Citrus Sinensis ID: 013752

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MIVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRFEFEEEDEEGPQFTTTPSLEDKMPFLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEMEETQIQALEFESCVTQETLDLHSPVKLETKDLQNPHSVTSCIEGLSSESNQEHIQVQPNSDSVINITHPPQQQIRAKQSQFSKSPPITREKRKRKRTKPIKNKEEVESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKRMRMGTTSAATLEGCDSATSTTTTTTTTDKAILSNVYSMSRPEIGNCEEKMKAESKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYINGS
cEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHcccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccEEEEEEEccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHcc
cEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHEEccccccccHHHHHHHHcccccccccHHccccHHHHHHccccccccccccccHHHHHHHHHcccccccccccccHHHcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHccc
MIVLSlafkgrcvKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEfintgalrfefeeedeegpqftttpsledkmPFLQMlqsvgtpsvfpfkepnfqTLLRLQHLkkpwelvspfmpeMEETQIQALEFEscvtqetldlhspvkletkdlqnphsvtscieglssesnqehiqvqpnsdsvinithppqqqirakqsqfsksppitrekrkrkrtkpiknkeEVESQRMTHIAVERNRRRQMNDHLNTlrslmppayvqrgdqasiIGGAIDFVKELEQLLQSLEAQKRMrmgttsaatlegcdsatsttttttttdKAILSnvysmsrpeigncEEKMKAESKLDGAEIEVIVIHNhvnlkihcprrpGQLLKAIVALEDLRLTFLHLNitssettvhysfnlkieedcklgSAEEIAAAVHQIFSYINGS
mivlslafkgrcvKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRFEFEEEDEEGPQFTTTPSLEDKMPFLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEMEETQIQALEFESCVTQETLDLHSpvkletkdlqnphSVTSCIEGLSSESNQEHIQVQPNSDSVINITHPPQQqirakqsqfsksppitrekrkrkrtkpiknkeevesqrmthiavernrrrqMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKRMRMGTtsaatlegcdsatsttttttttdkailsnvysmsrpeIGNCEEKMKAESKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYINGS
MIVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRfefeeedeeGPQFTTTPSLEDKMPFLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEMEETQIQALEFESCVTQETLDLHSPVKLETKDLQNPHSVTSCIEGLSSESNQEHIQVQPNSDSVINITHPPQQQIRAKQSQFSKSPpitrekrkrkrtkpiknkeEVESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKeleqllqsleaqKRMRMGTTSAATLEGCDSAtsttttttttDKAILSNVYSMSRPEIGNCEEKMKAESKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYINGS
*IVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRFEF*********************FLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEMEETQIQALEFESCVTQETLDL*******************************************************************************************************************PAYVQRGDQASIIGGAIDFVKELEQLL*****************************************************************GAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYI***
*IVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEF***************************************************************************************************************************************************************************************************RRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELE*************************************************************************VIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEE****GSAEEIAAAVHQIFSYI***
MIVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRFEF************TPSLEDKMPFLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEMEETQIQALEFESCVTQETLDLHSPVKLETKDLQNPHSVTSCIEGLSSESNQEHIQVQPNSDSVINITHP*****************************************MTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKRMRMGTTSAATLEGCDSATSTTTTTTTTDKAILSNVYSMSRPEIGNCEEKMKAESKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYINGS
MIVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRFEFEEEDE*****TTTPSLEDKMPFLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEM*****QALEFESCVTQETLDLHSPVKLET******************************************************************************SQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKR******************************************************KLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYIN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVLSLAFKGRCVKPIVLAVSLFICRWVFVFLQFLGDHLSVECFEQEFINTGALRFEFEEEDEEGPQFTTTPSLEDKMPFLQMLQSVGTPSVFPFKEPNFQTLLRLQHLKKPWELVSPFMPEMEETQIQALEFESCVTQETLDLHSPVKLETKDLQNPHSVTSCIEGLSSESNQEHIQVQPNSDSVINITHPPQQQIRAKQSQFSKSPPITREKRKRKRTKPIKNKEEVESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKRMRMGTTSAATLEGCDSATSTTTTTTTTDKAILSNVYSMSRPEIGNCEEKMKAESKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYINGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
O81037371 Transcription factor bHLH yes no 0.727 0.857 0.460 5e-65
Q700E4358 Transcription factor bHLH no no 0.693 0.846 0.407 2e-62
Q9M128315 Transcription factor bHLH no no 0.688 0.955 0.416 9e-61
Q56YJ8414 Transcription factor FAMA no no 0.503 0.531 0.524 4e-52
Q9C7T4320 Transcription factor bHLH no no 0.446 0.609 0.479 2e-47
Q9SK91304 Transcription factor bHLH no no 0.448 0.644 0.459 1e-42
Q56XR0327 Transcription factor bHLH no no 0.482 0.645 0.414 2e-33
Q9M8K6202 Transcription factor MUTE no no 0.430 0.930 0.435 1e-31
Q9FKQ6296 Transcription factor bHLH no no 0.427 0.631 0.380 5e-26
Q700C7364 Transcription factor SPEE no no 0.162 0.195 0.611 5e-20
>sp|O81037|BH070_ARATH Transcription factor bHLH70 OS=Arabidopsis thaliana GN=BHLH70 PE=2 SV=1 Back     alignment and function desciption
 Score =  248 bits (634), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 231/380 (60%), Gaps = 62/380 (16%)

Query: 56  FEFEEEDEEGPQFTTTPSL--EDKMPFLQMLQSVGTPSVF-PFKEPNFQTLLRLQHLKKP 112
           F  EEE+++     +TPSL  +  +PFLQMLQ    PS F  FK+P+F  LL LQ L+KP
Sbjct: 48  FALEEEEQQ----LSTPSLLQDTTIPFLQMLQQSEDPSPFLSFKDPSFLALLSLQTLEKP 103

Query: 113 WELVSPFMPEMEETQIQALEFESCVTQETLDLHSPVKLETKDLQNPHSVTSCIEGLSSES 172
           WEL                  E+ +  E  + HSP+  ET    N +     +EG++   
Sbjct: 104 WEL------------------ENYLPHEVPEFHSPIHSET----NHYYHNPSLEGVNEAI 141

Query: 173 NQEHIQVQPNSDSVINITHPPQQQIRAKQSQFSKSPPITREKRKRKRTKPIKNKEEVESQ 232
           + + +   P  ++          + R K+   + +  +TREKRKR+RTKP KN EE+ESQ
Sbjct: 142 SNQELPFNPLENA----------RSRRKRKNNNLASLMTREKRKRRRTKPTKNIEEIESQ 191

Query: 233 RMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQ 292
           RMTHIAVERNRRRQMN HLN+LRS++P +Y+QRGDQASI+GGAIDFVK LEQ LQSLEAQ
Sbjct: 192 RMTHIAVERNRRRQMNVHLNSLRSIIPSSYIQRGDQASIVGGAIDFVKILEQQLQSLEAQ 251

Query: 293 KRMRMGTTSAATLEGCDSATSTTTTTTTTDKAILSNVYSMSRPEIGNCEEKMKAESKLDG 352
           KR +    +   +   +S               L N+ S ++    N EE+    SKL  
Sbjct: 252 KRSQQSDDNKEQIPEDNS---------------LRNISS-NKLRASNKEEQ---SSKL-- 290

Query: 353 AEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITS-SETTVHYSFNLKI 411
            +IE  VI +HVNLKI C R+ GQLL++I+ LE LR T LHLNITS + T+V YSFNLK+
Sbjct: 291 -KIEATVIESHVNLKIQCTRKQGQLLRSIILLEKLRFTVLHLNITSPTNTSVSYSFNLKM 349

Query: 412 EEDCKLGSAEEIAAAVHQIF 431
           E++C LGSA+EI AA+ QIF
Sbjct: 350 EDECNLGSADEITAAIRQIF 369

Arabidopsis thaliana (taxid: 3702)
>sp|Q700E4|BH067_ARATH Transcription factor bHLH67 OS=Arabidopsis thaliana GN=BHLH67 PE=2 SV=1 Back     alignment and function description
>sp|Q9M128|BH057_ARATH Transcription factor bHLH57 OS=Arabidopsis thaliana GN=BHLH57 PE=2 SV=1 Back     alignment and function description
>sp|Q56YJ8|FAMA_ARATH Transcription factor FAMA OS=Arabidopsis thaliana GN=FMA PE=1 SV=1 Back     alignment and function description
>sp|Q9C7T4|BH096_ARATH Transcription factor bHLH96 OS=Arabidopsis thaliana GN=BHLH96 PE=2 SV=1 Back     alignment and function description
>sp|Q9SK91|BH094_ARATH Transcription factor bHLH94 OS=Arabidopsis thaliana GN=BHLH94 PE=2 SV=2 Back     alignment and function description
>sp|Q56XR0|BH071_ARATH Transcription factor bHLH71 OS=Arabidopsis thaliana GN=BHLH71 PE=1 SV=1 Back     alignment and function description
>sp|Q9M8K6|MUTE_ARATH Transcription factor MUTE OS=Arabidopsis thaliana GN=MUTE PE=2 SV=1 Back     alignment and function description
>sp|Q9FKQ6|BH099_ARATH Transcription factor bHLH99 OS=Arabidopsis thaliana GN=BHLH99 PE=2 SV=1 Back     alignment and function description
>sp|Q700C7|SPCH_ARATH Transcription factor SPEECHLESS OS=Arabidopsis thaliana GN=SPCH PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
255548057400 DNA binding protein, putative [Ricinus c 0.869 0.95 0.607 1e-114
359489477419 PREDICTED: transcription factor bHLH70-l 0.901 0.940 0.582 1e-113
147785077 590 hypothetical protein VITISV_028014 [Viti 0.885 0.655 0.574 1e-108
356520219384 PREDICTED: transcription factor bHLH70-l 0.848 0.966 0.578 1e-107
296089016356 unnamed protein product [Vitis vinifera] 0.789 0.969 0.605 1e-103
356560225379 PREDICTED: transcription factor bHLH70-l 0.821 0.947 0.555 2e-98
449432974358 PREDICTED: transcription factor bHLH67-l 0.752 0.918 0.498 2e-76
224128065292 predicted protein [Populus trichocarpa] 0.441 0.660 0.625 1e-67
224064378298 predicted protein [Populus trichocarpa] 0.457 0.671 0.632 2e-66
15226442371 transcription factor bHLH70 [Arabidopsis 0.727 0.857 0.460 4e-63
>gi|255548057|ref|XP_002515085.1| DNA binding protein, putative [Ricinus communis] gi|223545565|gb|EEF47069.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 251/413 (60%), Positives = 299/413 (72%), Gaps = 33/413 (7%)

Query: 34  FLGDHLSVECFEQEFINTGALRFEFEEEDEEGPQFTT--TPSLEDKMPFLQMLQSVGTPS 91
           FLG+ L VE  ++EF NTG+LRF+ EEE+EE  + T    PSLEDKMPFLQMLQSV  P 
Sbjct: 12  FLGERLDVEGLQREFANTGSLRFQEEEEEEEEEEETQLLMPSLEDKMPFLQMLQSVEYPP 71

Query: 92  VFPFKEPNFQTLLRLQHLKK--PWELVSPFMPEMEETQIQA--LEFESCVTQETLDLHSP 147
            FP KEPNFQTLL+LQHLKK  PW++ + ++ E E   IQA  LE ESCVT +  DLHSP
Sbjct: 72  FFPIKEPNFQTLLKLQHLKKQQPWDMTT-YITETETRHIQAAALEHESCVTHDIPDLHSP 130

Query: 148 VKLETKDLQNPHSVTSCIEGLSSESNQEHIQVQPNSDSVINITHPPQQQIRAKQSQFSKS 207
           VK E++DL+NPHS  S +E +S E+N + ++V  +S S         QQ     + FSKS
Sbjct: 131 VKSESQDLRNPHS-NSYLEEVSREANNQTVRVNSDSSSFPWTI----QQTMLSDTHFSKS 185

Query: 208 PP--ITREKRKRKRTKPIKNKEEVESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQR 265
            P  + RE+RKRKRT+P KNKEEVESQRMTHIAVERNRRRQMNDHLN+LRSLMPP+YVQR
Sbjct: 186 SPLLVPRERRKRKRTRPTKNKEEVESQRMTHIAVERNRRRQMNDHLNSLRSLMPPSYVQR 245

Query: 266 GDQASIIGGAIDFVKELEQLLQSLEAQKRMRMGTTSAATLEGCDSATSTTTTTTTTDKAI 325
           GDQASIIGGAIDFVKELEQLLQSLEAQ+R R    + A +                   I
Sbjct: 246 GDQASIIGGAIDFVKELEQLLQSLEAQRRTRKPEEAEAGI------------------GI 287

Query: 326 LSN-VYSMSRPEIGNCEEKMKAESKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVAL 384
            SN ++++     GNCEE+ K +   +  EIEV  +HNHVNLKI C R+PG LL+AI AL
Sbjct: 288 SSNGLFTLQSDCNGNCEEESKVKRISEVGEIEVTAVHNHVNLKIQCHRKPGLLLRAIFAL 347

Query: 385 EDLRLTFLHLNITSSETTVHYSFNLKIEEDCKLGSAEEIAAAVHQIFSYINGS 437
           E+LRL+ LHLNITSSETTV YSFNLKIEEDCKLGSA+E+AA V+QIFS INGS
Sbjct: 348 EELRLSVLHLNITSSETTVLYSFNLKIEEDCKLGSADEVAATVNQIFSIINGS 400

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359489477|ref|XP_002267819.2| PREDICTED: transcription factor bHLH70-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147785077|emb|CAN75452.1| hypothetical protein VITISV_028014 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356520219|ref|XP_003528761.1| PREDICTED: transcription factor bHLH70-like [Glycine max] Back     alignment and taxonomy information
>gi|296089016|emb|CBI38719.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356560225|ref|XP_003548394.1| PREDICTED: transcription factor bHLH70-like [Glycine max] Back     alignment and taxonomy information
>gi|449432974|ref|XP_004134273.1| PREDICTED: transcription factor bHLH67-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224128065|ref|XP_002320235.1| predicted protein [Populus trichocarpa] gi|222861008|gb|EEE98550.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224064378|ref|XP_002301446.1| predicted protein [Populus trichocarpa] gi|222843172|gb|EEE80719.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15226442|ref|NP_182204.1| transcription factor bHLH70 [Arabidopsis thaliana] gi|75278887|sp|O81037.1|BH070_ARATH RecName: Full=Transcription factor bHLH70; AltName: Full=Basic helix-loop-helix protein 70; Short=AtbHLH70; Short=bHLH 70; AltName: Full=Transcription factor EN 13; AltName: Full=bHLH transcription factor bHLH070 gi|3510255|gb|AAC33499.1| unknown protein [Arabidopsis thaliana] gi|330255663|gb|AEC10757.1| transcription factor bHLH70 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2116977315 AT4G01460 "AT4G01460" [Arabido 0.450 0.625 0.511 3.3e-53
TAIR|locus:2044387371 AT2G46810 "AT2G46810" [Arabido 0.226 0.266 0.551 3.1e-45
TAIR|locus:2079512358 AT3G61950 "AT3G61950" [Arabido 0.178 0.217 0.620 1.1e-42
TAIR|locus:2093746414 FMA "AT3G24140" [Arabidopsis t 0.810 0.855 0.341 5.9e-41
UNIPROTKB|Q6K4B1351 OJ1595_D08.4 "Os09g0468700 pro 0.473 0.589 0.437 2.9e-39
UNIPROTKB|Q8H7N8329 OJ1217B09.8 "BHLH transcriptio 0.473 0.629 0.460 8.9e-38
UNIPROTKB|Q6YTU1363 P0419H09.4 "cDNA clone:002-131 0.473 0.570 0.433 2.1e-36
TAIR|locus:2207061320 AT1G72210 "AT1G72210" [Arabido 0.446 0.609 0.425 3.1e-35
UNIPROTKB|Q6ZGS3373 OJ1148_D05.9 "Putative basic-h 0.121 0.142 0.811 8.5e-35
TAIR|locus:2009537304 AT1G22490 "AT1G22490" [Arabido 0.427 0.615 0.415 8.5e-33
TAIR|locus:2116977 AT4G01460 "AT4G01460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 487 (176.5 bits), Expect = 3.3e-53, Sum P(2) = 3.3e-53
 Identities = 107/209 (51%), Positives = 133/209 (63%)

Query:   228 EVESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKXXXXXXX 287
             EVE+QRMTHIAVERNRRRQMN+HLN+LRSLMPP+++QRGDQASI+GGAIDF+K       
Sbjct:   109 EVENQRMTHIAVERNRRRQMNEHLNSLRSLMPPSFLQRGDQASIVGGAIDFIKELEQLLQ 168

Query:   288 XXXXXKRMRMGTTSAATLEGCDSAXXXXXXXXXXDKAILSNVYSMSRPEIGNCEEKMKAE 347
                  KR + GT        C S+               S++ S+S         +    
Sbjct:   169 SLEAEKR-KDGTDETPKTASCSSSSSLACTN--------SSISSVSTTSENGFTARFGGG 219

Query:   348 SKLDGAEIEVIVIHNHVNLKIHCPRRPGQLLKAIVALEDLRLTFLHLNITSSETTVHYSF 407
                D  E+E  VI NHV+LK+ C R   Q+LKAIV++E+L+L  LHL I+SS   V YSF
Sbjct:   220 ---DTTEVEATVIQNHVSLKVRCKRGKRQILKAIVSIEELKLAILHLTISSSFDFVIYSF 276

Query:   408 NLKIEEDCKLGSAEEIAAAVHQIFSYING 436
             NLK+E+ CKLGSA+EIA AVHQIF  ING
Sbjct:   277 NLKMEDGCKLGSADEIATAVHQIFEQING 305
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2044387 AT2G46810 "AT2G46810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079512 AT3G61950 "AT3G61950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093746 FMA "AT3G24140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6K4B1 OJ1595_D08.4 "Os09g0468700 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H7N8 OJ1217B09.8 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YTU1 P0419H09.4 "cDNA clone:002-131-D10, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2207061 AT1G72210 "AT1G72210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZGS3 OJ1148_D05.9 "Putative basic-helix-loop-helix transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2009537 AT1G22490 "AT1G22490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026175001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (298 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 4e-13
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 4e-12
smart0035353 smart00353, HLH, helix loop helix domain 7e-09
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information 
 Score = 63.3 bits (155), Expect = 4e-13
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 232 QRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELE 283
           +R  H   ER RR ++ND    LR L+P    ++  +A I+  AI+++K L+
Sbjct: 1   RRKAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52

Length = 52
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.33
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.3
smart0035353 HLH helix loop helix domain. 99.23
KOG1318411 consensus Helix loop helix transcription factor EB 98.73
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.35
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.35
KOG3960284 consensus Myogenic helix-loop-helix transcription 98.1
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.09
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.03
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 97.99
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 97.91
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.88
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 97.88
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.83
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.8
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.66
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.52
KOG4029228 consensus Transcription factor HAND2/Transcription 97.5
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.5
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.36
KOG0561 373 consensus bHLH transcription factor [Transcription 97.3
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.19
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.17
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 96.9
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.85
KOG4447173 consensus Transcription factor TWIST [Transcriptio 96.84
PRK00275895 glnD PII uridylyl-transferase; Provisional 96.81
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.71
PLN0321793 transcription factor ATBS1; Provisional 96.7
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.66
PRK05007884 PII uridylyl-transferase; Provisional 96.63
PRK05092931 PII uridylyl-transferase; Provisional 96.63
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 96.59
PRK04374869 PII uridylyl-transferase; Provisional 96.46
PRK01759854 glnD PII uridylyl-transferase; Provisional 96.45
PRK0019490 hypothetical protein; Validated 96.43
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.42
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.3
PRK03059856 PII uridylyl-transferase; Provisional 96.19
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.13
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.06
PRK03381 774 PII uridylyl-transferase; Provisional 96.02
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.01
PRK03381774 PII uridylyl-transferase; Provisional 95.93
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 95.77
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.56
PRK00275 895 glnD PII uridylyl-transferase; Provisional 95.54
PRK05007 884 PII uridylyl-transferase; Provisional 95.53
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 95.33
PRK04374 869 PII uridylyl-transferase; Provisional 95.22
PRK03059 856 PII uridylyl-transferase; Provisional 95.19
KOG3910632 consensus Helix loop helix transcription factor [T 95.15
PRK05092 931 PII uridylyl-transferase; Provisional 95.14
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 94.99
cd0211660 ACT ACT domains are commonly involved in specifica 94.54
PRK04435147 hypothetical protein; Provisional 94.44
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 94.4
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 93.73
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 93.47
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 93.46
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 93.4
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 93.23
KOG3898254 consensus Transcription factor NeuroD and related 93.16
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.14
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 92.79
PRK08577136 hypothetical protein; Provisional 92.63
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 92.28
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 92.1
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 91.85
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 91.76
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 91.67
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 91.65
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 91.62
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 91.6
PRK07334403 threonine dehydratase; Provisional 91.27
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 91.2
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 90.32
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 90.3
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 90.01
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 90.01
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 88.99
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 88.59
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 88.21
CHL00100174 ilvH acetohydroxyacid synthase small subunit 88.01
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 87.58
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 87.0
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 86.88
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 86.83
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 86.5
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 86.15
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 84.94
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 84.69
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 84.31
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 83.92
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 83.91
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 83.2
PRK11589190 gcvR glycine cleavage system transcriptional repre 83.15
PRK11589 190 gcvR glycine cleavage system transcriptional repre 83.02
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 82.44
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 82.12
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 81.14
KOG4395285 consensus Transcription factor Atonal, contains HT 80.61
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 80.09
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information 
Probab=99.33  E-value=1.9e-12  Score=98.26  Aligned_cols=52  Identities=38%  Similarity=0.653  Sum_probs=48.5

Q ss_pred             hhchhhHHHHHHHHHHHHHHHHHHccCCCC---cCCCCCcchhHHHHHHHHHHHH
Q 013752          232 QRMTHIAVERNRRRQMNDHLNTLRSLMPPA---YVQRGDQASIIGGAIDFVKELE  283 (437)
Q Consensus       232 ~r~~H~~~ER~RR~kmNe~f~~LRsLvP~~---~~~K~dKaSIL~~AI~YIk~Lq  283 (437)
                      +|..|+.+||+||.+||+.|..|+.+||..   ...|.+|++||..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            478999999999999999999999999995   4578999999999999999997

; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 1e-10
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 3e-10
1hlo_A80 Protein (transcription factor MAX); transcriptiona 8e-10
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 2e-09
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 8e-07
1a0a_A63 BHLH, protein (phosphate system positive regulator 6e-06
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 6e-05
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
 Score = 56.6 bits (137), Expect = 1e-10
 Identities = 14/64 (21%), Positives = 32/64 (50%)

Query: 232 QRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEA 291
           +R  H A+ER RR  + D  ++LR  +P    ++  +A I+  A ++++ + +   + + 
Sbjct: 2   KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQ 61

Query: 292 QKRM 295
               
Sbjct: 62  DIDD 65
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.58
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.52
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.52
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.47
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.46
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.42
4ati_A118 MITF, microphthalmia-associated transcription fact 99.38
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.37
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.36
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.33
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.29
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.21
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.09
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.77
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.6
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.42
4ath_A83 MITF, microphthalmia-associated transcription fact 98.0
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.93
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.24
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.23
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 95.98
2nyi_A 195 Unknown protein; protein structure initiative, PSI 95.61
2nyi_A195 Unknown protein; protein structure initiative, PSI 95.46
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.38
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 93.1
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 93.09
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 92.98
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 92.38
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 91.82
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 90.14
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 89.39
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 88.43
2pc6_A165 Probable acetolactate synthase isozyme III (small; 87.15
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 85.75
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 82.14
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.58  E-value=2.3e-15  Score=123.13  Aligned_cols=67  Identities=22%  Similarity=0.369  Sum_probs=61.8

Q ss_pred             hhhhchhhHHHHHHHHHHHHHHHHHHccCCCCcCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 013752          230 ESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKRMRM  297 (437)
Q Consensus       230 e~~r~~H~~~ER~RR~kmNe~f~~LRsLvP~~~~~K~dKaSIL~~AI~YIk~Lq~~v~~Le~~ke~l~  297 (437)
                      ..+|.+|+.+||+||.+||+.|..|++|||+. ..|+||++||.+||+||++||.+++.|+.+.+.+.
T Consensus         4 ~~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~-~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~   70 (82)
T 1am9_A            4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLR   70 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHhhhhHHHHHHHHHHHHHHHHHHhccCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35789999999999999999999999999984 48999999999999999999999999999887654
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 3e-15
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 4e-14
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 3e-13
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 5e-12
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 2e-11
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 2e-11
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 6e-11
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 9e-10
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myod B/HLH domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 68.0 bits (166), Expect = 3e-15
 Identities = 17/65 (26%), Positives = 30/65 (46%)

Query: 223 IKNKEEVESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKEL 282
           +K K     +R      ER R  ++N+   TL+        QR  +  I+  AI +++ L
Sbjct: 3   LKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGL 62

Query: 283 EQLLQ 287
           + LL+
Sbjct: 63  QALLR 67
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.48
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.43
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.42
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.32
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.3
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.06
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.56
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 94.38
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 90.32
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 89.17
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 88.56
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 87.67
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 83.85
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 82.99
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 81.83
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 81.5
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.51  E-value=1.2e-14  Score=116.07  Aligned_cols=67  Identities=22%  Similarity=0.369  Sum_probs=61.1

Q ss_pred             hhhhchhhHHHHHHHHHHHHHHHHHHccCCCCcCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 013752          230 ESQRMTHIAVERNRRRQMNDHLNTLRSLMPPAYVQRGDQASIIGGAIDFVKELEQLLQSLEAQKRMRM  297 (437)
Q Consensus       230 e~~r~~H~~~ER~RR~kmNe~f~~LRsLvP~~~~~K~dKaSIL~~AI~YIk~Lq~~v~~Le~~ke~l~  297 (437)
                      ..+|.+|+.+||+||.+||+.|..|++|||+. ..|++|++||..||+||+.|+++++.|..+...+.
T Consensus         4 ~~kR~~H~~~Er~RR~~in~~~~~L~~llP~~-~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk   70 (80)
T d1am9a_           4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLR   70 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35789999999999999999999999999985 57999999999999999999999999998877543
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure