Citrus Sinensis ID: 013797

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MSREKETEGQEEREDLRITDDDLYEQWVLVGNCGDNLIVSSNRLPLRKKRFAEASQRANPNWADGFSSTEGRRGGSASPGVEPQDADYSFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
cccccccccHHccccEEEEEccccccEEEEccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHccccHHHHHHHcccccccccccccccccEEEEEEEcccEEEEEEcccccEEcccccccccccccccEEEEEcccEEEEEcccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEccccccccccccEEEEEEcccccEEEccccccccccccEEEEccEEEEEEccccccccccEEEEEEcccccEEEcccccccccccccccccEEEEEccEEEEEEccccEEEEEEcccccEEEEEccccccccccccEEEEEEEccEEEEEEccccccccEEEEEEEEccccccccccEEccccccccccEEEEEEEEEc
ccHHHHHHcccccccccccccEEEEEEEEccccccEEEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHcHHHHHHHccHHHHHHHHHccccccEEEEEEcccccEEEEccccccEEEcccccccccccccccEEEEEccEEEEEcccccccEEEEEccccccccccccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEcccccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEcccccccccccccccccEEEEEccEEEEEEccccEEEEEcccccEEEEEccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEEEccccccccccEEEcccccccccEEEEEEEEEc
msreketegqeeredlritdddLYEQWVLVGncgdnlivssnrlplrKKRFAEASqranpnwadgfsstegrrggsaspgvepqdadysfvpslSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRreigfrepsvfmlasgdsswwAFDRHFQtrrklpelpsdpcfklgdkeslcagthlIVSGNEIEGGVIWRYELetnnwfkgpsmrrprclfasatcgtfafvagghgmdgsgvlnsaerynpetkswdslpgmrqrrklcsgcymdnkfyviggrnekdkpltcgeaydeyagtwyhipdilkdfpaetgksppliaVVNNELYSLETSSNELRVYLKdsnswknlglvpvradfnrgwgiAFKSLGNELLVIGasstsshesmaiytccpssdagELQWRLLEcgkrplshfihncsvmva
msreketegqeeredlritdddLYEQWVLVGNCGDNLIVSSNRLPLRKKRFAeasqranpnwadgfsstEGRRGGSASPGVEPQDADYSFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPetkswdslpgmrQRRKLCSGCYMDNKFyviggrnekdkplTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDsnswknlglvpvRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
MSReketegqeereDLRITDDDLYEQWVLVGNCGDNLIVSSNRLPLRKKRFAEASQRANPNWADGFSSTEGRRGGSASPGVEPQDADYSFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
*****************ITDDDLYEQWVLVGNCGDNLIVSSNR*********************************************SFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGV**********************RRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVI***********AIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSV***
***************LRITDDDLYEQWVLVGN***********************************************************PSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
**************DLRITDDDLYEQWVLVGNCGDNLIVSSNRLPLRKKRFAEASQRANPNWADGFSS**************PQDADYSFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
***************LRITDDDLYEQWVLVGNCGDNLIVSSNRL*****RF************************************YSFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSREKETEGQEEREDLRITDDDLYEQWVLVGNCGDNLIVSSNRLPLRKKRFAEASQRANPNWADGFSSTEGRRGGSASPGVEPQDADYSFVPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVMVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query436 2.2.26 [Sep-21-2011]
Q9LI89422 F-box/kelch-repeat protei yes no 0.901 0.931 0.567 1e-119
Q9FKJ0393 F-box/kelch-repeat protei no no 0.784 0.870 0.393 7e-66
Q8L736467 F-box/kelch-repeat protei no no 0.784 0.732 0.398 7e-64
Q84M94421 F-box/kelch-repeat protei no no 0.809 0.838 0.375 2e-62
Q9CA63451 F-box/kelch-repeat protei no no 0.75 0.725 0.371 5e-59
Q93W93434 F-box/kelch-repeat protei no no 0.594 0.596 0.282 5e-20
Q9CAG8376 F-box/kelch-repeat protei no no 0.711 0.824 0.258 5e-19
Q9LM55475 F-box/kelch-repeat protei no no 0.630 0.578 0.247 6e-14
Q5R7B8609 Kelch-like protein 20 OS= yes no 0.399 0.285 0.27 1e-13
Q8VCK5604 Kelch-like protein 20 OS= yes no 0.399 0.288 0.27 2e-13
>sp|Q9LI89|FBK70_ARATH F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1 Back     alignment and function desciption
 Score =  430 bits (1106), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 289/405 (71%), Gaps = 12/405 (2%)

Query: 41  SNRLPLRKKRFAEASQRANPNWADGFSSTEGRRGGSASPGVEPQDADYSF--VPSLSDEL 98
           S +L + +    + +   + +W DG  + E  +  S S  ++P+DADY    VP L  EL
Sbjct: 21  SKKLRVHRYEIPDLNVEPSLDW-DGEETGEATKALS-STCLKPKDADYCLLNVPQLVYEL 78

Query: 99  EVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFD 158
           EV I+ARVPR EYWK  LLNK F  LLKS E+FK+RRE G  EPSVFML+SGD+ W  FD
Sbjct: 79  EVEILARVPRFEYWKLKLLNKGFSRLLKSDEIFKVRRERGVVEPSVFMLSSGDTCWTMFD 138

Query: 159 RHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSM 218
           + F   +KLPELPSD CF  GDKESLCAGTHLIV+G E +   +WRYELET+ WFKGP+M
Sbjct: 139 KGFGNCQKLPELPSDICFLHGDKESLCAGTHLIVTGKEEKSIALWRYELETSKWFKGPAM 198

Query: 219 RRPRCLFASATCGTFAFVAGGHGMDGSG---VLNSAERYNPETKSWDSLPGMRQRRKLCS 275
             PR LFASATCGT  FVAGG  ++G+G   V++S E+Y+ +TK+W  L GM +RRK CS
Sbjct: 199 ITPRILFASATCGTVVFVAGGLKIEGNGTMEVVDSVEKYDSKTKTWTLLRGMHKRRKFCS 258

Query: 276 GCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNN 335
           GCY+  KFYV+GGR+E  + LTCGE+YDE   TW  IPDILKD    + +SPPLIAVV +
Sbjct: 259 GCYLRGKFYVLGGRDENGQNLTCGESYDEKTNTWELIPDILKDMSFSSVQSPPLIAVVGD 318

Query: 336 ELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTSSH 395
           +LYSLETS+NELRVY  ++NSWK LG VPVRA  N GWG+AFKSLG++LLVIGAS+  S 
Sbjct: 319 DLYSLETSANELRVYDANANSWKKLGDVPVRAKSNGGWGVAFKSLGDKLLVIGASAGPSR 378

Query: 396 -ESMAIYTCCPSSD-AGELQWRLLE--CGKRPLSHFIHNCSVMVA 436
            E+M++YT  PS++ A +L W   +  CG R  +HFI NC VM+A
Sbjct: 379 AETMSVYTSRPSANPANKLYWEESKRCCGVR-FNHFILNCCVMIA 422

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FKJ0|FK132_ARATH F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1 Back     alignment and function description
>sp|Q8L736|SKI11_ARATH F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2 Back     alignment and function description
>sp|Q84M94|FBK15_ARATH F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA63|FBK29_ARATH F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function description
>sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
225451426437 PREDICTED: F-box/kelch-repeat protein At 0.993 0.990 0.645 1e-152
224055717390 f-box family protein [Populus trichocarp 0.846 0.946 0.713 1e-151
147766682514 hypothetical protein VITISV_041987 [Viti 0.993 0.842 0.643 1e-150
255536919483 ubiquitin-protein ligase, putative [Rici 0.846 0.763 0.678 1e-144
224129084389 f-box family protein [Populus trichocarp 0.830 0.930 0.693 1e-142
356514107394 PREDICTED: F-box/kelch-repeat protein At 0.827 0.916 0.623 1e-127
356558716404 PREDICTED: F-box/kelch-repeat protein At 0.825 0.891 0.607 1e-125
449455864422 PREDICTED: F-box/kelch-repeat protein At 0.830 0.857 0.588 1e-123
356570145375 PREDICTED: F-box/kelch-repeat protein At 0.795 0.925 0.592 1e-119
15232103422 F-box/kelch-repeat protein [Arabidopsis 0.901 0.931 0.567 1e-118
>gi|225451426|ref|XP_002273717.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  545 bits (1404), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 284/440 (64%), Positives = 335/440 (76%), Gaps = 7/440 (1%)

Query: 1   MSREKETEGQ-EEREDLRITDDDLYEQ-WVLVGNCGDNLIVSSNRLPLRKKRFAEASQRA 58
           MSR KE E + EE + L + D ++  +  VL G+ G+    SS+  P  K R     +R 
Sbjct: 1   MSRGKENEIEDEEGKSLCMCDSNVRNRRGVLDGDSGNGCWASSSSPPPEKIRARGTVRRL 60

Query: 59  NPNWADGFSSTEGRRGGSASPGVEPQDADYSFVPSLSDELEVLIVARVPRAEYWKFYLLN 118
           +P+  +GFSS E R G S++  V+ QDADYS  PSLS E+E LI+ARVPR+EYWKF  +N
Sbjct: 61  DPS-RNGFSSGECRVGSSSA--VDTQDADYSDGPSLSYEVEGLILARVPRSEYWKFCFVN 117

Query: 119 KRFLSLLKSGELFKIRREIGFREPSVFMLASGDSSWWAFDRHFQTRRKLPELPSDPCFKL 178
           KR+L+LLKSGELFKIRREIG +E SVFMLASG++SWWAFDR F++RR+LP LPSDPCF  
Sbjct: 118 KRYLTLLKSGELFKIRREIGVKESSVFMLASGETSWWAFDRQFESRRRLPILPSDPCFTS 177

Query: 179 GDKESLCAGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAG 238
            DKES+CAGTHLIVSG E EG VIWRYEL  N WFKGPSM  PRC+FASA CG FA VAG
Sbjct: 178 ADKESVCAGTHLIVSGREFEGVVIWRYELAMNKWFKGPSMLNPRCMFASANCGAFACVAG 237

Query: 239 GHGMDGSG-VLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLT 297
           G  M  +  VLNSAE YNP+ KSWD+LP M +RRK CSGCYMDNKFYVIGG++EK + LT
Sbjct: 238 GISMVSTKEVLNSAEIYNPDNKSWDTLPRMNKRRKHCSGCYMDNKFYVIGGQDEKGEGLT 297

Query: 298 CGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSSNELRVYLKDSNSW 357
           CGEAYDE    W  IPD+LKD P  T +SPPL+AVVNN+LYSLE SSNEL+VYLK +NSW
Sbjct: 298 CGEAYDEDRKAWDLIPDMLKDAPVSTSESPPLVAVVNNDLYSLEASSNELKVYLKKTNSW 357

Query: 358 KNLGLVPVRADFNRGWGIAFKSLGNELLVIGASSTS-SHESMAIYTCCPSSDAGELQWRL 416
           + LG VPVRADFNRGWG+AFKSLGNELLVIGASS S +   M IYTCCP  DA EL W+ 
Sbjct: 358 RRLGTVPVRADFNRGWGVAFKSLGNELLVIGASSVSFAGHGMTIYTCCPDPDAEELLWKP 417

Query: 417 LECGKRPLSHFIHNCSVMVA 436
           L+ G+  LSHFI NCS+M+A
Sbjct: 418 LDSGRNRLSHFILNCSIMIA 437

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224055717|ref|XP_002298618.1| f-box family protein [Populus trichocarpa] gi|222845876|gb|EEE83423.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147766682|emb|CAN60757.1| hypothetical protein VITISV_041987 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255536919|ref|XP_002509526.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223549425|gb|EEF50913.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224129084|ref|XP_002328886.1| f-box family protein [Populus trichocarpa] gi|222839316|gb|EEE77653.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356514107|ref|XP_003525748.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Glycine max] Back     alignment and taxonomy information
>gi|356558716|ref|XP_003547649.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Glycine max] Back     alignment and taxonomy information
>gi|449455864|ref|XP_004145670.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Cucumis sativus] gi|449502024|ref|XP_004161522.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356570145|ref|XP_003553251.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Glycine max] Back     alignment and taxonomy information
>gi|15232103|ref|NP_189351.1| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|75273330|sp|Q9LI89.1|FBK70_ARATH RecName: Full=F-box/kelch-repeat protein At3g27150 gi|9294080|dbj|BAB01932.1| unnamed protein product [Arabidopsis thaliana] gi|332643752|gb|AEE77273.1| F-box/kelch-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
TAIR|locus:2095138422 AT3G27150 "AT3G27150" [Arabido 0.926 0.957 0.558 1.9e-113
TAIR|locus:2168738415 AT5G40680 "AT5G40680" [Arabido 0.809 0.850 0.511 1.1e-92
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.784 0.870 0.393 2.3e-64
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.786 0.777 0.408 4.7e-64
TAIR|locus:2056705467 AT2G02870 "AT2G02870" [Arabido 0.855 0.798 0.387 9.7e-64
TAIR|locus:2202765421 AT1G26930 "AT1G26930" [Arabido 0.805 0.833 0.392 4.8e-62
TAIR|locus:2019215451 AT1G74510 "AT1G74510" [Arabido 0.816 0.789 0.365 1.2e-58
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.711 0.824 0.267 5.3e-21
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.589 0.592 0.286 2.4e-20
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.545 0.501 0.259 5.6e-14
TAIR|locus:2095138 AT3G27150 "AT3G27150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1119 (399.0 bits), Expect = 1.9e-113, P = 1.9e-113
 Identities = 233/417 (55%), Positives = 294/417 (70%)

Query:    30 VGNCGDNLIVS-SNRLPLRKKRFAEASQRANPNWADGFSSTEGRRGGSASPGVEPQDADY 88
             +G  G +   S S +L + +    + +   + +W DG  + E  +  S S  ++P+DADY
Sbjct:     9 IGRIGASSSWSRSKKLRVHRYEIPDLNVEPSLDW-DGEETGEATKALS-STCLKPKDADY 66

Query:    89 SF--VPSLSDELEVLIVARVPRAEYWKFYLLNKRFLSLLKSGELFKIRREIGFREPSVFM 146
                 VP L  ELEV I+ARVPR EYWK  LLNK F  LLKS E+FK+RRE G  EPSVFM
Sbjct:    67 CLLNVPQLVYELEVEILARVPRFEYWKLKLLNKGFSRLLKSDEIFKVRRERGVVEPSVFM 126

Query:   147 LASGDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIEGGVIWRYE 206
             L+SGD+ W  FD+ F   +KLPELPSD CF  GDKESLCAGTHLIV+G E +   +WRYE
Sbjct:   127 LSSGDTCWTMFDKGFGNCQKLPELPSDICFLHGDKESLCAGTHLIVTGKEEKSIALWRYE 186

Query:   207 LETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSG---VLNSAERYNPETKSWDS 263
             LET+ WFKGP+M  PR LFASATCGT  FVAGG  ++G+G   V++S E+Y+ +TK+W  
Sbjct:   187 LETSKWFKGPAMITPRILFASATCGTVVFVAGGLKIEGNGTMEVVDSVEKYDSKTKTWTL 246

Query:   264 LPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAET 323
             L GM +RRK CSGCY+  KFYV+GGR+E  + LTCGE+YDE   TW  IPDILKD    +
Sbjct:   247 LRGMHKRRKFCSGCYLRGKFYVLGGRDENGQNLTCGESYDEKTNTWELIPDILKDMSFSS 306

Query:   324 GKSPPLIAVVNNELYSLETSSNELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGNE 383
              +SPPLIAVV ++LYSLETS+NELRVY  ++NSWK LG VPVRA  N GWG+AFKSLG++
Sbjct:   307 VQSPPLIAVVGDDLYSLETSANELRVYDANANSWKKLGDVPVRAKSNGGWGVAFKSLGDK 366

Query:   384 LLVIGASSTSSH-ESMAIYTCCPSSD-AGELQWRLLE--CGKRPLSHFIHNCSVMVA 436
             LLVIGAS+  S  E+M++YT  PS++ A +L W   +  CG R  +HFI NC VM+A
Sbjct:   367 LLVIGASAGPSRAETMSVYTSRPSANPANKLYWEESKRCCGVR-FNHFILNCCVMIA 422
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005634 "nucleus" evidence=IDA
GO:0000041 "transition metal ion transport" evidence=RCA
GO:0006826 "iron ion transport" evidence=RCA
GO:0009691 "cytokinin biosynthetic process" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2168738 AT5G40680 "AT5G40680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056705 AT2G02870 "AT2G02870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202765 AT1G26930 "AT1G26930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019215 AT1G74510 "AT1G74510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LI89FBK70_ARATHNo assigned EC number0.56790.90130.9312yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037841001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (494 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-11
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-11
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-10
smart0061247 smart00612, Kelch, Kelch domain 9e-09
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-08
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-07
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-05
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 1e-04
smart0061247 smart00612, Kelch, Kelch domain 2e-04
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 2e-04
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 5e-04
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 7e-04
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 0.001
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 0.001
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 65.6 bits (160), Expect = 2e-11
 Identities = 35/152 (23%), Positives = 61/152 (40%), Gaps = 16/152 (10%)

Query: 222 RCLFASATCGTFAFVAGGHGMDGSG-VLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMD 280
              F S       +  GG  M+ +   +NS   Y+ +TKSW+ +P +   RK       +
Sbjct: 285 VYCFGSVVLNNVIYFIGG--MNKNNLSVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFN 342

Query: 281 NKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSL 340
           N+ YVIGG       L   E++      W   P ++  FP    +  P +  VNN +Y +
Sbjct: 343 NRIYVIGGI-YNSISLNTVESWKPGESKWREEPPLI--FP----RYNPCVVNVNNLIYVI 395

Query: 341 ------ETSSNELRVYLKDSNSWKNLGLVPVR 366
                 +     +  +  ++N W     +P+ 
Sbjct: 396 GGISKNDELLKTVECFSLNTNKWSKGSPLPIS 427

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 436
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA03098534 kelch-like protein; Provisional 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.94
KOG1230 521 consensus Protein containing repeated kelch motifs 99.92
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.91
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.88
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.87
KOG1230521 consensus Protein containing repeated kelch motifs 99.86
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.76
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.64
PF1396450 Kelch_6: Kelch motif 99.14
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 99.14
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.13
PF1396450 Kelch_6: Kelch motif 99.02
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.87
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.84
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.78
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.78
PF1341549 Kelch_3: Galactose oxidase, central domain 98.78
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.75
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.74
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.69
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.69
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.64
smart0061247 Kelch Kelch domain. 98.62
PF1341549 Kelch_3: Galactose oxidase, central domain 98.6
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.54
smart0061247 Kelch Kelch domain. 98.4
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.38
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.38
PLN02772 398 guanylate kinase 98.3
PLN02772 398 guanylate kinase 98.19
PF1385442 Kelch_5: Kelch motif 98.17
PF1385442 Kelch_5: Kelch motif 98.15
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.14
KOG0281499 consensus Beta-TrCP (transducin repeats containing 98.12
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.11
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.85
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.65
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.58
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.54
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.53
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.45
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.24
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.05
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.02
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.96
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.58
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 96.48
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.44
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 96.44
PRK11028330 6-phosphogluconolactonase; Provisional 96.41
PF12768281 Rax2: Cortical protein marker for cell polarity 96.26
KOG2055514 consensus WD40 repeat protein [General function pr 96.25
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.12
PRK11028330 6-phosphogluconolactonase; Provisional 96.09
PRK04792448 tolB translocation protein TolB; Provisional 95.99
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.95
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 95.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.81
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.58
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.38
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.32
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 95.24
PRK04922433 tolB translocation protein TolB; Provisional 95.16
PF12768281 Rax2: Cortical protein marker for cell polarity 95.15
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.14
PRK00178430 tolB translocation protein TolB; Provisional 95.06
PF03089 337 RAG2: Recombination activating protein 2; InterPro 95.0
KOG2055514 consensus WD40 repeat protein [General function pr 94.99
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.74
KOG2997366 consensus F-box protein FBX9 [General function pre 94.61
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.39
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.25
smart00284255 OLF Olfactomedin-like domains. 94.24
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.23
PRK05137435 tolB translocation protein TolB; Provisional 94.14
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.95
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 93.75
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 93.54
KOG0310 487 consensus Conserved WD40 repeat-containing protein 93.37
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 93.13
PRK00178430 tolB translocation protein TolB; Provisional 92.93
PLN029191057 haloacid dehalogenase-like hydrolase family protei 92.92
PRK04792448 tolB translocation protein TolB; Provisional 92.87
PRK02889427 tolB translocation protein TolB; Provisional 92.82
PRK05137435 tolB translocation protein TolB; Provisional 92.71
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.39
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 91.95
PF09910339 DUF2139: Uncharacterized protein conserved in arch 91.94
PRK03629429 tolB translocation protein TolB; Provisional 91.82
KOG0310 487 consensus Conserved WD40 repeat-containing protein 91.42
PRK04043419 tolB translocation protein TolB; Provisional 90.45
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.43
PRK13684334 Ycf48-like protein; Provisional 90.11
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 89.53
COG1520370 FOG: WD40-like repeat [Function unknown] 89.44
COG1520370 FOG: WD40-like repeat [Function unknown] 89.03
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 88.9
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 88.84
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 88.77
KOG2321 703 consensus WD40 repeat protein [General function pr 88.71
PRK04922433 tolB translocation protein TolB; Provisional 88.7
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 88.54
PLN00181793 protein SPA1-RELATED; Provisional 88.49
KOG0296399 consensus Angio-associated migratory cell protein 88.28
PRK03629429 tolB translocation protein TolB; Provisional 87.63
smart00284255 OLF Olfactomedin-like domains. 87.19
PLN00181793 protein SPA1-RELATED; Provisional 86.54
KOG0289506 consensus mRNA splicing factor [General function p 86.39
KOG0316307 consensus Conserved WD40 repeat-containing protein 86.31
PRK04043419 tolB translocation protein TolB; Provisional 85.87
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 85.69
KOG2321 703 consensus WD40 repeat protein [General function pr 85.5
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 85.35
COG4946 668 Uncharacterized protein related to the periplasmic 85.31
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 85.08
PRK01742429 tolB translocation protein TolB; Provisional 84.85
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 83.5
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 83.35
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 82.43
PRK10115 686 protease 2; Provisional 81.82
PRK01742429 tolB translocation protein TolB; Provisional 81.68
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 81.35
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 80.9
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 80.75
PF12217367 End_beta_propel: Catalytic beta propeller domain o 80.47
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-41  Score=345.97  Aligned_cols=320  Identities=22%  Similarity=0.308  Sum_probs=254.4

Q ss_pred             CCCCCCCChHHHHHHhhccCCcccccccccccH-------hhhhhhccc-hhHHHHhhcC-ccCCeEEEeccC------C
Q 013797           87 DYSFVPSLSDELEVLIVARVPRAEYWKFYLLNK-------RFLSLLKSG-ELFKIRREIG-FREPSVFMLASG------D  151 (436)
Q Consensus        87 ~~~~~~~LPddl~~~ILarLP~~~l~~~~~Vck-------~w~~li~s~-~f~~~~~~~~-~~~~~l~~~~~~------~  151 (436)
                      ....+|-||...+..++...+   +.+-...|+       .+..+-... .....+.... .....++++++-      .
T Consensus       224 ~~vr~~ll~~~~l~~~v~~~~---~~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~t~~r~~~~~~l~~vGG~~~~~~~~  300 (571)
T KOG4441|consen  224 EAVRLPLLPPQFLVEIVESEP---LIKRDSACRDLLDEAKKYHLLPQRRPVMQSPRTRPRRSVSGKLVAVGGYNRQGQSL  300 (571)
T ss_pred             HhcCccCCCHHHHHHHHhhhh---hhccCHHHHHHHHHHHHHhhCcccCccccCCCcccCcCCCCeEEEECCCCCCCccc
Confidence            344567888888877776665   222112222       222221111 1111111111 334556666552      2


Q ss_pred             CeEEEEecCCCCeEeCCCCCCCCCccCCCeeeEEeCCEEEEEceecC-C---CeEEEEECCCCCEEeCCCCCCCCcccEE
Q 013797          152 SSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIE-G---GVIWRYELETNNWFKGPSMRRPRCLFAS  227 (436)
Q Consensus       152 ~~~~~~dp~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~-~---~~v~~ydp~t~~W~~l~~~p~~r~~~~~  227 (436)
                      ..+..|||.++.|..+++||.++....    +++++|.||++||.+. .   +.+++|||.+++|..+++|..+|..+++
T Consensus       301 ~~ve~yd~~~~~w~~~a~m~~~r~~~~----~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v  376 (571)
T KOG4441|consen  301 RSVECYDPKTNEWSSLAPMPSPRCRVG----VAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGV  376 (571)
T ss_pred             ceeEEecCCcCcEeecCCCCccccccc----EEEECCEEEEEccccCCCcccceEEEecCCCCceeccCCccCcccccee
Confidence            578899999999999999998887443    8899999999999873 2   7999999999999999999999999999


Q ss_pred             EEeCCEEEEEcCcCCCCCCccceEEEEeCCCCCeEeCCCCccCCcceeEEEECCEEEEEeccCCCCCcCCEEEEEECCCC
Q 013797          228 ATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAG  307 (436)
Q Consensus       228 ~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~iyv~gG~~~~~~~~~~v~~yD~~~~  307 (436)
                      ++++|.||++||.++..  .++++++|||.+++|+.+++|+.+|..+++++++|+||++||.++....++.+++|||.++
T Consensus       377 ~~l~g~iYavGG~dg~~--~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~  454 (571)
T KOG4441|consen  377 AVLDGKLYAVGGFDGEK--SLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETN  454 (571)
T ss_pred             EEECCEEEEEecccccc--ccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCC
Confidence            99999999999999755  7899999999999999999999999999999999999999998877668899999999999


Q ss_pred             cEEEcCCCCCCCCCCCCCCCCEEEEECCEEEEEecCC-----CeEEEEECCCCcEEEcccCCCccCCCCCceEEEEEeCC
Q 013797          308 TWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETSS-----NELRVYLKDSNSWKNLGLVPVRADFNRGWGIAFKSLGN  382 (436)
Q Consensus       308 ~W~~v~~~~~~~~~~~~r~~~~~~~~~g~lyv~gg~~-----~~i~~yd~~~~~W~~v~~~p~~~~~~~~~~~~~~~~~~  382 (436)
                      +|+.+++|+      .+|.++++++++++||++||..     ..+++|||.+++|+.++.|+.+   +...+++  ..++
T Consensus       455 ~W~~~~~M~------~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m~~~---rs~~g~~--~~~~  523 (571)
T KOG4441|consen  455 TWTLIAPMN------TRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYDPETNQWTMVAPMTSP---RSAVGVV--VLGG  523 (571)
T ss_pred             ceeecCCcc------cccccceEEEECCEEEEECCccCCCccceEEEEcCCCCceeEcccCccc---cccccEE--EECC
Confidence            999999998      7899999999999999999963     3599999999999999877643   4555555  8999


Q ss_pred             EEEEEcCCCC-CCCCcEEEEeecCCCCCCccCcEEeecCCCCCCceeeeeEEe
Q 013797          383 ELLVIGASST-SSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVM  434 (436)
Q Consensus       383 ~l~v~GG~~~-~~~~~~~~y~~~p~~d~~~~~W~~l~~~~~~~~~~~~~~~~~  434 (436)
                      +||++||.++ ..+..+++|  ||++|    +|+....  +...+...+|+++
T Consensus       524 ~ly~vGG~~~~~~l~~ve~y--dp~~d----~W~~~~~--~~~~~~~~~~~~~  568 (571)
T KOG4441|consen  524 KLYAVGGFDGNNNLNTVECY--DPETD----TWTEVTE--PESGRGGAGVAVI  568 (571)
T ss_pred             EEEEEecccCccccceeEEc--CCCCC----ceeeCCC--ccccccCcceEEe
Confidence            9999999888 778899999  55555    9999984  4555555555554

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 7e-09
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 8e-09
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 3e-08
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 3e-08
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 1e-07
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-07
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-07
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-06
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 9e-06
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 70/180 (38%), Gaps = 19/180 (10%)
Query: 186 AGTHLIVSGNEIEGGVIWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGS 245
            G+H  +  N +E     RYE E + W     M   R     A      +  GG   DG+
Sbjct: 129 GGSHGCIHHNSVE-----RYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGG--FDGT 181
Query: 246 GVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEY 305
             LNSAE Y PE   W  +  M   R     C + N  Y  GG + +D+ L   E YD  
Sbjct: 182 NRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQ-LNSVERYDVE 240
Query: 306 AGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSL-----ETSSNELRVYLKDSNSWKNL 360
             TW  +       P +  +S   I V    +Y L      T  + +  Y  D+++W  +
Sbjct: 241 TETWTFVA------PMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEV 294
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-19
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-28
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-10
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 5e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-27
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-24
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-14
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-28
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 4e-13
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-04
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-26
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-25
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-18
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 3e-19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-09
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 6e-06
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 3e-11
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-06
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-08
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
 Score =  114 bits (287), Expect = 5e-29
 Identities = 50/242 (20%), Positives = 79/242 (32%), Gaps = 36/242 (14%)

Query: 203 WRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWD 262
             Y   TN W     M  PR            +  GG    G    NS ERY PE   W 
Sbjct: 93  DCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGS--HGCIHHNSVERYEPERDEWH 150

Query: 263 SLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAE 322
            +  M  RR       ++   Y +GG +  +  L   E Y      W  I          
Sbjct: 151 LVAPMLTRRIGVGVAVLNRLLYAVGGFDGTN-RLNSAECYYPERNEWRMIT------AMN 203

Query: 323 TGKSPPLIAVVNNELY-------SLETSSNELRVYLKDSNSWKNLGLVPV-RADFNRGWG 374
           T +S   + V++N +Y         + +S E   Y  ++ +W  +  +   R+      G
Sbjct: 204 TIRSGAGVCVLHNCIYAAGGYDGQDQLNSVE--RYDVETETWTFVAPMKHRRSAL----G 257

Query: 375 IAFKSLGNELLVI-GASSTSSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSV 433
           I        + V+ G    +  +S+  Y   P +D     W  +      ++       V
Sbjct: 258 IT--VHQGRIYVLGGYDGHTFLDSVECY--DPDTD----TWSEVT----RMTSGRSGVGV 305

Query: 434 MV 435
            V
Sbjct: 306 AV 307
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.93
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.9
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.77
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.67
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.37
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.35
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.24
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.2
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.98
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.97
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.91
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.84
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.76
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.75
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.51
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.49
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.48
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.47
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.42
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.34
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.27
3jrp_A379 Fusion protein of protein transport protein SEC13 97.25
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.25
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.18
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.15
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.12
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.06
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.01
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.99
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.95
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.95
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.89
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.89
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.88
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.83
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.83
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.83
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.71
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.71
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.68
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.65
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.63
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.59
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.58
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.55
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.53
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.5
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.49
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.47
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.45
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.4
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.4
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.39
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.39
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.39
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.33
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.32
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.29
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.27
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.26
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.26
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.23
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.22
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.22
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.2
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.18
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.17
3jro_A 753 Fusion protein of protein transport protein SEC13 96.17
2pm7_B297 Protein transport protein SEC13, protein transport 96.13
3v65_B386 Low-density lipoprotein receptor-related protein; 96.1
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.05
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.04
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.03
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.01
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.01
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.01
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.98
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.98
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.98
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.9
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.89
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.8
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.8
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.78
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.78
3v65_B386 Low-density lipoprotein receptor-related protein; 95.7
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.7
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.65
2pm7_B297 Protein transport protein SEC13, protein transport 95.58
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.5
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.5
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.5
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.49
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.49
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.46
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.46
3jro_A 753 Fusion protein of protein transport protein SEC13 95.43
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.39
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.36
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.36
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.34
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.31
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.28
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.23
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.22
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.2
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.14
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.13
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.07
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.03
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.98
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.96
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.95
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.89
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.89
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.83
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.82
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.78
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.71
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 94.69
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.63
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 94.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.61
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.59
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.57
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.56
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.54
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.53
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.5
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.46
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 94.46
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.3
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.27
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.18
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.15
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.14
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.06
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.05
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.01
2p4o_A306 Hypothetical protein; putative lactonase, structur 93.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.93
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.87
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.83
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 93.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.73
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.7
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.68
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 93.63
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 93.62
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.5
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.5
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.49
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.46
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.35
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.31
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.26
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.26
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.16
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.14
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.12
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 93.11
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 93.09
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.06
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 93.0
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.89
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 92.85
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.73
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 92.7
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.58
3ott_A758 Two-component system sensor histidine kinase; beta 92.51
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 92.48
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.46
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 92.45
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.45
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 92.37
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 92.29
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 92.27
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 92.25
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.01
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.99
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 91.98
1itv_A195 MMP9; adaptive molecular recognition, beta propell 91.8
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 91.74
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 91.52
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.44
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.37
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.19
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 91.04
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 91.01
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.98
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 90.72
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 90.61
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.35
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 90.09
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 90.09
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 90.08
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.07
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 89.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 89.89
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.76
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 89.66
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 89.17
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 88.99
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 88.99
3ott_A758 Two-component system sensor histidine kinase; beta 88.95
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 88.64
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 88.52
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 88.25
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 88.17
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 88.0
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.5
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 87.24
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 86.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 86.79
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 86.72
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 86.6
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 86.55
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 86.55
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 86.35
1itv_A195 MMP9; adaptive molecular recognition, beta propell 86.34
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 86.25
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 85.79
2xyi_A430 Probable histone-binding protein CAF1; transcripti 85.58
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 85.29
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 85.1
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 84.49
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 84.26
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 84.24
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 83.79
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.62
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 83.56
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 83.23
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 83.08
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 82.53
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 82.4
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 82.26
2ymu_A577 WD-40 repeat protein; unknown function, two domain 81.73
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 81.58
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 81.46
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 80.89
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 80.65
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 80.19
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=1.8e-41  Score=323.91  Aligned_cols=268  Identities=20%  Similarity=0.278  Sum_probs=229.2

Q ss_pred             CCeEEEecc----CCCeEEEEecCCCCeEeCCCCCCCCCccCCCeeeEEeCCEEEEEceec----C---CCeEEEEECCC
Q 013797          141 EPSVFMLAS----GDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEI----E---GGVIWRYELET  209 (436)
Q Consensus       141 ~~~l~~~~~----~~~~~~~~dp~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~----~---~~~v~~ydp~t  209 (436)
                      ...++++.+    ..+.+++||+.+++|..++++|.++..+    +++..++.||++||..    .   .+.+++||+.+
T Consensus        24 ~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~----~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~d~~~   99 (308)
T 1zgk_A           24 GRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVPRSGL----AGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMT   99 (308)
T ss_dssp             CCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSCCBSC----EEEEETTEEEEECCEEEETTEEEECCCEEEEETTT
T ss_pred             CCEEEEEeCcCCCCcceEEEEcCCCCeEeECCCCCcccccc----eEEEECCEEEEECCCcCCCCCCeecceEEEECCCC
Confidence            355677655    2368999999999999999999887644    3678899999999973    2   26899999999


Q ss_pred             CCEEeCCCCCCCCcccEEEEeCCEEEEEcCcCCCCCCccceEEEEeCCCCCeEeCCCCccCCcceeEEEECCEEEEEecc
Q 013797          210 NNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGR  289 (436)
Q Consensus       210 ~~W~~l~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~iyv~gG~  289 (436)
                      ++|++++++|.+|..|++++++++||++||.....  ..+++++||+.+++|+.++++|.+|..+++++++++||++||.
T Consensus       100 ~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~--~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~  177 (308)
T 1zgk_A          100 NQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCI--HHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF  177 (308)
T ss_dssp             TEEEECCCCSSCCBTCEEEEETTEEEEECCEETTE--ECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCB
T ss_pred             CeEeECCCCCcCccccEEEEECCEEEEEcCCCCCc--ccccEEEECCCCCeEeECCCCCccccceEEEEECCEEEEEeCC
Confidence            99999999999999999999999999999987643  5788999999999999999999999999999999999999998


Q ss_pred             CCCCCcCCEEEEEECCCCcEEEcCCCCCCCCCCCCCCCCEEEEECCEEEEEecC-----CCeEEEEECCCCcEEEcccCC
Q 013797          290 NEKDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETS-----SNELRVYLKDSNSWKNLGLVP  364 (436)
Q Consensus       290 ~~~~~~~~~v~~yD~~~~~W~~v~~~~~~~~~~~~r~~~~~~~~~g~lyv~gg~-----~~~i~~yd~~~~~W~~v~~~p  364 (436)
                      +... ..+++++||+.+++|+.++++|      .+|..+++++++++||++||.     .+++++||+++++|++++.+|
T Consensus       178 ~~~~-~~~~~~~yd~~~~~W~~~~~~p------~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p  250 (308)
T 1zgk_A          178 DGTN-RLNSAECYYPERNEWRMITAMN------TIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMK  250 (308)
T ss_dssp             CSSC-BCCCEEEEETTTTEEEECCCCS------SCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCS
T ss_pred             CCCC-cCceEEEEeCCCCeEeeCCCCC------CccccceEEEECCEEEEEeCCCCCCccceEEEEeCCCCcEEECCCCC
Confidence            7665 5889999999999999999887      688999999999999999986     468999999999999998776


Q ss_pred             CccCCCCCceEEEEEeCCEEEEEcCCCC-CCCCcEEEEeecCCCCCCccCcEEeecCCCCCCceeeeeEEe
Q 013797          365 VRADFNRGWGIAFKSLGNELLVIGASST-SSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSVM  434 (436)
Q Consensus       365 ~~~~~~~~~~~~~~~~~~~l~v~GG~~~-~~~~~~~~y~~~p~~d~~~~~W~~l~~~~~~~~~~~~~~~~~  434 (436)
                      .+   +..++++  .++++|||+||.+. ....++++|  ||    ++++|++++  ++|.+|+.|+|++|
T Consensus       251 ~~---r~~~~~~--~~~~~i~v~GG~~~~~~~~~v~~y--d~----~~~~W~~~~--~~p~~r~~~~~~~l  308 (308)
T 1zgk_A          251 HR---RSALGIT--VHQGRIYVLGGYDGHTFLDSVECY--DP----DTDTWSEVT--RMTSGRSGVGVAVT  308 (308)
T ss_dssp             SC---CBSCEEE--EETTEEEEECCBCSSCBCCEEEEE--ET----TTTEEEEEE--ECSSCCBSCEEEEC
T ss_pred             CC---ccceEEE--EECCEEEEEcCcCCCcccceEEEE--cC----CCCEEeecC--CCCCCcccceeEeC
Confidence            43   4455444  78999999999876 345566666  54    455999998  56899999999875
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 436
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 7e-05
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.8 bits (135), Expect = 1e-09
 Identities = 31/113 (27%), Positives = 43/113 (38%), Gaps = 3/113 (2%)

Query: 202 IWRYELETNNWFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSW 261
              Y  E N W    +M   R            + AGG+       LNS ERY+ ET++W
Sbjct: 166 AECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQD--QLNSVERYDVETETW 223

Query: 262 DSLPGMRQRRKLCSGCYMDNKFYVIGGRNEKDKPLTCGEAYDEYAGTWYHIPD 314
             +  M+ RR          + YV+GG +     L   E YD    TW  +  
Sbjct: 224 TFVAPMKHRRSALGITVHQGRIYVLGGYDG-HTFLDSVECYDPDTDTWSEVTR 275
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.98
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.94
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.13
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.97
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.58
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.11
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.06
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.44
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.37
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.3
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.11
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.79
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.68
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.66
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.55
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.53
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.51
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.18
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.12
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.09
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 93.89
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.86
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 93.84
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.64
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.44
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.36
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 93.16
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.11
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.07
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.04
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.8
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.67
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 92.56
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 92.46
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.23
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 91.91
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.76
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.61
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.44
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.43
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 90.8
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.76
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.47
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 89.87
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 89.27
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 89.1
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 89.06
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 88.93
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.66
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.76
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 85.54
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 85.2
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 84.66
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 84.46
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 83.72
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 82.96
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 82.93
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 82.12
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 81.67
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.59
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-36  Score=284.83  Aligned_cols=265  Identities=20%  Similarity=0.276  Sum_probs=224.7

Q ss_pred             eEEEecc----CCCeEEEEecCCCCeEeCCCCCCCCCccCCCeeeEEeCCEEEEEceecC-------CCeEEEEECCCCC
Q 013797          143 SVFMLAS----GDSSWWAFDRHFQTRRKLPELPSDPCFKLGDKESLCAGTHLIVSGNEIE-------GGVIWRYELETNN  211 (436)
Q Consensus       143 ~l~~~~~----~~~~~~~~dp~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~-------~~~v~~ydp~t~~  211 (436)
                      .+|++.+    ....+++||+.+++|.+++++|.++..+    ++++.+++|||+||...       .+++++||+.+++
T Consensus         6 ~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~R~~~----~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~   81 (288)
T d1zgka1           6 LIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVPRSGL----AGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQ   81 (288)
T ss_dssp             CEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSCCBSC----EEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTE
T ss_pred             EEEEECCcCCCCCceEEEEECCCCeEEECCCCCCcccee----EEEEECCEEEEEeCcccCCCCccccchhhhccccccc
Confidence            4666655    2357889999999999999999887654    37788999999999532       2689999999999


Q ss_pred             EEeCCCCCCCCcccEEEEeCCEEEEEcCcCCCCCCccceEEEEeCCCCCeEeCCCCccCCcceeEEEECCEEEEEeccCC
Q 013797          212 WFKGPSMRRPRCLFASATCGTFAFVAGGHGMDGSGVLNSAERYNPETKSWDSLPGMRQRRKLCSGCYMDNKFYVIGGRNE  291 (436)
Q Consensus       212 W~~l~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~iyv~gG~~~  291 (436)
                      |++++++|.+|..|+++++++++|++||.....  ..++++.||+.+++|...+.++..|..++++++++++|++||.+.
T Consensus        82 w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~  159 (288)
T d1zgka1          82 WSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCI--HHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG  159 (288)
T ss_dssp             EEECCCCSSCCBTCEEEEETTEEEEECCEETTE--ECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCS
T ss_pred             ccccccccceecceeccccceeeEEecceeccc--ccceeeeeccccCccccccccccccccceeeeeeecceEecCccc
Confidence            999999999999999999999999999987654  678899999999999999999999999999999999999999876


Q ss_pred             CCCcCCEEEEEECCCCcEEEcCCCCCCCCCCCCCCCCEEEEECCEEEEEecC-----CCeEEEEECCCCcEEEcccCCCc
Q 013797          292 KDKPLTCGEAYDEYAGTWYHIPDILKDFPAETGKSPPLIAVVNNELYSLETS-----SNELRVYLKDSNSWKNLGLVPVR  366 (436)
Q Consensus       292 ~~~~~~~v~~yD~~~~~W~~v~~~~~~~~~~~~r~~~~~~~~~g~lyv~gg~-----~~~i~~yd~~~~~W~~v~~~p~~  366 (436)
                      .. ....++.||+.+++|...+..+      ..+..+++++.+++||++||.     .+..+.||..+++|+.++.+|. 
T Consensus       160 ~~-~~~~~~~~d~~~~~~~~~~~~~------~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p~-  231 (288)
T d1zgka1         160 TN-RLNSAECYYPERNEWRMITAMN------TIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKH-  231 (288)
T ss_dssp             SC-BCCCEEEEETTTTEEEECCCCS------SCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSS-
T ss_pred             cc-ccceEEEeeccccccccccccc------cccccccccceeeeEEEecCccccccccceeeeeecceeeecccCccC-
Confidence            55 6778999999999999998776      567788899999999999874     4578999999999999986664 


Q ss_pred             cCCCCCceEEEEEeCCEEEEEcCCCC-CCCCcEEEEeecCCCCCCccCcEEeecCCCCCCceeeeeEE
Q 013797          367 ADFNRGWGIAFKSLGNELLVIGASST-SSHESMAIYTCCPSSDAGELQWRLLECGKRPLSHFIHNCSV  433 (436)
Q Consensus       367 ~~~~~~~~~~~~~~~~~l~v~GG~~~-~~~~~~~~y~~~p~~d~~~~~W~~l~~~~~~~~~~~~~~~~  433 (436)
                        .|..++++  .++++|||+||.+. .....+++|  ||    ++++|++|+  ++|.+|..|+++|
T Consensus       232 --~r~~~~~~--~~~~~l~v~GG~~~~~~~~~v~~y--d~----~~~~W~~~~--~~p~~R~~~~~~~  287 (288)
T d1zgka1         232 --RRSALGIT--VHQGRIYVLGGYDGHTFLDSVECY--DP----DTDTWSEVT--RMTSGRSGVGVAV  287 (288)
T ss_dssp             --CCBSCEEE--EETTEEEEECCBCSSCBCCEEEEE--ET----TTTEEEEEE--ECSSCCBSCEEEE
T ss_pred             --cccceEEE--EECCEEEEEecCCCCeecceEEEE--EC----CCCEEEECC--CCCCCcEeEEEEE
Confidence              35555544  78999999999876 555667777  54    455999999  6788999998776
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure