Citrus Sinensis ID: 013710

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MRPPLPFFFLLLILLTTATITTVTSSGTTKPTKTLPPASAPTSSPTPRTRTPTPTPVASSHPSPLDPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKDNSSDDSENDSSDDDDSDDDSSQKEHHHGPNKVVLGLAIGLSSIVFLIVFVVLLSKWCG
ccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHccccccEEEcccHHHHccccccEEEcccccccccHHHHccccccccccccccccccccHHHHHccccEEcccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHccEEEcccccccccccccccccccccccEEEEEcccccccccccHcHcccccEEEEccccccccccccccccHHHHHHHHHccccccccccHHHccccccEEEEcccccccccHHHccccccEEEEEccccccccccHHHcccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MRPPLPFFFLLLILLTTATittvtssgttkptktlppasaptssptprtrtptptpvasshpspldpkqIRALqslnipsksacslykcdsskpfshLLSLRlsncsddislSSTALKSLSTlqnltffncpiapihfpndlslslLSFSCIHSLHHLSGVFLsrfvnltdltvtnvpvnaSGLYVIIGNMHKLRSVTISNanvtgyipkhlhsnlthvdfsgnqlkgkiptSITLLENLQhlnlssnglngeipssIGDLIALKNVslasnslsgsvpesmASLTDMVHLdlssnqlngtiprFFSDLKKLRYLNLqnnnfhgvlpfNASILEKLQVFKvggntnlcynHTVLSsklklgiapcdkhglpispppakdnssddsendssddddsdddssqkehhhgpnKVVLGLAIGLSSIVFLIVFVVLLSKWCG
MRPPLPFFFLLLILLTTATIttvtssgttkptktlppasaptssptprtrtptptpvasshpspLDPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKDNSSDDSENDSSDDDDSDDDSSQKEHHHGPNKVVLGLAIGLSSIVFLIVFVVLLSKWCG
MRpplpffflllillttatittvtssgttkptktlppasaptssptprtrtptptpvassHPSPLDPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDIslsstalkslstlQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKdnssddsendssddddsdddssQKEHHHGPNKVVLGLAIGlssivflivfvvllsKWCG
****LPFFFLLLILLTTATITTV***********************************************************ACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVS*******************MVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDK******************************************KVVLGLAIGLSSIVFLIVFVVLLSKWC*
*RPPLPFFFLLLILLTTATITTVTSSGTTKPTKTLPPA*****SPTPRTRTPTPTPVASSHPSPLDPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKDNSSDDSEN**********************KVVLGLAIGLSSIVFLIVFVVLLSKWCG
MRPPLPFFFLLLILLTTATITTV******************************************DPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPP*******************************GPNKVVLGLAIGLSSIVFLIVFVVLLSKWCG
*RPPLPFFFLLLILLTTATITTVTSSGTTKPTKTLPPASAPTSSPTPRTRTPTPTPVASSHPSPLDPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKDNSSDDSENDSSDDDDSDDDSSQKEHHHGPNKVVLGLAIGLSSIVFLIVFVVLLSKWCG
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPPLPFFFLLLILLTTATITTVTSSGTTKPTKTLPPASAPTSSPTPRTRTPTPTPVASSHPSPLDPKQIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKDNSSDDSENDSSDDDDSDDDSSQKEHHHGPNKVVLGLAIGLSSIVFLIVFVVLLSKWCG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.432 0.223 0.388 4e-24
C0LGS2 1136 Probable LRR receptor-lik no no 0.315 0.121 0.385 5e-22
Q6R2K2 687 Protein STRUBBELIG-RECEPT no no 0.508 0.323 0.305 4e-21
Q9FRS6 1029 Leucine-rich repeat recep no no 0.567 0.241 0.315 7e-21
Q00874372 DNA-damage-repair/tolerat no no 0.320 0.376 0.380 7e-21
O82318 960 Probably inactive leucine no no 0.359 0.163 0.371 1e-20
C0LGQ9 1037 Probable LRR receptor-lik no no 0.448 0.189 0.325 1e-20
C0LGV1 1135 LRR receptor-like serine/ no no 0.711 0.274 0.285 1e-20
C0LGP4 1010 Probable LRR receptor-lik no no 0.478 0.206 0.295 2e-20
Q9LYN8 1192 Leucine-rich repeat recep no no 0.480 0.176 0.306 4e-20
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 113/193 (58%), Gaps = 4/193 (2%)

Query: 157 HLSGVFLSRFVNLTDLTVTNVPVN--ASGLYVIIGNMHKLRSVTISNANVTGYIPKHLH- 213
           +L G   S   NL+ LT+ N+  N     +   IGN+++LR + ++N  +TG IP  L  
Sbjct: 121 NLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGN 180

Query: 214 -SNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASN 272
            S L +++   N+L GKIP SI  L+ L++L+L+SN L GEIPSS+G+L  L ++ L  N
Sbjct: 181 LSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHN 240

Query: 273 SLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASI 332
            L G VP S+ +L ++  +   +N L+G IP  F++L KL    L +NNF    PF+ SI
Sbjct: 241 QLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSI 300

Query: 333 LEKLQVFKVGGNT 345
              L+ F V  N+
Sbjct: 301 FHNLEYFDVSYNS 313
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q6R2K2|SRF4_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Arabidopsis thaliana GN=SRF4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
188509979435 putative leucine-rich repeat family prot 0.851 0.855 0.7 1e-147
49333375435 putative leucine-rich repeat family prot 0.851 0.855 0.697 1e-147
255562462437 serine-threonine protein kinase, plant-t 0.858 0.858 0.703 1e-144
224076944417 predicted protein [Populus trichocarpa] 0.858 0.899 0.697 1e-140
188509963440 putative leucine-rich repeat family prot 0.851 0.845 0.702 1e-140
188509948435 putative leucine-rich repeat family prot 0.851 0.855 0.702 1e-139
49333390435 putative leucine-rich repeat family prot 0.851 0.855 0.7 1e-139
224114638448 predicted protein [Populus trichocarpa] 0.855 0.834 0.716 1e-136
449500841464 PREDICTED: probable LRR receptor-like se 0.851 0.801 0.659 1e-133
449465004429 PREDICTED: LRR receptor-like serine/thre 0.851 0.867 0.656 1e-133
>gi|188509979|gb|ACD56661.1| putative leucine-rich repeat family protein [Gossypium arboreum] Back     alignment and taxonomy information
 Score =  529 bits (1362), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 266/380 (70%), Positives = 322/380 (84%), Gaps = 8/380 (2%)

Query: 65  LDPKQIRALQSLNIP-SKSAC------SLYKCDSSKPFSHLLSLRLSNCSDDISLSSTAL 117
           LDPKQI AL+SLNIP ++  C      +   CDSSKPF HL+SL LSNCS D+SLS TAL
Sbjct: 57  LDPKQIEALESLNIPTARDPCIQPSPHNATVCDSSKPFRHLVSLHLSNCSSDLSLSFTAL 116

Query: 118 KSLSTLQNLTFFNCPIAPIHFPNDLSLSLLSFSCIHSLHHLSGVFLSRFVNLTDLTVTNV 177
           KSLS++ +L+F NC  + I FP DLSLSL SF+CI SL  L+GV+LSRFVNLTDLTV+  
Sbjct: 117 KSLSSVHSLSFTNCHTSSIRFPYDLSLSLTSFTCIRSLRRLTGVWLSRFVNLTDLTVSFT 176

Query: 178 PVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQLKGKIPTSITLL 237
           PVNASGLYVI+GNMHKL+++TIS+AN+TG +P+HLH NLTHVD S N+LKG IPTS+TLL
Sbjct: 177 PVNASGLYVILGNMHKLKTITISHANLTGSLPRHLHLNLTHVDLSDNKLKGNIPTSLTLL 236

Query: 238 ENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQ 297
           E+L++LNLSSNGLNGEIP+  GDLI+L+N+SLASNS SGS+PES++++  +VH+DLS+NQ
Sbjct: 237 EDLEYLNLSSNGLNGEIPTEFGDLISLRNLSLASNSFSGSIPESISAIPGLVHVDLSNNQ 296

Query: 298 LNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSK 357
           LNGT+PRFFS LK L+ LNL+NN  HGVLPFNAS ++KL VFKVGGN+NLCYNH+VLSSK
Sbjct: 297 LNGTVPRFFSQLKGLKVLNLENNELHGVLPFNASFIKKLAVFKVGGNSNLCYNHSVLSSK 356

Query: 358 LKLGIAPCDKHGLPISPPPAKDNSSDDSENDSSDDDDSDDDSSQKEHHHGPNKVVLGLAI 417
           +KLGIA CDKHGLP+SPPP+K+ SS DS+    +DD +DD S  KEHHHGPNKVVLG+AI
Sbjct: 357 MKLGIARCDKHGLPMSPPPSKE-SSGDSDLSDYEDDSADDTSENKEHHHGPNKVVLGVAI 415

Query: 418 GLSSIVFLIVFVVLLSKWCG 437
           GLSSIVFLIVF+VLLSKWCG
Sbjct: 416 GLSSIVFLIVFLVLLSKWCG 435

Source: Gossypium arboreum

Species: Gossypium arboreum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|49333375|gb|AAT64015.1| putative leucine-rich repeat family protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|255562462|ref|XP_002522237.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223538490|gb|EEF40095.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224076944|ref|XP_002305061.1| predicted protein [Populus trichocarpa] gi|222848025|gb|EEE85572.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|188509963|gb|ACD56647.1| putative leucine-rich repeat family protein [Gossypioides kirkii] Back     alignment and taxonomy information
>gi|188509948|gb|ACD56634.1| putative leucine-rich repeat family protein [Gossypium raimondii] Back     alignment and taxonomy information
>gi|49333390|gb|AAT64029.1| putative leucine-rich repeat family protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224114638|ref|XP_002316816.1| predicted protein [Populus trichocarpa] gi|222859881|gb|EEE97428.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449500841|ref|XP_004161208.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g37450-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449465004|ref|XP_004150219.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2124147431 RLP51 "receptor like protein 5 0.842 0.853 0.536 2.3e-103
TAIR|locus:2171963425 RLP55 "receptor like protein 5 0.805 0.828 0.464 2.5e-81
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.432 0.223 0.388 1.3e-26
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.411 0.221 0.370 1.7e-24
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.459 0.198 0.341 4.2e-24
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.427 0.198 0.371 7.7e-24
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.473 0.204 0.320 8.3e-24
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.471 0.230 0.356 1.2e-23
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.496 0.182 0.308 1.4e-23
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.354 0.136 0.380 2.2e-23
TAIR|locus:2124147 RLP51 "receptor like protein 51" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1024 (365.5 bits), Expect = 2.3e-103, P = 2.3e-103
 Identities = 211/393 (53%), Positives = 268/393 (68%)

Query:    63 SPLDPKQIRALQSLNIPS-KSAC-----------SLYKCDSSKPFSHLLSLRLSNCSDDI 110
             SPLDPKQ++AL+SLNIP+ K  C           S+  CD+S PF  + S+  +NCS D+
Sbjct:    46 SPLDPKQLKALESLNIPTVKDPCNHRPTTKSTSSSVVTCDTSSPFRLVTSISFTNCSTDL 105

Query:   111 XXXXXXXXXXX-XXQNLTFFNCP-IAPIHFPNDLSLSLLSFSCIHSL----HHLSGVFLS 164
                            +L+F NCP ++P   P  L  SL SF+ + S     + LSGVFL+
Sbjct:   106 SISTTALRALSPSLTSLSFLNCPSLSP---PPRLPDSLHSFTAVSSFLRRRNGLSGVFLA 162

Query:   165 RFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGN 224
             R VNLTDLTV++VPV+ SGL+VI+GNMH++ S+TIS+AN++G IPK  HSNLT +D S N
Sbjct:   163 RLVNLTDLTVSSVPVSTSGLFVILGNMHEIVSLTISHANLSGNIPKSFHSNLTFIDLSDN 222

Query:   225 QLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMAS 284
              LKG IPTSITLL NL+ LNLS N ++G+IP SIGDLI+LKN+SL+SN LSG +P+S++S
Sbjct:   223 LLKGSIPTSITLLSNLKSLNLSKNTISGDIPDSIGDLISLKNLSLSSNKLSGPIPDSISS 282

Query:   285 LTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGN 344
             + ++ HLDLS NQLNGTIPRF S +K L +LNL NN FHGVLPFNAS ++ L+VFK+GGN
Sbjct:   283 IPELTHLDLSGNQLNGTIPRFISKMKYLTHLNLANNAFHGVLPFNASFIKNLEVFKIGGN 342

Query:   345 TNLCYNHTVLSSKLKLGIAPCDKHGLPISPPPAKXXXXXXXXXXXXXXXXXXXXXXQKEH 404
             ++LCYNH+VLSSK+KLGIA CDKHGLP+SPPP K                      +KE 
Sbjct:   343 SDLCYNHSVLSSKMKLGIAQCDKHGLPLSPPPQKEDSNSDYDYGNEDDTSEK----KKEE 398

Query:   405 HHGPNKVVLGLAIGXXXXXXXXXXXXXXXKWCG 437
             HHGPNKVVLG+AIG               KWCG
Sbjct:   399 HHGPNKVVLGVAIGLSSLVFLIIFMILLAKWCG 431
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2171963 RLP55 "receptor like protein 55" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-12
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  108 bits (272), Expect = 3e-25
 Identities = 86/263 (32%), Positives = 136/263 (51%), Gaps = 25/263 (9%)

Query: 94  PFSHLLSLRLSNCS----DDISLSSTALKSLSTLQNLTFFNCPIAPIHFPN----DLSLS 145
           P+   ++L  +  S    DDI  +S++L+ L+   N   F   I     PN    DLS +
Sbjct: 93  PYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNN--NFTGSIPRGSIPNLETLDLSNN 150

Query: 146 LLSFSCIHSLHHLSGVFLS-RFVNLT-DLTVTNVPVNASGLYVIIGNMHKLRSVTISNAN 203
           +LS    + +    G F S + ++L  ++ V  +P +       + N+  L  +T+++  
Sbjct: 151 MLSGEIPNDI----GSFSSLKVLDLGGNVLVGKIPNS-------LTNLTSLEFLTLASNQ 199

Query: 204 VTGYIPKHL--HSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDL 261
           + G IP+ L    +L  +    N L G+IP  I  L +L HL+L  N L G IPSS+G+L
Sbjct: 200 LVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL 259

Query: 262 IALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNN 321
             L+ + L  N LSG +P S+ SL  ++ LDLS N L+G IP     L+ L  L+L +NN
Sbjct: 260 KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNN 319

Query: 322 FHGVLPFNASILEKLQVFKVGGN 344
           F G +P   + L +LQV ++  N
Sbjct: 320 FTGKIPVALTSLPRLQVLQLWSN 342

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.79
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
KOG4237498 consensus Extracellular matrix protein slit, conta 99.69
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PLN03150623 hypothetical protein; Provisional 99.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.41
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
PLN03150623 hypothetical protein; Provisional 99.25
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.03
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.68
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.49
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.4
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.34
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.19
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.82
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.81
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.61
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.04
KOG4308478 consensus LRR-containing protein [Function unknown 97.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.99
KOG4308478 consensus LRR-containing protein [Function unknown 96.94
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.91
KOG4341483 consensus F-box protein containing LRR [General fu 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
KOG4341483 consensus F-box protein containing LRR [General fu 96.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.24
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 95.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.61
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.0
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.88
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 93.04
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 92.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.24
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.94
smart0037026 LRR Leucine-rich repeats, outliers. 89.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.53
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 89.45
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 88.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.52
PF03302397 VSP: Giardia variant-specific surface protein; Int 87.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.8
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.13
smart0037026 LRR Leucine-rich repeats, outliers. 86.13
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 84.61
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.23
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 83.49
PF15176102 LRR19-TM: Leucine-rich repeat family 19 TM domain 80.35
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 80.14
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.97  E-value=4.5e-32  Score=260.54  Aligned_cols=321  Identities=20%  Similarity=0.210  Sum_probs=232.8

Q ss_pred             hhhhccccccccCCCCCccccCCCCCCCCeeEEEccCCCCCCcCChhhhCCCCCCCEEecccCCCCCCCCCchhhhc---
Q 013710           69 QIRALQSLNIPSKSACSLYKCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLS---  145 (437)
Q Consensus        69 ~~~~L~~l~~~~~~~c~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~L~~n~l~~i~lp~~l~~~---  145 (437)
                      .+..|++||++.+. .+.+.-..+..=.++++|+|++|.|+. +..+.|.++.+|..|.|++|+++.+  |...+..   
T Consensus       147 ~l~alrslDLSrN~-is~i~~~sfp~~~ni~~L~La~N~It~-l~~~~F~~lnsL~tlkLsrNrittL--p~r~Fk~L~~  222 (873)
T KOG4194|consen  147 ALPALRSLDLSRNL-ISEIPKPSFPAKVNIKKLNLASNRITT-LETGHFDSLNSLLTLKLSRNRITTL--PQRSFKRLPK  222 (873)
T ss_pred             hHhhhhhhhhhhch-hhcccCCCCCCCCCceEEeeccccccc-cccccccccchheeeecccCccccc--CHHHhhhcch
Confidence            35567888888743 233333333333456666666665542 2224455555555555555555433  3222211   


Q ss_pred             ---------------------ccccccc----ccCCCCChhhhcCCCCCCEEEeecCCCCCCchhHhhcCCcCccEEEee
Q 013710          146 ---------------------LLSFSCI----HSLHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTIS  200 (437)
Q Consensus       146 ---------------------l~~l~~l----~~l~~l~~~~~~~l~~L~~L~ls~n~l~~~~~~~~l~~l~~L~~L~L~  200 (437)
                                           +.++.++    +.+..+.+.+|..+.++++|+|+.|+++.. -...+-+++.|+.|+++
T Consensus       223 L~~LdLnrN~irive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~~N~l~~v-n~g~lfgLt~L~~L~lS  301 (873)
T KOG4194|consen  223 LESLDLNRNRIRIVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLETNRLQAV-NEGWLFGLTSLEQLDLS  301 (873)
T ss_pred             hhhhhccccceeeehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecccchhhhh-hcccccccchhhhhccc
Confidence                                 1122211    233367777888888999999999888654 33456778899999999


Q ss_pred             CCcccccCCcccc--cCccEEEccCCcCCCCCChhccCCCCCcEEEccCCCCCCCCCcccCCCcccceeecccccCCCCC
Q 013710          201 NANVTGYIPKHLH--SNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSV  278 (437)
Q Consensus       201 ~n~l~~~~~~~~~--~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~  278 (437)
                      +|.|...-++.+.  ++|++|+|++|+|+...++.|..+..|++|+|++|.++......|..+.+|+.|||++|.+.+.+
T Consensus       302 ~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnLs~Nsi~~l~e~af~~lssL~~LdLr~N~ls~~I  381 (873)
T KOG4194|consen  302 YNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFRVLSQLEELNLSHNSIDHLAEGAFVGLSSLHKLDLRSNELSWCI  381 (873)
T ss_pred             hhhhheeecchhhhcccceeEeccccccccCChhHHHHHHHhhhhcccccchHHHHhhHHHHhhhhhhhcCcCCeEEEEE
Confidence            9988877777665  88999999999998777888888999999999999988666677888999999999999988543


Q ss_pred             ---ccccCCCCCCCeeeccCCcCCCcchhhhcCCCCCCEEeccCCcCCCCCCCCcccCCCCCEEEecCCCCCCcCc-ccc
Q 013710          279 ---PESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNH-TVL  354 (437)
Q Consensus       279 ---~~~l~~l~~L~~L~L~~N~l~~~~~~~l~~l~~L~~L~L~~N~l~~~~~~~l~~l~~L~~L~l~~N~~~c~~~-~~~  354 (437)
                         ...|.++++|+.|+|.+|++..+.-..|.++..|++|||.+|.|..+-+..|..+ +|++|.+..-.++|+|+ .|+
T Consensus       382 EDaa~~f~gl~~LrkL~l~gNqlk~I~krAfsgl~~LE~LdL~~NaiaSIq~nAFe~m-~Lk~Lv~nSssflCDCql~Wl  460 (873)
T KOG4194|consen  382 EDAAVAFNGLPSLRKLRLTGNQLKSIPKRAFSGLEALEHLDLGDNAIASIQPNAFEPM-ELKELVMNSSSFLCDCQLKWL  460 (873)
T ss_pred             ecchhhhccchhhhheeecCceeeecchhhhccCcccceecCCCCcceeecccccccc-hhhhhhhcccceEEeccHHHH
Confidence               3457789999999999999987777889999999999999999988888888888 89999999999999999 777


Q ss_pred             cccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 013710          355 SSKLKLGIAPCDKHGLPISPPPAKDNSSDDSENDSSDDDDSD  396 (437)
Q Consensus       355 ~~~~~~~~~~c~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  396 (437)
                      ..|....... ......|+.|+...+......+.....|.+.
T Consensus       461 ~qWl~~~~lq-~sv~a~CayPe~Lad~~i~svd~~~lvC~Ds  501 (873)
T KOG4194|consen  461 AQWLYRRKLQ-SSVIAKCAYPEPLADQSIVSVDTANLVCDDS  501 (873)
T ss_pred             HHHHHhcccc-cceeeeccCCcccccceeEeechhhceecCC
Confidence            7777654333 4445678889988888877777777777654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>PF15176 LRR19-TM: Leucine-rich repeat family 19 TM domain Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-15
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-11
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-09
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-09
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 6e-09
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-09
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-09
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-09
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-09
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-05
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 8e-05
2z7x_A 549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
2z80_A 353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-04
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 6e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 8e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 9e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 9e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 92/170 (54%), Gaps = 5/170 (2%)
Query: 192 HKLRSVTISNANVTGYIPKHLH--SNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNG 249
           + L+ + + N   TG IP  L   S L  +  S N L G IP+S+  L  L+ L L  N 
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 453
Query: 250 LNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDL 309
           L GEIP  +  +  L+ + L  N L+G +P  +++ T++  + LS+N+L G IP++   L
Sbjct: 454 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 513
Query: 310 KKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNHTVLSSKLK 359
           + L  L L NN+F G +P  A + +   +  +  NTNL +N T+ ++  K
Sbjct: 514 ENLAILKLSNNSFSGNIP--AELGDCRSLIWLDLNTNL-FNGTIPAAMFK 560
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-37
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-35
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-10
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  140 bits (356), Expect = 2e-38
 Identities = 70/278 (25%), Positives = 113/278 (40%), Gaps = 31/278 (11%)

Query: 88  KCDSSKPFSHLLSLRLSNCSDDISLSSTALKSLSTLQNLTFFNCPIAPIHFPNDLSLSLL 147
            CD+      + +L LS  +  +        SL+ L  L F       I   N+L   + 
Sbjct: 42  LCDTDTQTYRVNNLDLSGLN--LPKPYPIPSSLANLPYLNFLY-----IGGINNLVGPIP 94

Query: 148 SFSCIHSLHHLSGVFLSR----------FVNLTDLTVTNVPVNA-SGLYVI---IGNMHK 193
               I  L  L  ++++              +  L   +   NA SG   +   I ++  
Sbjct: 95  P--AIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG--TLPPSISSLPN 150

Query: 194 LRSVTISNANVTGYIPK---HLHSNLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGL 250
           L  +T     ++G IP          T +  S N+L GKIP +   L NL  ++LS N L
Sbjct: 151 LVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNML 209

Query: 251 NGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLSSNQLNGTIPRFFSDLK 310
            G+     G     + + LA NSL+  +   +    ++  LDL +N++ GT+P+  + LK
Sbjct: 210 EGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLK 268

Query: 311 KLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLC 348
            L  LN+  NN  G +P     L++  V     N  LC
Sbjct: 269 FLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKCLC 305
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.39
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.93
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.7
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.21
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.05
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 95.24
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 93.72
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 93.0
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 91.54
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
Probab=99.98  E-value=1.6e-31  Score=268.32  Aligned_cols=145  Identities=23%  Similarity=0.234  Sum_probs=129.7

Q ss_pred             CccEEEccCCcCCCCCChhccCCCCCcEEEccCCCCCCCCCcccCCCcccceeecccccCCCCCccccCCCCCCCeeecc
Q 013710          215 NLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLS  294 (437)
Q Consensus       215 ~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~  294 (437)
                      +|++|++++|.+.+..+..|..+++|++|++++|.+++..+..|..+++|++|++++|++++..+..+..+++|++|+|+
T Consensus       276 ~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls  355 (455)
T 3v47_A          276 GVKTCDLSKSKIFALLKSVFSHFTDLEQLTLAQNEINKIDDNAFWGLTHLLKLNLSQNFLGSIDSRMFENLDKLEVLDLS  355 (455)
T ss_dssp             CCCEEECCSSCCCEECTTTTTTCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCEECGGGGTTCTTCCEEECC
T ss_pred             CceEEEecCccccccchhhcccCCCCCEEECCCCcccccChhHhcCcccCCEEECCCCccCCcChhHhcCcccCCEEECC
Confidence            57777777788877778889999999999999999998888899999999999999999998788899999999999999


Q ss_pred             CCcCCCcchhhhcCCCCCCEEeccCCcCCCCCCCCcccCCCCCEEEecCCCCCCcCc--cccccccc
Q 013710          295 SNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNH--TVLSSKLK  359 (437)
Q Consensus       295 ~N~l~~~~~~~l~~l~~L~~L~L~~N~l~~~~~~~l~~l~~L~~L~l~~N~~~c~~~--~~~~~~~~  359 (437)
                      +|++++..+..+.++++|++|++++|++++..+..+..+++|+.|++++|++.|+|+  .++..|..
T Consensus       356 ~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~l~~~l~  422 (455)
T 3v47_A          356 YNHIRALGDQSFLGLPNLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLN  422 (455)
T ss_dssp             SSCCCEECTTTTTTCTTCCEEECCSSCCSCCCTTTTTTCTTCCEEECCSSCBCCCTTTTHHHHHHHH
T ss_pred             CCcccccChhhccccccccEEECCCCccccCCHhHhccCCcccEEEccCCCcccCCCcchHHHHHHH
Confidence            999998889999999999999999999998777777899999999999999999997  33444543
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 65.8 bits (159), Expect = 2e-12
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 28/199 (14%)

Query: 166 FVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLHSNLTHVDFSGNQ 225
             NLT L   ++  N      ++  +  L S+  +N  ++   P  + +NL  +  +GNQ
Sbjct: 171 LANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQ 230

Query: 226 LKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVP------ 279
           LK     ++  L NL  L+L++N ++   P  +  L  L  + L +N +S   P      
Sbjct: 231 LKD--IGTLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTA 286

Query: 280 --------------ESMASLTDMVHLDLSSNQLNGTIPRFFSDLKKLRYLNLQNNNFHGV 325
                           +++L ++ +L L  N ++   P   S L KL+ L   NN    V
Sbjct: 287 LTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDV 344

Query: 326 LPFNASILEKLQVFKVGGN 344
                + L  +     G N
Sbjct: 345 SSL--ANLTNINWLSAGHN 361
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.6
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.05
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.52
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.96  E-value=1.7e-29  Score=238.82  Aligned_cols=269  Identities=25%  Similarity=0.345  Sum_probs=185.1

Q ss_pred             hccccccccCCCC---C-ccccCCCCCCCCeeEEEccCCCCCCc--CChhhhCCCCCCCEEeccc-CCCCCCCCCchhhh
Q 013710           72 ALQSLNIPSKSAC---S-LYKCDSSKPFSHLLSLRLSNCSDDIS--LSSTALKSLSTLQNLTFFN-CPIAPIHFPNDLSL  144 (437)
Q Consensus        72 ~L~~l~~~~~~~c---~-~~~~~~~~~l~~L~~L~Ls~n~~~~~--~~~~~~~~l~~L~~L~L~~-n~l~~i~lp~~l~~  144 (437)
                      .+.+|+- +.|+|   + |+.|+..++-.++++|+|+++++.+.  +| ..++++++|++|+|++ |++.+ .+|..+. 
T Consensus        23 ~l~sW~~-~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp-~~l~~L~~L~~L~Ls~~N~l~g-~iP~~i~-   98 (313)
T d1ogqa_          23 TLSSWLP-TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIP-SSLANLPYLNFLYIGGINNLVG-PIPPAIA-   98 (313)
T ss_dssp             GGTTCCT-TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECC-GGGGGCTTCSEEEEEEETTEES-CCCGGGG-
T ss_pred             cCCCCCC-CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCC-hHHhcCcccccccccccccccc-ccccccc-
Confidence            3667764 34777   3 99999877777899999999998764  55 6899999999999987 66643 2355432 


Q ss_pred             cccccccccc-------CCCCChhhhcCCCCCCEEEeecCCCCCCchhHhhcCCcCccEEEeeCCcccccCCcccc---c
Q 013710          145 SLLSFSCIHS-------LHHLSGVFLSRFVNLTDLTVTNVPVNASGLYVIIGNMHKLRSVTISNANVTGYIPKHLH---S  214 (437)
Q Consensus       145 ~l~~l~~l~~-------l~~l~~~~~~~l~~L~~L~ls~n~l~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~---~  214 (437)
                         ++.+++.       +..+....+..+.+|+++++++|.+... ++..+.++++|+++++++|.+.+.+|..+.   .
T Consensus        99 ---~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~-~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~  174 (313)
T d1ogqa_          99 ---KLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGT-LPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK  174 (313)
T ss_dssp             ---GCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESC-CCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCT
T ss_pred             ---cccccchhhhccccccccccccccchhhhccccccccccccc-CchhhccCcccceeeccccccccccccccccccc
Confidence               2222222       1222333455566666666666655433 445566666666666666666666665554   2


Q ss_pred             CccEEEccCCcCCCCCChhccCCCCCcEEEccCCCCCCCCCcccCCCcccceeecccccCCCCCccccCCCCCCCeeecc
Q 013710          215 NLTHVDFSGNQLKGKIPTSITLLENLQHLNLSSNGLNGEIPSSIGDLIALKNVSLASNSLSGSVPESMASLTDMVHLDLS  294 (437)
Q Consensus       215 ~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~  294 (437)
                      .++.+++++|++++..+..+..+..+ .++++++...+.++..+..+++++.+++++|.+.+.++ .+..+++|++|+|+
T Consensus       175 l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls  252 (313)
T d1ogqa_         175 LFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLR  252 (313)
T ss_dssp             TCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECC
T ss_pred             cccccccccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccc-ccccccccccccCc
Confidence            33666666666666666555555433 56666666666677777777888888888888875544 57777888888888


Q ss_pred             CCcCCCcchhhhcCCCCCCEEeccCCcCCCCCCCCcccCCCCCEEEecCCCCCCcCc
Q 013710          295 SNQLNGTIPRFFSDLKKLRYLNLQNNNFHGVLPFNASILEKLQVFKVGGNTNLCYNH  351 (437)
Q Consensus       295 ~N~l~~~~~~~l~~l~~L~~L~L~~N~l~~~~~~~l~~l~~L~~L~l~~N~~~c~~~  351 (437)
                      +|++++.+|..+.++++|++|+|++|+++|.+|. ++.+++|+.+++++|+.+|+.+
T Consensus       253 ~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         253 NNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             SSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTT
T ss_pred             cCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCC
Confidence            8888878888888888888888888888887775 4677788888888888777653
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure