElVqKYiGEGaRlVRelF~lArekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~A  296 (406)
T COG1222         217 VGSELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVIMA  296 (406)
T ss_pred             ccHHHHHHHhccchHHHHHHHHHHhhcCCeEEEEechhhhhcccccCCCCchHHHHHHHHHHHHhccCCCCCCCeEEEEe
Confidence            9999999999999999999999885   59999999999999886543   33455666777888887    78999999


Q ss_pred             cCChhHHHHhhhCcCccC--CCCcceeCCCCCHHHHHHHHHHHHhccccccccccccccccccHHHHHHHHHHHhhHhhh
Q 013706          308 GYSEPMKRVIASNEGFCR--RVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQR  385 (438)
Q Consensus       308 ~~~~~~~~~~~~~p~l~~--R~~~~i~~~~~~~~e~~~il~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  385 (438)
                      ||+.++.     ||||+|  |||++|+||.|+.+.|.+||+.+.++.         .+.++++.+.++..+.+       
T Consensus       297 TNR~D~L-----DPALLRPGR~DRkIEfplPd~~gR~~Il~IHtrkM---------~l~~dvd~e~la~~~~g-------  355 (406)
T COG1222         297 TNRPDIL-----DPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKM---------NLADDVDLELLARLTEG-------  355 (406)
T ss_pred             cCCcccc-----ChhhcCCCcccceeecCCCCHHHHHHHHHHHhhhc---------cCccCcCHHHHHHhcCC-------
Confidence            8887765     999999  999999999999999999999999876         56788888888877774       


Q ss_pred             ccccccchHHHHHHHHHHhhccccCCCCChhhhhhccHHHHHHHHHHHHh
Q 013706          386 REMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLR  435 (438)
Q Consensus       386 ~~~n~~~l~~~~~~a~~~~~~r~~~~~~~~~~~~~i~~~d~~~a~~~~~~  435 (438)
                        .+|+++++++..|...|.         ++....||++||.+|++++..
T Consensus       356 --~sGAdlkaictEAGm~Ai---------R~~R~~Vt~~DF~~Av~KV~~  394 (406)
T COG1222         356 --FSGADLKAICTEAGMFAI---------RERRDEVTMEDFLKAVEKVVK  394 (406)
T ss_pred             --CchHHHHHHHHHHhHHHH---------HhccCeecHHHHHHHHHHHHh
Confidence              558888999998888762         345578999999999999865



>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
3syl_A309 Crystal Structure Of The Aaa+ Protein Cbbx, Native 2e-35
3zuh_A289 Negative Stain Em Map Of The Aaa Protein Cbbx, A Re 3e-35
3syk_A309 Crystal Structure Of The Aaa+ Protein Cbbx, Selenom 4e-33
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-18
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-16
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-15
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-13
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-13
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-13
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-13
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 6e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 9e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-12
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-12
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-12
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-12
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-11
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-10
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-09
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 5e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 7e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-09
1uoh_A226 Human Gankyrin Length = 226 5e-09
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-09
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-08
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-08
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-08
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 6e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-07
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-06
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 4e-06
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 4e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 4e-06
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 5e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 5e-06
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 5e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 5e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 2e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-05
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 3e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 3e-05
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 4e-05
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 5e-05
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 5e-05
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 5e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 6e-05
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 6e-05
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 6e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 7e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 1e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 4e-04
>pdb|3SYL|A Chain A, Crystal Structure Of The Aaa+ Protein Cbbx, Native Structure Length = 309 Back     alignment and structure

Iteration: 1

Score = 146 bits (369), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 86/215 (40%), Positives = 131/215 (60%), Gaps = 12/215 (5%) Query: 142 RALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPP- 200 RA S K ++EL+ EL +GL +K ++R+ A +L++ R+ LGL A P Sbjct: 14 RAEYEGSGAKEVLEELDREL---IGLKPVKDRIRETAALLLVERARQKLGL---AHETPT 67 Query: 201 -HMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIK 259 HM+F GNPGTGKT VA + LL+ +G + + V R DLVG+++GHT PKT+ +K Sbjct: 68 LHMSFTGNPGTGKTTVALKMAGLLHRLGYVRKGHLVSVTRDDLVGQYIGHTAPKTKEVLK 127 Query: 260 EAEGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMDGGK--VVVIFAGYSEPMKRVI 317 A GG+LF+DEAY L + +++DYG EA+E ++ VM+ + +VVI AGY++ M+ Sbjct: 128 RAMGGVLFIDEAYYL--YRPDNERDYGQEAIEILLQVMENNRDDLVVILAGYADRMENFF 185 Query: 318 ASNEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQ 352 SN GF R+ F D++ EEL +I +++Q Sbjct: 186 QSNPGFRSRIAHHIEFPDYSDEELFEIAGHMLDDQ 220
>pdb|3ZUH|A Chain A, Negative Stain Em Map Of The Aaa Protein Cbbx, A Red-Type Rubisco Activase From R. Sphaeroides Length = 289 Back     alignment and structure
>pdb|3SYK|A Chain A, Crystal Structure Of The Aaa+ Protein Cbbx, Selenomethionine Structure Length = 309 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 6e-59
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-33
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-31
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-20
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-30
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-26
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-31
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-26
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-26
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-29
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-30
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-30
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-30
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-30
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-29
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-30
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-30
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-30
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-30
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-30
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-29
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-24
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-26
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-29
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-26
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-29
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-26
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-26
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-25
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-29
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-27
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-29
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-23
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-29
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-29
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-28
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-28
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-27
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-27
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-29
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-25
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-28
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-24
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-28
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-26
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-25
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-26
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-25
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-25
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-24
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-13
2rfa_A232 Transient receptor potential cation channel subfa 3e-27
2rfa_A232 Transient receptor potential cation channel subfa 2e-26
2rfa_A232 Transient receptor potential cation channel subfa 4e-24
2rfa_A232 Transient receptor potential cation channel subfa 1e-21
2rfa_A232 Transient receptor potential cation channel subfa 3e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-27
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-20
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-25
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-24
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-25
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-24
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-25
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-25
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-25
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-18
2etb_A256 Transient receptor potential cation channel subfam 5e-23
2etb_A256 Transient receptor potential cation channel subfam 1e-19
2etb_A256 Transient receptor potential cation channel subfam 1e-14
2etb_A256 Transient receptor potential cation channel subfam 2e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-12
2pnn_A273 Transient receptor potential cation channel subfa 8e-21
2pnn_A273 Transient receptor potential cation channel subfa 2e-17
2pnn_A273 Transient receptor potential cation channel subfa 3e-16
2pnn_A273 Transient receptor potential cation channel subfa 4e-12
2pnn_A273 Transient receptor potential cation channel subfa 4e-11
2pnn_A273 Transient receptor potential cation channel subfa 9e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-06
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 1e-04
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 2e-04
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-04
2chg_A226 Replication factor C small subunit; DNA-binding pr 3e-04
2chq_A319 Replication factor C small subunit; DNA-binding pr 5e-04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 5e-04
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
 Score =  194 bits (494), Expect = 6e-59
 Identities = 102/293 (34%), Positives = 149/293 (50%), Gaps = 23/293 (7%)

Query: 142 RALEACSETKAKMDELENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPH 201
           RA    S  K  ++EL+ EL   +GL  +K ++R+ A  +L++  R+ LGL        H
Sbjct: 14  RAEYEGSGAKEVLEELDREL---IGLKPVKDRIRETAALLLVERARQKLGLAHE-TPTLH 69

Query: 202 MAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQRTDLVGEFVGHTGPKTRRRIKEA 261
           M+F GNPGTGKT VA  +  LL+ +G +    +  V R DLVG+++GHT PKT+  +K A
Sbjct: 70  MSFTGNPGTGKTTVALKMAGLLHRLGYVRKGHLVSVTRDDLVGQYIGHTAPKTKEVLKRA 129

Query: 262 EGGILFVDEAYRLIPMQKADDKDYGIEALEEIMSVMD--GGKVVVIFAGYSEPMKRVIAS 319
            GG+LF+DEAY L         DYG EA+E ++ VM+     +VVI AGY++ M+    S
Sbjct: 130 MGGVLFIDEAYYLYRPDNER--DYGQEAIEILLQVMENNRDDLVVILAGYADRMENFFQS 187

Query: 320 NEGFCRRVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKE 379
           N GF  R+     F D++ EEL +I    +++Q           +   + +A  AL    
Sbjct: 188 NPGFRSRIAHHIEFPDYSDEELFEIAGHMLDDQ-----------NYQMTPEAETALRAYI 236

Query: 380 TTEKQRREM-NGGLVDPMLVNARENLDLRL---SFDCLDTDELRTITLEDLEA 428
              + +    N   +   L  AR     RL   S   LD   L TI  ED+ A
Sbjct: 237 GLRRNQPHFANARSIRNALDRARLRQANRLFTASSGPLDARALSTIAEEDIRA 289


>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.98
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.98
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.97
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.97
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.96
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.96
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.96
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.96
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.96
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.96
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.95
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.95
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.95
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.95
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.93
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.92
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.92
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.92
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.91
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.91
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.9
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3pvs_A 447 Replication-associated recombination protein A; ma 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.89
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.89
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.89
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.88
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.88
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.88
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.88
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.88
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.88
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.88
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.88
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.88
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.87
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.87
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.87
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.87
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.86
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.86
2etb_A256 Transient receptor potential cation channel subfam 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.86
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.86
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.86
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.86
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.86
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.86
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.86
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.86
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.86
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.85
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.85
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.85
2rfa_A232 Transient receptor potential cation channel subfa 99.85
2pnn_A273 Transient receptor potential cation channel subfa 99.85
2rfa_A232 Transient receptor potential cation channel subfa 99.85
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.85
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.84
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.84
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.84
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.84
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.84
3hra_A201 Ankyrin repeat family protein; structural protein; 99.84
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.84
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.84
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.84
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.84
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
3hra_A201 Ankyrin repeat family protein; structural protein; 99.84
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.84
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.84
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.83
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.83
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.83
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.83
2etb_A256 Transient receptor potential cation channel subfam 99.83
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.83
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.83
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.82
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.82
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.82
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.82
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.82
2pnn_A273 Transient receptor potential cation channel subfa 99.82
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.82
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.82
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.82
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.82
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.81
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.81
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.8
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.8
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.8
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.8
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.8
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.8
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.8
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.8
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.8
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.8
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.79
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.79
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 99.79
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.79
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.79
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.79
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.79
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.79
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.78
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.78
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.78
3bos_A242 Putative DNA replication factor; P-loop containing 99.78
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.77
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 99.77
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.77
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.77
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.77
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.77
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.76
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.76
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.76
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.76
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.76
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.76
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.75
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.75
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.75
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.75
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.75
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.74
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 99.74
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.74
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.74
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.74
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.73
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.72
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 99.72
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.72
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.72
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.72
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.71
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.7
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 99.7
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.7
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.7
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.69
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.69
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.69
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.68
3co5_A143 Putative two-component system transcriptional RES 99.68
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.68
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.67
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.67
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.66
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.66
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.66
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.64
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.64
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.63
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.62
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.58
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.51
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 99.5
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.48
3f8t_A506 Predicted ATPase involved in replication control, 99.39
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.1
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.05
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.04
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.99
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.97
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 98.91
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.89
2fna_A357 Conserved hypothetical protein; structural genomic 98.88
2qgz_A308 Helicase loader, putative primosome component; str 98.79
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.76
1tue_A212 Replication protein E1; helicase, replication, E1E 98.72
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.65
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.64
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.45
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.42
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.33
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.31
2krk_A86 26S protease regulatory subunit 8; structural geno 98.28
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.19
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 98.11
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.88
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.86
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.85
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.85
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.73
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 97.72
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.71
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.71
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 97.71
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.71
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.7
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.67
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.63
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.63
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 97.63
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.6
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.6
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.58
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.58
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.57
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.54
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.53
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.51
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.51
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.49
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.44
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.43
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.42
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.42
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.4
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.38
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.35
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.34
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.32
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.29
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.29
1via_A175 Shikimate kinase; structural genomics, transferase 97.29
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.29
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.28
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.28
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.28
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.26
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.26
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.25
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.23
2z43_A324 DNA repair and recombination protein RADA; archaea 97.2
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.2
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.19
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.17
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.15
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.14
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.14
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.14
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.14
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.12
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.1
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.1
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.09
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.09
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.09
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.08
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.07
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.07
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.07
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.07
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.06
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.05
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.03
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.03
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.02
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.02
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.02
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.01
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.01
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.01
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.0
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.0
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.0
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.98
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.98
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.96
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.96
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.96
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.95
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.95
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.94
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.93
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.93
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.93
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.91
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.91
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.9
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.88
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.87
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.85
3io5_A333 Recombination and repair protein; storage dimer, i 96.83
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.82
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.78
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.77
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.77
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.75
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.73
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.7
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.69
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.68
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.66
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.66
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.63
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.62
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.6
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.6
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 96.57
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.56
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.53
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.53
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.52
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.52
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.51
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.49
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.49
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.48
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.48
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.46
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 96.44
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 96.42
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.42
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.4
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.36
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 96.34
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.34
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.25
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.22
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.21
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 96.21
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.2
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.2
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.2
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.19
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.17
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.17
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.13
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.06
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.06
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.05
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.05
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 96.04
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.03
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.02
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.01
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.99
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.98
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.96
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.96
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.94
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 95.94
3h1t_A 590 Type I site-specific restriction-modification syst 95.93
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 95.92
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 95.91
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 95.9
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.89
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.86
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.86
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.86
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.85
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.84
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 95.84
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.82
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 95.79
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 95.78
3bor_A237 Human initiation factor 4A-II; translation initiat 95.77
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 95.77
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.74
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.74
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.74
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.73
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.68
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.67
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.67
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 95.67
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.66
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 95.66
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.65
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.63
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.63
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 95.62
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.61
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.58
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 95.57
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.56
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.55
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.54
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 95.54
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.53
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 95.52
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 95.5
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.5
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.49
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.48
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 95.48
1qzm_A94 ATP-dependent protease LA; oligomerization domain, 95.45
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.43
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 95.42
2og2_A359 Putative signal recognition particle receptor; nuc 95.41
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.41
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.4
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 95.39
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.36
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.34
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.33
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 95.32
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.31
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.28
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 95.28
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.27
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 95.25
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.25
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 95.25
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.23
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.16
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 95.14
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 95.11
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 95.08
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 95.05
2ged_A193 SR-beta, signal recognition particle receptor beta 95.03
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 95.02
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.01
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 94.93
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.91
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.91
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 94.9
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 94.86
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 94.83
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.8
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.78
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.76
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 94.76
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 94.74
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 94.73
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 94.71
3ice_A422 Transcription termination factor RHO; transcriptio 94.67
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.67
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 94.63
3kta_A182 Chromosome segregation protein SMC; structural mai 94.58
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.54
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 94.5
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.46
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 94.46
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 94.45
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 94.44
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.4
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 94.39
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.38
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.37
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.36
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 94.35
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 94.32
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.32
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 94.31
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.29
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.27
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 94.24
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 94.2
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 94.2
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 94.19
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.14
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.12
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.1
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 94.09
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.08
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 94.06
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.05
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 94.03
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.03
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.02
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.98
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.97
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 93.94
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.93
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=4.6e-40  Score=311.09  Aligned_cols=236  Identities=19%  Similarity=0.284  Sum_probs=199.5

Q ss_pred             HHHHhhhcChHHHHHHHHHHHHHhhhHHHHHhcCCCCCCCCCCceEEecCCCCCHHHHHHHHHHHHHHcCCcCCCCEEEe
Q 013706          158 ENELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEV  237 (438)
Q Consensus       158 ~~~l~~i~G~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~GppGtGKT~la~~la~~l~~~~~~~~~~~~~~  237 (438)
                      ...|++++|++.+|++|++.   +.+|.++++.+...+..+|+++|||||||||||++|+++|++++.       +|+.+
T Consensus       144 ~v~~~dIgGl~~~k~~l~e~---v~~Pl~~pe~f~~~gi~~prGvLL~GPPGTGKTllAkAiA~e~~~-------~f~~v  213 (405)
T 4b4t_J          144 DSTYDMVGGLTKQIKEIKEV---IELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDC-------KFIRV  213 (405)
T ss_dssp             SCCGGGSCSCHHHHHHHHHH---THHHHHCHHHHHHHTCCCCCCEEEESCSSSSHHHHHHHHHHHHTC-------EEEEE
T ss_pred             CCCHHHhCCHHHHHHHHHHH---HHHHHhCHHHHHhCCCCCCCceEEeCCCCCCHHHHHHHHHHhhCC-------CceEE
Confidence            45799999999999999988   666777777777777889999999999999999999999999987       99999


Q ss_pred             ecccccccccccchHHHHHHHHHc---cCcEEEEeCcccccCCCCCCC---chhHHHHHHHHHhhccC----CCEEEEEe
Q 013706          238 QRTDLVGEFVGHTGPKTRRRIKEA---EGGILFVDEAYRLIPMQKADD---KDYGIEALEEIMSVMDG----GKVVVIFA  307 (438)
Q Consensus       238 ~~~~~~~~~~g~~~~~~~~~~~~a---~~~il~iDEid~l~~~~~~~~---~~~~~~~~~~ll~~~~~----~~v~vi~~  307 (438)
                      +++++.++|+|++++.++.+|..|   .+|||||||+|+++++|..++   +....+++++||..||+    ..|+||+|
T Consensus       214 ~~s~l~sk~vGese~~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~~~~V~vIaA  293 (405)
T 4b4t_J          214 SGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMA  293 (405)
T ss_dssp             EGGGGSCSSTTHHHHHHHHHHHHHHHTCSEEEEEESSSCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTCCCCEEEEEE
T ss_pred             EhHHhhccccchHHHHHHHHHHHHHHhCCceEeeecchhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCCCCCeEEEec
Confidence            999999999999999999999887   469999999999999876433   33566889999999986    56888888


Q ss_pred             cCChhHHHHhhhCcCccC--CCCcceeCCCCCHHHHHHHHHHHHhccccccccccccccccccHHHHHHHHHHHhhHhhh
Q 013706          308 GYSEPMKRVIASNEGFCR--RVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQR  385 (438)
Q Consensus       308 ~~~~~~~~~~~~~p~l~~--R~~~~i~~~~~~~~e~~~il~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  385 (438)
                      ||.....     ||||+|  ||+.+|+|+.|+.++|.+|++.++++.         .+..+++.+.++..+.        
T Consensus       294 TNrpd~L-----DpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~---------~l~~dvdl~~lA~~t~--------  351 (405)
T 4b4t_J          294 TNRLDIL-----DPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKM---------NLTRGINLRKVAEKMN--------  351 (405)
T ss_dssp             ESCSSSS-----CHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTS---------BCCSSCCHHHHHHHCC--------
T ss_pred             cCChhhC-----CHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCC---------CCCccCCHHHHHHHCC--------
Confidence            8765553     999998  999999999999999999999998764         3445666666655554        


Q ss_pred             ccccccchHHHHHHHHHHhhccccCCCCChhhhhhccHHHHHHHHHHHHh
Q 013706          386 REMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLLR  435 (438)
Q Consensus       386 ~~~n~~~l~~~~~~a~~~~~~r~~~~~~~~~~~~~i~~~d~~~a~~~~~~  435 (438)
                       ..+|+++.+++..|...+..+         +...|+.+||..|++++.+
T Consensus       352 -G~SGADi~~l~~eA~~~Air~---------~~~~vt~~Df~~Al~~v~~  391 (405)
T 4b4t_J          352 -GCSGADVKGVCTEAGMYALRE---------RRIHVTQEDFELAVGKVMN  391 (405)
T ss_dssp             -SCCHHHHHHHHHHHHHHHHHT---------TCSBCCHHHHHHHHHHHHH
T ss_pred             -CCCHHHHHHHHHHHHHHHHHc---------CCCCcCHHHHHHHHHHHhC
Confidence             455888899999888776433         3356999999999999876



>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 438
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-13
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-09
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.004
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-06
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 5e-06
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 8e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-05
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-05
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 5e-05
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-04
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 5e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 5e-04
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 7e-04
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 7e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.001
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.001
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 0.001
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 84.6 bits (208), Expect = 2e-18
 Identities = 44/112 (39%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 6   TPLHVSAGYNKAEIVKSLLEWPGNDKVELEAQNMYGETPLHMAAKNGCNEAAKLLLAHGA 65
           TPLHV++      IVK+LL+            N+  ETPLHMAA+ G  E AK LL + A
Sbjct: 2   TPLHVASFMGHLPIVKNLLQ----RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA 57

Query: 66  FIEAKANNGMTPLHLSVWYSIRSEDYATVKTLLEYNADCSAKDNEGKTPLDH 117
            + AKA +  TPLH +            VK LLE NA+ +     G TPL  
Sbjct: 58  KVNAKAKDDQTPLHCAARIG----HTNMVKLLLENNANPNLATTAGHTPLHI 105


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.97
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.9
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.89
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.86
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.85
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.85
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.84
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.84
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.84
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.83
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.83
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.83
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.82
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.82
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.82
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.82
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.81
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.81
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.8
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.8
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.79
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.79
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.79
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.78
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.77
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.77
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.76
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.76
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.76
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.76
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.74
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.74
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.74
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.74
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.73
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.72
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.71
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.71
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.67
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.67
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.64
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.64
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.62
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.62
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.57
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.53
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.52
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.52
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.5
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.45
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.45
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.41
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.26
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.01
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.74
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.61
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.06
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.02
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.01
d1tuea_205 Replication protein E1 helicase domain {Human papi 98.0
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.96
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.89
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.89
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.87
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.85
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.83
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.79
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.71
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.71
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.68
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.67
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.66
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.58
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.58
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.57
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.57
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.56
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.55
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.53
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.53
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.52
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.51
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.49
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.43
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.42
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.41
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.4
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.37
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.36
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.36
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.34
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.29
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.26
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.26
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.22
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.22
d2qy9a2211 GTPase domain of the signal recognition particle r 97.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.14
d1vmaa2213 GTPase domain of the signal recognition particle r 97.12
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.11
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.1
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.05
d1okkd2207 GTPase domain of the signal recognition particle r 97.05
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.99
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.96
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.86
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.84
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.84
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.8
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.78
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.76
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.71
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.71
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.71
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.71
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.7
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.67
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.61
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.58
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.53
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.51
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.5
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.44
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.32
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 96.31
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.23
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.23
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.03
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.01
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.99
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.92
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.88
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.87
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.85
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.73
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.72
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.7
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.66
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.66
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.62
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.58
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.54
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.43
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.4
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.39
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 95.38
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.38
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.29
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.21
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 95.16
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.05
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.98
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.98
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.9
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.87
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.82
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.8
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.79
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.78
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.73
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.72
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 94.71
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.7
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.69
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.68
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.66
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.65
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 94.61
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.49
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 94.47
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.44
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.38
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.35
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 94.34
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.33
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.27
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.24
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.24
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.23
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.21
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.19
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.18
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.17
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.14
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.13
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.09
d1xpua3289 Transcription termination factor Rho, ATPase domai 94.08
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.07
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 94.06
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.02
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.01
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.01
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.99
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.95
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.94
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.87
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.86
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.75
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.71
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.71
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.7
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.69
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.68
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.61
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.55
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.55
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.52
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.47
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.47
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.45
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.45
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.43
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.43
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.38
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.32
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.31
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.27
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.25
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.24
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.24
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.23
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.23
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.19
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.18
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.15
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.11
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.1
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.05
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.02
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 92.93
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.9
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.86
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.85
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.8
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.77
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.65
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.63
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.59
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.55
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.55
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.47
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.43
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.29
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 92.23
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.21
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.07
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.05
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 92.04
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.01
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 91.99
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 91.86
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.82
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.63
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.32
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.11
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 90.87
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 90.77
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 90.59
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.35
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.3
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.28
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.91
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.89
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.5
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.41
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 89.37
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.3
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.29
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.25
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.32
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.37
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 87.31
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.05
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 86.23
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.89
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.89
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 85.66
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.14
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 83.73
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 83.35
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 83.0
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 81.91
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 81.01
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 80.19
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.2e-36  Score=272.69  Aligned_cols=233  Identities=20%  Similarity=0.290  Sum_probs=185.5

Q ss_pred             HHHhhhcChHHHHHHHHHHHHHhhhHHHHHhcCCCCCCCCCCceEEecCCCCCHHHHHHHHHHHHHHcCCcCCCCEEEee
Q 013706          159 NELSNIVGLHELKIQLRKWAKGMLLDERRKALGLKVGARRPPHMAFLGNPGTGKTMVARILGRLLYMVGILPTDRVTEVQ  238 (438)
Q Consensus       159 ~~l~~i~G~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~GppGtGKT~la~~la~~l~~~~~~~~~~~~~~~  238 (438)
                      ..|++++|++++|++|++.+..+    ++++.+...+...++++|||||||||||++|+++|++++.       +++.++
T Consensus         9 ~t~~Di~Gl~~~k~~l~e~v~~~----~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~-------~~~~i~   77 (256)
T d1lv7a_           9 TTFADVAGCDEAKEEVAELVEYL----REPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKV-------PFFTIS   77 (256)
T ss_dssp             CCGGGSCSCHHHHHHTHHHHHHH----HCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTC-------CEEEEC
T ss_pred             CCHHHHhchHHHHHHHHHHHHHH----HCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCC-------CEEEEE
Confidence            46999999999999999876543    4455555566678899999999999999999999999976       999999


Q ss_pred             cccccccccccchHHHHHHHHHcc---CcEEEEeCcccccCCCCCCC---chhHHHHHHHHHhhccC----CCEEEEEec
Q 013706          239 RTDLVGEFVGHTGPKTRRRIKEAE---GGILFVDEAYRLIPMQKADD---KDYGIEALEEIMSVMDG----GKVVVIFAG  308 (438)
Q Consensus       239 ~~~~~~~~~g~~~~~~~~~~~~a~---~~il~iDEid~l~~~~~~~~---~~~~~~~~~~ll~~~~~----~~v~vi~~~  308 (438)
                      ++++.+.|+|+++++++++|+.|+   +|||||||+|.+++.+++..   +....++++.|+..||+    ..++||++|
T Consensus        78 ~~~l~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~vIatT  157 (256)
T d1lv7a_          78 GSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAAT  157 (256)
T ss_dssp             SCSSTTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEEEEEE
T ss_pred             hHHhhhcchhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCCCCEEEEEeC
Confidence            999999999999999999999874   48999999999998776442   34566788999999974    457888776


Q ss_pred             CChhHHHHhhhCcCccC--CCCcceeCCCCCHHHHHHHHHHHHhccccccccccccccccccHHHHHHHHHHHhhHhhhc
Q 013706          309 YSEPMKRVIASNEGFCR--RVTKFFHFNDFNSEELAKILHIKMNNQTEDSLLYGFKLHSSCSMDAIAALIEKETTEKQRR  386 (438)
Q Consensus       309 ~~~~~~~~~~~~p~l~~--R~~~~i~~~~~~~~e~~~il~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  386 (438)
                      +.....     ||+++|  ||+.+|+|++|+.++|.+|++.++.+.         .+..+++.+.++..+.         
T Consensus       158 n~~~~l-----d~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~---------~~~~~~~~~~la~~t~---------  214 (256)
T d1lv7a_         158 NRPDVL-----DPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRV---------PLAPDIDAAIIARGTP---------  214 (256)
T ss_dssp             SCTTTS-----CGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTS---------CBCTTCCHHHHHHTCT---------
T ss_pred             CCcccC-----CHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCC---------CcCcccCHHHHHHhCC---------
Confidence            644432     899987  999999999999999999999998764         3445556555555444         


Q ss_pred             cccccchHHHHHHHHHHhhccccCCCCChhhhhhccHHHHHHHHHHHH
Q 013706          387 EMNGGLVDPMLVNARENLDLRLSFDCLDTDELRTITLEDLEAGLKLLL  434 (438)
Q Consensus       387 ~~n~~~l~~~~~~a~~~~~~r~~~~~~~~~~~~~i~~~d~~~a~~~~~  434 (438)
                      ..+++++.+++++|...+..         +....|+.+||++|++++.
T Consensus       215 G~s~adi~~l~~~A~~~a~~---------~~~~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         215 GFSGADLANLVNEAALFAAR---------GNKRVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             TCCHHHHHHHHHHHHHHHHH---------TTCSSBCHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHHH---------cCCCccCHHHHHHHHHHHh
Confidence            34578899999988766532         2335689999999999875



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure