Citrus Sinensis ID: 013810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MSLFKHLLRNPTAKSYSYSSPSIIMPSNLILTCLSHFTTDASPSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQRGKENTFLVY
cccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHccccccEEEEEcccccccccccHHHHcccccccccccccHHcccccccccccEEEEEEEEEEEEccccEEEEEEcccccccccccEEEEcccEEEEEccccccccccccHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEcccEEEEEccEEEEccccEEccccEEEccccccccccccccccccccccEEEcccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccc
ccHHHHHcccccccccccccccccccccccHHEEEEEEcccccccccccccccccccccccccEEEEEcccHHHHHHHHHHcccccEEEEEcccccEEEcccHHHHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccEEEEEEccccccccccccEEEEccEEEEEEcccccccccccHHHHcccHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEccccEEcccEEEEEccccccHHHHHccccccccccEEEcccccccccccEEEEEccHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEcccccEEEEEEcccccccccEEEc
mslfkhllrnptaksysysspsiimpsnlILTCLshfttdaspstvqltqysglgptkanekprvvvlgsgwagcrlmkgidtslydvvcvsprnhmvftpllastcvgtlefrsvaepiariqpaisrepgsyfflshcagidtdnhvvhCETVtdelrtlepwkfkISYDKLVIALGaeastfgihgvKENATFLREVHHAQEIRRKLLLNLMlsdvpgiseeeKSRLLHCVVvgggptgvefsgELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGivkdvdsqklilndgtevpyGLLVWstgvgpstlvksldlpkspggrigidewlrvpsvqdvfavgdcsgylestgktvlpaLAQVSYEQLHlfqkpsfllarnwcwffDVCSLTSILNRLqrgkentflvy
mslfkhllrnptaksysysspsIIMPSNLILTCLSHFTTDASPSTVQLTQYSGlgptkanekprVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDelrtlepwKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYAttqlsksgvrlvRGIVkdvdsqklilndgtevpYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSIlnrlqrgkentflvy
MSLFKHLLRNPTAKsysysspsiimpsNLILTCLSHFTTDASPSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQRGKENTFLVY
*********************SIIMPSNLILTCLSHFTTDASPSTVQLTQYSGL*******KPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQR*********
*SLFKHLLRNP******************ILT*********************************VVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVK********GGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQRGK**TFLVY
MSLFKHLLRNPTAKSYSYSSPSIIMPSNLILTCLSHFTTDASPSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQRGKENTFLVY
********************PSIIMPSNLILTCLSHFTTDASPS***************NEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQRGKENTFLVY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFKHLLRNPTAKSYSYSSPSIIMPSNLILTCLSHFTTDASPSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFLLARNWCWFFDVCSLTSILNRLQRGKENTFLVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query436 2.2.26 [Sep-21-2011]
O80874508 Alternative NAD(P)H dehyd yes no 0.807 0.692 0.835 1e-168
Q8GWA1510 Alternative NAD(P)H dehyd no no 0.885 0.756 0.755 1e-165
Q55CD9451 Probable NADH dehydrogena yes no 0.802 0.776 0.375 1e-64
Q1JPL4 571 NAD(P)H dehydrogenase B1, no no 0.699 0.534 0.401 5e-61
F4JJJ3 580 NAD(P)H dehydrogenase B3, no no 0.747 0.562 0.393 4e-57
O43090551 Probable NADH-ubiquinone yes no 0.720 0.569 0.380 2e-56
Q94BV7 582 NAD(P)H dehydrogenase B2, no no 0.706 0.529 0.397 3e-55
O14121551 Probable NADH-ubiquinone no no 0.731 0.578 0.362 3e-53
Q9SKT7 582 NAD(P)H dehydrogenase B4, no no 0.701 0.525 0.388 1e-50
P40215560 External NADH-ubiquinone yes no 0.805 0.626 0.358 4e-46
>sp|O80874|NDA2_ARATH Alternative NAD(P)H dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=1 SV=1 Back     alignment and function desciption
 Score =  592 bits (1525), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/352 (83%), Positives = 319/352 (90%)

Query: 43  PSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPL 102
           P+ V  +QYSGL PT+  EKPRVVVLGSGWAGCRLMKGIDT+LYDVVCVSPRNHMVFTPL
Sbjct: 52  PNDVDRSQYSGLPPTREGEKPRVVVLGSGWAGCRLMKGIDTNLYDVVCVSPRNHMVFTPL 111

Query: 103 LASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTL 162
           LASTCVGTLEFRSVAEPI+RIQPAISREPGS+FFL++C+ +D D H VHCET+TD L TL
Sbjct: 112 LASTCVGTLEFRSVAEPISRIQPAISREPGSFFFLANCSRLDADAHEVHCETLTDGLNTL 171

Query: 163 EPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGI 222
           +PWKFKI+YDKLVIA GAEASTFGIHGV ENA FLREVHHAQEIRRKLLLNLMLSD PGI
Sbjct: 172 KPWKFKIAYDKLVIASGAEASTFGIHGVMENAIFLREVHHAQEIRRKLLLNLMLSDTPGI 231

Query: 223 SEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSF 282
           S+EEK RLLHCVVVGGGPTGVEFSGELSDFIM+DVRQRY+HVKD IHVTLIEA +ILSSF
Sbjct: 232 SKEEKRRLLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYAHVKDDIHVTLIEARDILSSF 291

Query: 283 DDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSL 342
           DDRLR YA  QL+KSGVR VRGIVKDV SQKLIL+DGTEVPYGLLVWSTGVGPS  V+SL
Sbjct: 292 DDRLRRYAIKQLNKSGVRFVRGIVKDVQSQKLILDDGTEVPYGLLVWSTGVGPSPFVRSL 351

Query: 343 DLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQ 394
            LPK P GRIGIDEW+RVPSVQDVFA+GDCSGYLE+TGK  LPALAQV+  +
Sbjct: 352 GLPKDPTGRIGIDEWMRVPSVQDVFAIGDCSGYLETTGKPTLPALAQVAERE 403

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|Q8GWA1|NDA1_ARATH Alternative NAD(P)H dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 Back     alignment and function description
>sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 Back     alignment and function description
>sp|Q1JPL4|NDB1_ARATH NAD(P)H dehydrogenase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 Back     alignment and function description
>sp|F4JJJ3|NDB3_ARATH NAD(P)H dehydrogenase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 Back     alignment and function description
>sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 Back     alignment and function description
>sp|Q94BV7|NDB2_ARATH NAD(P)H dehydrogenase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 Back     alignment and function description
>sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 Back     alignment and function description
>sp|Q9SKT7|NDB4_ARATH NAD(P)H dehydrogenase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 Back     alignment and function description
>sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
255569381472 Rotenone-insensitive NADH-ubiquinone oxi 0.894 0.826 0.811 1e-177
118488127488 unknown [Populus trichocarpa] 0.878 0.784 0.796 1e-172
357490831 566 hypothetical protein MTR_5g071250 [Medic 0.889 0.685 0.751 1e-170
356500874485 PREDICTED: probable NADH dehydrogenase-l 0.871 0.783 0.758 1e-169
297826393504 NDA2 H dehydrogenase 2 [Arabidopsis lyra 0.903 0.781 0.764 1e-167
449450824505 PREDICTED: alternative NAD(P)H dehydroge 0.903 0.780 0.755 1e-167
356553084485 PREDICTED: probable NADH dehydrogenase-l 0.871 0.783 0.753 1e-167
15227684508 NADH dehydrogenase [Arabidopsis thaliana 0.807 0.692 0.835 1e-166
224104264452 predicted protein [Populus trichocarpa] 0.793 0.765 0.852 1e-166
356539622509 PREDICTED: probable NADH dehydrogenase-l 0.903 0.774 0.737 1e-165
>gi|255569381|ref|XP_002525658.1| Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial precursor, putative [Ricinus communis] gi|223535094|gb|EEF36776.1| Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  628 bits (1620), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 322/397 (81%), Positives = 350/397 (88%), Gaps = 7/397 (1%)

Query: 1   MSLFKHLLRNPTAKSYSYSS---PSIIMPSNLILTCLSHFTTDASPSTVQLTQYSGLGPT 57
           MS F +L+R  T KS S S+   P +I   N +++ L HF+T A P      QY+GL PT
Sbjct: 1   MSWFTNLIRISTVKSASSSTKSLPPLITNPNFLISSLFHFSTHAHPPP----QYAGLPPT 56

Query: 58  KANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVA 117
           K  EKPR+VVLGSGWAGCRLMKGIDT LYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVA
Sbjct: 57  KPGEKPRLVVLGSGWAGCRLMKGIDTKLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVA 116

Query: 118 EPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIA 177
           EPIARIQPAIS+EPGSYFFL++   IDT +H+VHCET TD   T++PWKF ISYDKLVIA
Sbjct: 117 EPIARIQPAISKEPGSYFFLANSTAIDTHSHLVHCETATDGSSTMDPWKFDISYDKLVIA 176

Query: 178 LGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVG 237
           LGAEASTFGIHGVKE+A FLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVG
Sbjct: 177 LGAEASTFGIHGVKEHAIFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVG 236

Query: 238 GGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKS 297
           GGPTGVEFSGELSDFI RDVRQRY+HVKDYIHVTLIEANEILSSFDDRLRHYAT QL+KS
Sbjct: 237 GGPTGVEFSGELSDFITRDVRQRYAHVKDYIHVTLIEANEILSSFDDRLRHYATKQLTKS 296

Query: 298 GVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEW 357
           GV+LVRGIVKDV  QKL+L+DG+EVPYGLLVWSTGVGPS LVKSLDLPKSPGGRIGIDEW
Sbjct: 297 GVQLVRGIVKDVKPQKLVLSDGSEVPYGLLVWSTGVGPSHLVKSLDLPKSPGGRIGIDEW 356

Query: 358 LRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQ 394
           LRVPSV DVFA+GDCSG+LESTGK+VLPALAQV+  Q
Sbjct: 357 LRVPSVPDVFAIGDCSGFLESTGKSVLPALAQVAERQ 393

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118488127|gb|ABK95883.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357490831|ref|XP_003615703.1| hypothetical protein MTR_5g071250 [Medicago truncatula] gi|355517038|gb|AES98661.1| hypothetical protein MTR_5g071250 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356500874|ref|XP_003519255.1| PREDICTED: probable NADH dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|297826393|ref|XP_002881079.1| NDA2 H dehydrogenase 2 [Arabidopsis lyrata subsp. lyrata] gi|297326918|gb|EFH57338.1| NDA2 H dehydrogenase 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449450824|ref|XP_004143162.1| PREDICTED: alternative NAD(P)H dehydrogenase 1, mitochondrial-like [Cucumis sativus] gi|449523139|ref|XP_004168582.1| PREDICTED: alternative NAD(P)H dehydrogenase 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553084|ref|XP_003544888.1| PREDICTED: probable NADH dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|15227684|ref|NP_180560.1| NADH dehydrogenase [Arabidopsis thaliana] gi|75318710|sp|O80874.1|NDA2_ARATH RecName: Full=Alternative NAD(P)H dehydrogenase 2, mitochondrial; Flags: Precursor gi|3420052|gb|AAC31853.1| putative NADH dehydrogenase (ubiquinone oxidoreductase) [Arabidopsis thaliana] gi|330253238|gb|AEC08332.1| NADH dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224104264|ref|XP_002313376.1| predicted protein [Populus trichocarpa] gi|222849784|gb|EEE87331.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356539622|ref|XP_003538295.1| PREDICTED: probable NADH dehydrogenase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
TAIR|locus:2045708508 NDA2 "AT2G29990" [Arabidopsis 0.800 0.687 0.842 2.9e-158
TAIR|locus:2007427510 NDA1 "AT1G07180" [Arabidopsis 0.784 0.670 0.833 1.7e-155
DICTYBASE|DDB_G0270104451 DDB_G0270104 "putative NADH de 0.802 0.776 0.377 5.5e-61
TAIR|locus:2119667 580 NDB3 "AT4G21490" [Arabidopsis 0.733 0.551 0.398 1.2e-60
TAIR|locus:2123713 571 NDB1 "AT4G28220" [Arabidopsis 0.711 0.542 0.398 1.3e-59
TAIR|locus:2051431 582 NDB4 "AT2G20800" [Arabidopsis 0.697 0.522 0.396 3.7e-55
DICTYBASE|DDB_G0290197 654 DDB_G0290197 "putative NADH de 0.543 0.362 0.381 2.6e-53
POMBASE|SPBC947.15c551 SPBC947.15c "mitochondrial NAD 0.736 0.582 0.385 3e-53
SGD|S000004753560 NDE1 "Mitochondrial external N 0.818 0.637 0.356 3.1e-51
UNIPROTKB|G4N8E7587 MGG_06276 "Uncharacterized pro 0.713 0.529 0.379 5.1e-51
TAIR|locus:2045708 NDA2 "AT2G29990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1542 (547.9 bits), Expect = 2.9e-158, P = 2.9e-158
 Identities = 294/349 (84%), Positives = 318/349 (91%)

Query:    43 PSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPL 102
             P+ V  +QYSGL PT+  EKPRVVVLGSGWAGCRLMKGIDT+LYDVVCVSPRNHMVFTPL
Sbjct:    52 PNDVDRSQYSGLPPTREGEKPRVVVLGSGWAGCRLMKGIDTNLYDVVCVSPRNHMVFTPL 111

Query:   103 LASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTL 162
             LASTCVGTLEFRSVAEPI+RIQPAISREPGS+FFL++C+ +D D H VHCET+TD L TL
Sbjct:   112 LASTCVGTLEFRSVAEPISRIQPAISREPGSFFFLANCSRLDADAHEVHCETLTDGLNTL 171

Query:   163 EPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGI 222
             +PWKFKI+YDKLVIA GAEASTFGIHGV ENA FLREVHHAQEIRRKLLLNLMLSD PGI
Sbjct:   172 KPWKFKIAYDKLVIASGAEASTFGIHGVMENAIFLREVHHAQEIRRKLLLNLMLSDTPGI 231

Query:   223 SEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSF 282
             S+EEK RLLHCVVVGGGPTGVEFSGELSDFIM+DVRQRY+HVKD IHVTLIEA +ILSSF
Sbjct:   232 SKEEKRRLLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYAHVKDDIHVTLIEARDILSSF 291

Query:   283 DDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSL 342
             DDRLR YA  QL+KSGVR VRGIVKDV SQKLIL+DGTEVPYGLLVWSTGVGPS  V+SL
Sbjct:   292 DDRLRRYAIKQLNKSGVRFVRGIVKDVQSQKLILDDGTEVPYGLLVWSTGVGPSPFVRSL 351

Query:   343 DLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVS 391
              LPK P GRIGIDEW+RVPSVQDVFA+GDCSGYLE+TGK  LPALAQV+
Sbjct:   352 GLPKDPTGRIGIDEWMRVPSVQDVFAIGDCSGYLETTGKPTLPALAQVA 400
GO:0003954 "NADH dehydrogenase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0031304 "intrinsic to mitochondrial inner membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
TAIR|locus:2007427 NDA1 "AT1G07180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270104 DDB_G0270104 "putative NADH dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2119667 NDB3 "AT4G21490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123713 NDB1 "AT4G28220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051431 NDB4 "AT2G20800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290197 DDB_G0290197 "putative NADH dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC947.15c SPBC947.15c "mitochondrial NADH dehydrogenase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000004753 NDE1 "Mitochondrial external NADH dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8E7 MGG_06276 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O80874NDA2_ARATH1, ., 6, ., -, ., -0.83520.80730.6929yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.4__968__AT2G29990.1
annotation not avaliable (504 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh1_pm.C_scaffold_3002392
annotation not avaliable (462 aa)
      • 0.430
scaffold_602256.1
annotation not avaliable (365 aa)
  •   • 0.425
fgenesh2_kg.6__826__AT5G08530.1
annotation not avaliable (486 aa)
     •• 0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 1e-121
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 5e-78
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 3e-39
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 9e-24
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 1e-20
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-13
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-13
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 7e-13
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 5e-12
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 2e-10
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-07
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 2e-07
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 7e-07
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 1e-06
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD 2e-06
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 2e-06
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 2e-06
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 9e-06
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 1e-05
PLN02507499 PLN02507, PLN02507, glutathione reductase 3e-05
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 3e-05
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 4e-05
PLN02546 558 PLN02546, PLN02546, glutathione reductase 5e-05
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 6e-05
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 1e-04
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 2e-04
PTZ00058 561 PTZ00058, PTZ00058, glutathione reductase; Provisi 6e-04
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 6e-04
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 0.001
TIGR02053463 TIGR02053, MerA, mercuric reductase 0.004
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.004
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information 
 Score =  359 bits (922), Expect = e-121
 Identities = 149/341 (43%), Positives = 216/341 (63%), Gaps = 11/341 (3%)

Query: 56  PTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRS 115
            T   +KP VVVLG+GWAG   ++ +D   Y++  +SPRNHM+FTPLL  T  GTLEFRS
Sbjct: 4   RTARLKKPNVVVLGTGWAGAYFVRNLDPKKYNITVISPRNHMLFTPLLPQTTTGTLEFRS 63

Query: 116 VAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLV 175
           + EP+   +PA+++ P + +  +    +D +   V C  V+          F + YDKLV
Sbjct: 64  ICEPV---RPALAKLP-NRYLRAVVYDVDFEEKRVKCGVVSKSNNANVN-TFSVPYDKLV 118

Query: 176 IALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVV 235
           +A GA  +TF I GV+E A FL+EV+HA+ IR++++  +  + +P  S EE+ RLLH VV
Sbjct: 119 VAHGARPNTFNIPGVEERAFFLKEVNHARGIRKRIVQCIERASLPTTSVEERKRLLHFVV 178

Query: 236 VGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEA-NEILSSFDDRLRHYATTQL 294
           VGGGPTGVEF+ EL+DF   DVR     + +   VT++EA +E+L SFD  LR Y   +L
Sbjct: 179 VGGGPTGVEFAAELADFFRDDVRNLNPELVEECKVTVLEAGSEVLGSFDQALRKYGQRRL 238

Query: 295 SKSGVRLV-RGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIG 353
            + GV +  +  VK+V  ++++L DG  +P GL+VWSTGVGP  L K L + K+  GRI 
Sbjct: 239 RRLGVDIRTKTAVKEVLDKEVVLKDGEVIPTGLVVWSTGVGPGPLTKQLKVDKTSRGRIS 298

Query: 354 IDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQ 394
           +D+ LRV  + +VFA+GDC+    +  +  LP LAQV+ +Q
Sbjct: 299 VDDHLRVKPIPNVFALGDCA----ANEERPLPTLAQVASQQ 335

Length = 424
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 436
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PLN02507 499 glutathione reductase 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
PRK06116450 glutathione reductase; Validated 100.0
PLN02546 558 glutathione reductase 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
PTZ00052 499 thioredoxin reductase; Provisional 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PTZ00153 659 lipoamide dehydrogenase; Provisional 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK12814 652 putative NADPH-dependent glutamate synthase small 100.0
KOG4716 503 consensus Thioredoxin reductase [Posttranslational 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 100.0
PRK12770352 putative glutamate synthase subunit beta; Provisio 100.0
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.98
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.98
PRK13984604 putative oxidoreductase; Provisional 99.98
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.97
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.97
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.96
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.96
PLN02852491 ferredoxin-NADP+ reductase 99.96
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.95
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.95
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.95
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.95
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 99.94
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.91
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.91
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.9
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.9
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.88
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.87
KOG2755334 consensus Oxidoreductase [General function predict 99.84
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.82
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.8
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.79
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.77
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.73
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.73
PTZ00188506 adrenodoxin reductase; Provisional 99.7
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.55
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.3
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.25
COG2081408 Predicted flavoproteins [General function predicti 99.14
PRK09897 534 hypothetical protein; Provisional 99.13
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.99
PLN02463447 lycopene beta cyclase 98.93
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.91
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.9
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.86
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.84
PRK10157428 putative oxidoreductase FixC; Provisional 98.84
PRK10015429 oxidoreductase; Provisional 98.82
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.81
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.8
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.78
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.76
PLN02697529 lycopene epsilon cyclase 98.75
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.75
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.74
PRK08071 510 L-aspartate oxidase; Provisional 98.74
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.73
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.73
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.72
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.71
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.71
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.7
PRK06847375 hypothetical protein; Provisional 98.7
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.7
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.7
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.68
PRK07395 553 L-aspartate oxidase; Provisional 98.68
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.65
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.64
PRK06834 488 hypothetical protein; Provisional 98.64
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.64
PRK09077536 L-aspartate oxidase; Provisional 98.64
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.64
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.64
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.63
PRK06184 502 hypothetical protein; Provisional 98.63
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.62
PRK07236386 hypothetical protein; Provisional 98.61
PLN02661357 Putative thiazole synthesis 98.6
PRK09126392 hypothetical protein; Provisional 98.6
COG0579 429 Predicted dehydrogenase [General function predicti 98.59
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.59
PLN02815 594 L-aspartate oxidase 98.57
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.57
PRK07190 487 hypothetical protein; Provisional 98.56
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.56
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.55
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.55
PRK07512513 L-aspartate oxidase; Provisional 98.55
PRK08244 493 hypothetical protein; Provisional 98.55
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.55
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.54
PRK08163396 salicylate hydroxylase; Provisional 98.53
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.52
PRK08013400 oxidoreductase; Provisional 98.52
PRK11445351 putative oxidoreductase; Provisional 98.52
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.52
PRK07045388 putative monooxygenase; Reviewed 98.52
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.49
PRK06185407 hypothetical protein; Provisional 98.49
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.48
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.48
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.47
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.47
PRK08401466 L-aspartate oxidase; Provisional 98.46
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.46
PRK06753373 hypothetical protein; Provisional 98.45
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.45
PRK06126 545 hypothetical protein; Provisional 98.45
PRK05868372 hypothetical protein; Validated 98.44
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.44
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 98.43
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.43
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.43
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.43
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.42
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.42
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.41
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.41
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.4
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.4
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.39
PTZ00383 497 malate:quinone oxidoreductase; Provisional 98.39
PRK07588391 hypothetical protein; Provisional 98.39
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.39
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.37
TIGR02053463 MerA mercuric reductase. This model represents the 98.36
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.36
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.36
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.34
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.34
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.33
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.33
PRK06370463 mercuric reductase; Validated 98.33
PRK06475400 salicylate hydroxylase; Provisional 98.33
PLN02985514 squalene monooxygenase 98.33
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.3
PRK07846451 mycothione reductase; Reviewed 98.28
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.28
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.27
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.27
PRK06116450 glutathione reductase; Validated 98.26
PRK14694468 putative mercuric reductase; Provisional 98.26
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.25
PRK06996398 hypothetical protein; Provisional 98.25
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.25
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.23
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.23
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.23
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.23
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.23
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.23
PRK11728393 hydroxyglutarate oxidase; Provisional 98.23
COG2081 408 Predicted flavoproteins [General function predicti 98.22
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.22
PLN02507499 glutathione reductase 98.22
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.21
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.19
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.19
PRK13512438 coenzyme A disulfide reductase; Provisional 98.18
PRK06175433 L-aspartate oxidase; Provisional 98.16
PTZ00367 567 squalene epoxidase; Provisional 98.16
PTZ00058561 glutathione reductase; Provisional 98.15
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.15
PRK13339 497 malate:quinone oxidoreductase; Reviewed 98.15
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 98.14
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.13
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.11
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.11
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.1
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.1
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.09
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.09
PRK14727479 putative mercuric reductase; Provisional 98.08
PRK13748561 putative mercuric reductase; Provisional 98.08
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.08
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 98.07
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.07
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.06
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.05
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.04
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.04
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.01
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.0
PRK07208 479 hypothetical protein; Provisional 98.0
PTZ00052499 thioredoxin reductase; Provisional 98.0
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.97
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.97
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.95
COG3349 485 Uncharacterized conserved protein [Function unknow 97.92
PLN02546558 glutathione reductase 97.92
PTZ00153659 lipoamide dehydrogenase; Provisional 97.91
PRK06847 375 hypothetical protein; Provisional 97.88
PLN02268435 probable polyamine oxidase 97.88
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.88
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.87
PRK10262321 thioredoxin reductase; Provisional 97.86
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.86
PRK07538413 hypothetical protein; Provisional 97.85
PRK07233434 hypothetical protein; Provisional 97.85
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 97.83
PRK12770 352 putative glutamate synthase subunit beta; Provisio 97.83
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.82
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.81
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.81
PLN02576 496 protoporphyrinogen oxidase 97.8
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 97.79
PLN02463 447 lycopene beta cyclase 97.79
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.79
PRK08294 634 phenol 2-monooxygenase; Provisional 97.79
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.78
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.78
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.78
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.77
PRK12831 464 putative oxidoreductase; Provisional 97.75
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.74
PLN02568 539 polyamine oxidase 97.74
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 97.74
PRK08274466 tricarballylate dehydrogenase; Validated 97.73
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.73
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.73
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.73
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.73
PRK12416463 protoporphyrinogen oxidase; Provisional 97.72
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.72
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.71
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.71
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.7
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 97.7
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.69
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.69
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.68
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.67
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.67
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 97.66
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.66
PLN02852 491 ferredoxin-NADP+ reductase 97.66
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 97.66
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 97.64
PLN02529 738 lysine-specific histone demethylase 1 97.63
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.61
PRK07121492 hypothetical protein; Validated 97.61
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 97.58
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.57
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.56
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.55
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.55
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.54
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.54
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.53
PLN02487 569 zeta-carotene desaturase 97.53
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.52
PRK07236 386 hypothetical protein; Provisional 97.52
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 97.52
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.51
PLN02676487 polyamine oxidase 97.51
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 97.51
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.51
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.51
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.51
PRK07804 541 L-aspartate oxidase; Provisional 97.5
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 97.5
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.49
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.49
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.48
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.48
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.47
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.47
PRK06834 488 hypothetical protein; Provisional 97.46
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.45
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.44
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.44
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 97.44
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.42
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.41
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 97.41
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.41
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.4
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 97.39
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 97.39
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.39
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.39
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.39
PLN02612567 phytoene desaturase 97.36
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.36
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.36
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.35
PLN02661357 Putative thiazole synthesis 97.35
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.33
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.32
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 97.32
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.31
PLN02697 529 lycopene epsilon cyclase 97.31
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.3
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 97.3
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.3
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.3
PRK08163 396 salicylate hydroxylase; Provisional 97.29
PTZ00188 506 adrenodoxin reductase; Provisional 97.27
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.25
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.25
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.24
PRK08275 554 putative oxidoreductase; Provisional 97.23
PRK05257 494 malate:quinone oxidoreductase; Validated 97.23
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.21
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.21
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.21
PRK09126 392 hypothetical protein; Provisional 97.18
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.18
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.17
KOG2852380 consensus Possible oxidoreductase [General functio 97.16
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.16
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.16
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 97.16
PRK12839 572 hypothetical protein; Provisional 97.16
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.15
PRK07588 391 hypothetical protein; Provisional 97.14
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.13
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.11
KOG0404322 consensus Thioredoxin reductase [Posttranslational 97.11
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.1
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.09
KOG2755 334 consensus Oxidoreductase [General function predict 97.08
PRK13984 604 putative oxidoreductase; Provisional 97.08
PRK06184 502 hypothetical protein; Provisional 97.07
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.07
PLN03000 881 amine oxidase 97.06
PRK02106 560 choline dehydrogenase; Validated 97.05
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.04
PRK07045 388 putative monooxygenase; Reviewed 97.04
PRK08244 493 hypothetical protein; Provisional 97.04
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.04
PRK05868 372 hypothetical protein; Validated 97.04
KOG1276 491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.03
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 97.03
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.02
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 96.99
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.97
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 96.96
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.94
PLN02976 1713 amine oxidase 96.93
PRK11728393 hydroxyglutarate oxidase; Provisional 96.91
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.91
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.91
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.9
PRK10157 428 putative oxidoreductase FixC; Provisional 96.88
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.88
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 96.87
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.86
PRK06753 373 hypothetical protein; Provisional 96.84
PRK07190 487 hypothetical protein; Provisional 96.84
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.83
PRK08013 400 oxidoreductase; Provisional 96.78
KOG2960328 consensus Protein involved in thiamine biosynthesi 96.78
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.77
PRK06475 400 salicylate hydroxylase; Provisional 96.75
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.74
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.73
PLN02785 587 Protein HOTHEAD 96.68
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 96.68
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.66
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 96.63
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.61
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 96.61
PRK06185 407 hypothetical protein; Provisional 96.59
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.58
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 96.57
COG3573 552 Predicted oxidoreductase [General function predict 96.55
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.54
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 96.52
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 96.51
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.5
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.5
PRK06996 398 hypothetical protein; Provisional 96.47
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 96.45
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 96.45
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.45
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.44
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 96.39
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 96.38
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.38
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.37
PRK10015 429 oxidoreductase; Provisional 96.35
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.35
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.33
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 96.32
PRK09897 534 hypothetical protein; Provisional 96.28
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.27
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.21
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.2
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 96.13
TIGR00275 400 flavoprotein, HI0933 family. The model when search 96.12
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.11
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.07
KOG2853509 consensus Possible oxidoreductase [General functio 96.0
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.99
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 95.98
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 95.97
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.96
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 95.88
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 95.86
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.84
PRK06719157 precorrin-2 dehydrogenase; Validated 95.82
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 95.8
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.8
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 95.76
KOG2852 380 consensus Possible oxidoreductase [General functio 95.66
PRK11445351 putative oxidoreductase; Provisional 95.63
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.62
PRK07538 413 hypothetical protein; Provisional 95.6
PLN02985 514 squalene monooxygenase 95.58
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 95.53
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.5
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.46
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.4
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.39
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 95.38
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.31
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 95.27
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.25
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.24
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.17
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.17
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.16
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 95.15
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.13
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 95.06
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 95.0
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 94.89
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.85
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 94.8
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 94.76
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.62
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 94.58
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 94.55
PRK04148134 hypothetical protein; Provisional 94.46
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 94.43
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 94.39
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.35
PRK08275 554 putative oxidoreductase; Provisional 94.22
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.2
PRK05562223 precorrin-2 dehydrogenase; Provisional 94.13
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 94.03
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=7.8e-53  Score=397.18  Aligned_cols=326  Identities=34%  Similarity=0.535  Sum_probs=285.7

Q ss_pred             CCCcEEEECCchHHHHHHHhcccCC--CeEEEEcCCCcceecchhhhhhcCcccccccccchhhcchhhhcCCCcEEEEe
Q 013810           61 EKPRVVVLGSGWAGCRLMKGIDTSL--YDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLS  138 (436)
Q Consensus        61 ~~~~VvIIGgG~AGl~aA~~L~~~g--~~v~lie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  138 (436)
                      .+++|||||||++|+.+|..|.+..  .+|+|||+.+++.|.|+++....|..+......++....   ....++.|+++
T Consensus         2 ~~~~iVIlGgGfgGl~~a~~l~~~~~~~~itLVd~~~~hl~~plL~eva~g~l~~~~i~~p~~~~~---~~~~~v~~~~~   78 (405)
T COG1252           2 MKKRIVILGGGFGGLSAAKRLARKLPDVEITLVDRRDYHLFTPLLYEVATGTLSESEIAIPLRALL---RKSGNVQFVQG   78 (405)
T ss_pred             CCceEEEECCcHHHHHHHHHhhhcCCCCcEEEEeCCCccccchhhhhhhcCCCChhheeccHHHHh---cccCceEEEEE
Confidence            3578999999999999999999864  889999999999999999999999999888877777653   22346999999


Q ss_pred             EeEeEeCCCCEEEEEEecCCcccCCCCceeeeccEEEEeCCCCCCCCCCCCCccccccccChHHHHHHHHHHHHhccccC
Q 013810          139 HCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSD  218 (436)
Q Consensus       139 ~v~~id~~~~~v~~~~~~~g~~~~~~~~~~~~~d~lViAtG~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  218 (436)
                      +|++||++++.|.+.   ++.        .+.||+||||+|+.+..+.+||..++.+.+++++++.++++++...+....
T Consensus        79 ~V~~ID~~~k~V~~~---~~~--------~i~YD~LVvalGs~~~~fgi~G~~E~a~~lks~edA~~ir~~l~~~fe~a~  147 (405)
T COG1252          79 EVTDIDRDAKKVTLA---DLG--------EISYDYLVVALGSETNYFGIPGAAEYAFGLKTLEDALRLRRHLLEAFEKAS  147 (405)
T ss_pred             EEEEEcccCCEEEeC---CCc--------cccccEEEEecCCcCCcCCCCCHHHhCCCCCCHHHHHHHHHHHHHHHHHhh
Confidence            999999999999886   333        799999999999999999999999999999999999999999976666555


Q ss_pred             CCCCChhhhcccCcEEEECCChHHHHHHHHHHHHHHHHHHhhhcCCCCccEEEEEeCC-CCCCcccHHHHHHHHHHHHhc
Q 013810          219 VPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEAN-EILSSFDDRLRHYATTQLSKS  297 (436)
Q Consensus       219 ~p~~~~~~~~~~~~vvViG~G~~g~e~A~~l~~~~~~~~~~~~~~~~~~~~V~lv~~~-~~l~~~~~~~~~~~~~~l~~~  297 (436)
                      .+.-+    +...+++|+|||++|+|+|.+|+++..+...+ +...+.+.+|+|+++. .++|.+++++++.+++.|++.
T Consensus       148 ~~~~~----~~~lti~IvGgG~TGVElAgeL~~~~~~l~~~-~~~~~~~~~V~LVea~p~ILp~~~~~l~~~a~~~L~~~  222 (405)
T COG1252         148 QEEDD----RALLTIVIVGGGPTGVELAGELAERLHRLLKK-FRVDPSELRVILVEAGPRILPMFPPKLSKYAERALEKL  222 (405)
T ss_pred             ccccc----cceeEEEEECCChhHHHHHHHHHHHHHHHhhh-hcCCccccEEEEEccCchhccCCCHHHHHHHHHHHHHC
Confidence            33200    13347999999999999999999988655555 4433346899999995 689999999999999999999


Q ss_pred             CCEEEecc-eEEEeCCeEEEcCCcE-EecceEEEecCCCCchhccc-CCCCCCCCCcEEeCCCCCCCCCCCEEEeccccc
Q 013810          298 GVRLVRGI-VKDVDSQKLILNDGTE-VPYGLLVWSTGVGPSTLVKS-LDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSG  374 (436)
Q Consensus       298 gV~i~~~~-v~~i~~~~v~~~~g~~-i~~D~vi~a~G~~p~~~~~~-~~l~~~~~G~i~vd~~~~~t~~~~Vya~GD~~~  374 (436)
                      ||++++++ |++++++.|++++|.+ |++|++||++|.+++++.++ .+++.|..|++.||+++|++++|+|||+|||+.
T Consensus       223 GV~v~l~~~Vt~v~~~~v~~~~g~~~I~~~tvvWaaGv~a~~~~~~l~~~e~dr~Grl~V~~~L~~~~~~~IFa~GD~A~  302 (405)
T COG1252         223 GVEVLLGTPVTEVTPDGVTLKDGEEEIPADTVVWAAGVRASPLLKDLSGLETDRRGRLVVNPTLQVPGHPDIFAAGDCAA  302 (405)
T ss_pred             CCEEEcCCceEEECCCcEEEccCCeeEecCEEEEcCCCcCChhhhhcChhhhccCCCEEeCCCcccCCCCCeEEEecccc
Confidence            99999996 9999999999999985 99999999999999999998 488889999999999999999999999999999


Q ss_pred             cccCCCCccCCccHHHHHHHHHHHHhhhhhhcCC
Q 013810          375 YLESTGKTVLPALAQVSYEQLHLFQKPSFLLARN  408 (436)
Q Consensus       375 ~~~~~~~~~~~~~~~~A~~~g~~aa~~i~~~~~~  408 (436)
                      .+++   .+.|+.++.|.+||+.+|+||.....+
T Consensus       303 ~~~~---~p~P~tAQ~A~Qqg~~~a~ni~~~l~g  333 (405)
T COG1252         303 VIDP---RPVPPTAQAAHQQGEYAAKNIKARLKG  333 (405)
T ss_pred             CCCC---CCCCChhHHHHHHHHHHHHHHHHHhcC
Confidence            8654   456999999999999999999865544

>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 2e-44
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 6e-44
3hyv_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 3e-08
3hyw_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 3e-08
3iwa_A 472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 6e-07
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 9e-06
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 1e-05
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 1e-05
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 1e-05
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-04
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 1e-04
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-04
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 1e-04
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 1e-04
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 3e-04
1xhc_A367 Nadh Oxidase /nitrite Reductase From Pyrococcus Fur 5e-04
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure 
Iteration: 1

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/382 (31%), Positives = 209/382 (54%), Gaps = 42/382 (10%)
Query: 52  SGLGPT----------KANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTP 101
           SG GPT          + ++KP V++LGSGW     +K IDT  Y+V  +SPR++ +FTP
Sbjct: 22  SGAGPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTP 81
Query: 102 LLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRT 161
           LL S  VGT++ +S+ EPI     A+ ++    ++ +    I+ D + V  ++++   + 
Sbjct: 82  LLPSAPVGTVDEKSIIEPIVNF--ALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQL 139
Query: 162 LEPWKF---------KISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLL 212
            +P            +I YD L+ A+GAE +TFGI GV +   FL+E+ ++ EIRR    
Sbjct: 140 YQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAA 199
Query: 213 NLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTL 272
           NL  +++    + E+ RLL  VVVGGGPTGVE +GEL D++ +D+R+    + + + + L
Sbjct: 200 NLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHL 259
Query: 273 IEANEI-LSSFDDRLRHYATTQLSKSGVRL-VRGIVKDVDSQKLILNDGTE--------V 322
           +EA  I L+ F+ +L  YA + L  + +++ +R  V  V+ ++L+     E        +
Sbjct: 260 VEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETI 319
Query: 323 PYGLLVWSTGVGPSTLVKSL--DLPKSPGGRIG--IDEWLRVPSVQDVFAVGDCSGYLES 378
           PYG L+W+TG     ++  L   +P+    + G  ++++L+V    ++FA+GD +     
Sbjct: 320 PYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAF---- 375
Query: 379 TGKTVLPALAQVSYEQLHLFQK 400
                LP  AQV++++     K
Sbjct: 376 ---AGLPPTAQVAHQEAEYLAK 394
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure
>pdb|3HYV|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase From The Hyperthermophilic Bacterium Aquifex Aeolicus Length = 430 Back     alignment and structure
>pdb|3HYW|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase Of The Hyperthermophilic Bacterium Aquifex Aeolicus In Complex With Decylubiquinone Length = 430 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|1XHC|A Chain A, Nadh Oxidase /nitrite Reductase From Pyrococcus Furiosus Pfu-1140779- 001 Length = 367 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 1e-46
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 7e-37
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 2e-36
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 5e-31
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 1e-29
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 3e-29
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 4e-29
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 2e-26
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 4e-26
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 5e-26
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 8e-26
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 8e-25
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 1e-24
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 4e-19
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 3e-17
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 1e-15
1fec_A490 Trypanothione reductase; redox-active center, oxid 2e-15
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 3e-15
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 4e-15
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 1e-14
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 1e-13
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 1e-13
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 3e-13
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 3e-13
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 6e-13
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 9e-13
4dna_A463 Probable glutathione reductase; structural genomic 1e-12
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 6e-12
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-11
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 1e-11
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 2e-11
4fk1_A304 Putative thioredoxin reductase; structural genomic 6e-11
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 2e-10
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 3e-10
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 4e-10
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 5e-10
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 5e-10
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 7e-10
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 9e-10
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-08
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 4e-05
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 6e-05
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 2e-04
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 2e-04
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 6e-04
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
 Score =  164 bits (418), Expect = 1e-46
 Identities = 61/339 (17%), Positives = 121/339 (35%), Gaps = 27/339 (7%)

Query: 63  PRVVVLGSGWAGC----RLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAE 118
            +V+VLG  +        L + + +   DV  ++      F P L    +G  +   +  
Sbjct: 2   TKVLVLGGRFGALTAAYTLKRLVGSKA-DVKVINKSRFSYFRPALPHVAIGVRDVDELKV 60

Query: 119 PIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIAL 178
            ++   P    E G  F       ID  + +V+       +           YD +++ +
Sbjct: 61  DLSEALP----EKGIQFQEGTVEKIDAKSSMVYYTKPDGSMAE-------EEYDYVIVGI 109

Query: 179 GAEASTFGIHGVKENATFLREVHHAQEIRRKLL----LNLMLSDVPGISEEEKSRLLHCV 234
           GA  +T  + G  +    + E   A ++R KL      N+ +   P          +   
Sbjct: 110 GAHLATELVKGWDKYGYSVCEPEFATKLREKLESFQGGNIAIGSGPFYQGHNPKPKVPEN 169

Query: 235 VVGGGP-TGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQ 293
            V            E+S  ++    ++   + D +HVT+    E LS      R    + 
Sbjct: 170 FVPNADSACEGPVFEMS-LMLHGYFKKK-GMLDKVHVTVFSPGEYLSDLSPNSRKAVASI 227

Query: 294 LSKSGVRLVRG-IVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVK-SLDLPKSPGGR 351
            ++ G++LV    +K++   +++   G  +P  + +       +  +K S       GG 
Sbjct: 228 YNQLGIKLVHNFKIKEIREHEIVDEKGNTIPADITILLPPYTGNPALKNSTPDLVDDGGF 287

Query: 352 IGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQV 390
           I  D  +      +V+AVGD +    +  K    A+   
Sbjct: 288 IPTDLNMVSIKYDNVYAVGDANSM--TVPKLGYLAVMTG 324
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
1ojt_A 482 Surface protein; redox-active center, glycolysis, 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
4dna_A 463 Probable glutathione reductase; structural genomic 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 100.0
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.98
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.97
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.97
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.97
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.96
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.96
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.94
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.94
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.93
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.89
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.88
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.71
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.63
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.6
2cul_A232 Glucose-inhibited division protein A-related PROT 99.59
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.31
2cul_A232 Glucose-inhibited division protein A-related PROT 99.19
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.17
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.12
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.05
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.01
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.96
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.96
2bry_A497 NEDD9 interacting protein with calponin homology a 98.91
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.9
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.88
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.87
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.84
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.82
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.79
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.78
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.73
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.72
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.71
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.71
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.7
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.7
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.7
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.67
3dme_A369 Conserved exported protein; structural genomics, P 98.66
3atr_A453 Conserved archaeal protein; saturating double bond 98.66
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.64
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.64
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.63
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.63
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.62
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.58
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.56
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.56
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.55
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.54
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.53
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.53
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.52
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.52
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.51
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.51
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.51
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.5
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.5
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.5
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.5
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.48
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.47
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.47
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.47
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.46
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.46
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.45
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.45
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.43
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.43
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.41
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.4
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.4
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.39
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.37
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.36
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.35
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.34
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.34
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.34
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.33
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.32
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.32
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.31
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.3
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.29
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.29
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.28
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.28
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.28
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.27
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.27
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.26
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.26
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.26
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.25
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.25
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.25
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.24
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.23
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.23
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.22
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.21
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.21
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.21
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.21
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.2
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.2
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.2
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.18
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.18
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.18
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.18
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.17
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.17
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 98.15
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 98.15
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.15
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.15
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.14
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.14
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.14
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.14
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.13
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.13
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.12
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.12
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.11
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.11
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.1
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 98.1
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.09
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.09
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.09
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.07
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 98.07
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.06
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.06
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.05
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.03
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.03
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.02
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.02
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.01
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 98.0
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.0
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.0
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.0
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 98.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.99
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.99
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 97.99
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.98
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.98
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.97
4dna_A463 Probable glutathione reductase; structural genomic 97.96
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.95
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.94
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 97.93
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.92
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.92
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 97.92
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.92
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.92
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.91
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.9
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.9
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.89
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.88
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.88
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.87
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.86
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.86
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.85
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.85
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 97.84
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.84
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.84
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.83
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.83
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.83
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.82
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.82
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.8
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.8
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.79
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.78
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.77
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.75
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.75
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.73
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.73
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.73
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.72
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.72
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 97.72
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.67
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.66
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.66
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.66
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.64
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.64
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.63
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.63
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.62
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.61
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.61
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.6
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.58
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.58
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.57
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.56
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.56
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.56
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.54
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.53
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.53
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.52
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.52
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.51
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.5
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 97.49
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.49
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.48
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.48
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.46
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.46
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.45
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.42
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.41
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.41
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.39
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 97.39
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.38
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.38
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 97.38
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.37
3atr_A 453 Conserved archaeal protein; saturating double bond 97.36
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.35
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.32
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 97.32
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.28
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.28
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.27
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.27
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.26
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.25
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.18
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.18
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.18
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.16
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 97.16
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.16
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.14
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.08
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.06
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.04
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.04
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.0
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.96
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 96.92
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.91
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.9
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.87
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.86
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 96.85
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 96.85
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 96.78
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 96.78
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.7
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.65
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 96.65
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.61
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.52
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.51
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.49
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.39
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.36
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.32
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.23
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.18
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.14
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.09
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.05
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.91
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.76
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.73
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 95.69
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 95.55
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.54
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.52
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 95.31
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.31
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.19
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 95.15
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.05
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.0
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 94.83
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.75
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.7
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.66
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.53
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.52
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.31
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 94.29
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 94.23
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 94.22
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.08
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.06
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.97
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.93
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 93.83
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 93.83
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 93.81
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 93.68
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 93.66
3tl2_A315 Malate dehydrogenase; center for structural genomi 93.65
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 93.6
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 93.58
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.55
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 93.54
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.48
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 93.44
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 93.43
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.43
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 93.41
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.41
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.4
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.38
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 93.32
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.23
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 93.22
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.2
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 93.16
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 93.05
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.01
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.89
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 92.87
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 92.86
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 92.85
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.83
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.83
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 92.81
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 92.71
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 92.7
3ius_A286 Uncharacterized conserved protein; APC63810, silic 92.69
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 92.67
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.65
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 92.59
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 92.57
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 92.53
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.5
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 92.5
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 92.49
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 92.45
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.41
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 92.37
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 92.36
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.34
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 92.34
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 92.32
3l6d_A306 Putative oxidoreductase; structural genomics, prot 92.31
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 92.24
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 92.23
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.12
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 92.12
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 92.07
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 92.06
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 92.05
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.02
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 92.01
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 91.96
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 91.95
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 91.95
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.93
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 91.93
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 91.92
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.87
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 91.86
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 91.82
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 91.81
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 91.75
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 91.71
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.69
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.57
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 91.54
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 91.54
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 91.53
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 91.51
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 91.5
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 91.49
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 91.49
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.46
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 91.45
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 91.43
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 91.43
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 91.39
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.35
3dme_A 369 Conserved exported protein; structural genomics, P 91.25
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 91.24
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 91.21
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 91.21
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.2
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 91.19
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 91.11
4ezb_A317 Uncharacterized conserved protein; structural geno 91.11
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 91.1
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 91.04
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 91.03
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 91.01
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 90.83
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.82
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.71
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 90.69
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 90.66
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
Probab=100.00  E-value=8.8e-51  Score=406.60  Aligned_cols=336  Identities=34%  Similarity=0.608  Sum_probs=277.3

Q ss_pred             CCCCcEEEECCchHHHHHHHhcccCCCeEEEEcCCCcceecchhhhhhcCcccccccccchhhcchhhhcCCCcEEEEeE
Q 013810           60 NEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSH  139 (436)
Q Consensus        60 ~~~~~VvIIGgG~AGl~aA~~L~~~g~~v~lie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  139 (436)
                      +.+++|||||||+||+++|..|++.+++|+|||+++++.|+|+++..+.|..+..+...++.++.  .....++.|+.++
T Consensus        40 ~~KprVVIIGgG~AGl~~A~~L~~~~~~VtLId~~~~~~~~PlL~~va~G~l~~~~i~~p~~~~~--~~~~~~v~~~~~~  117 (502)
T 4g6h_A           40 SDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFA--LKKKGNVTYYEAE  117 (502)
T ss_dssp             CSSCEEEEECSSHHHHHHHHHSCTTTCEEEEEESSSEEECGGGGGGTTTTSSCGGGGEEEHHHHH--TTCSSCEEEEEEE
T ss_pred             CCCCCEEEECCcHHHHHHHHHhhhCCCcEEEECCCCCcccccchhHHhhccccHHHhhhhHHHHH--HhhcCCeEEEEEE
Confidence            45679999999999999999999999999999999999999999999988887777666655432  2345679999999


Q ss_pred             eEeEeCCCCEEEEEEecCC---------cccCCCCceeeeccEEEEeCCCCCCCCCCCCCccccccccChHHHHHHHHHH
Q 013810          140 CAGIDTDNHVVHCETVTDE---------LRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKL  210 (436)
Q Consensus       140 v~~id~~~~~v~~~~~~~g---------~~~~~~~~~~~~~d~lViAtG~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~  210 (436)
                      |++||++.+.|.+......         ......+..++.||+||||||+.++.+++||.+++.+.++++.++..+++.+
T Consensus       118 v~~ID~~~k~V~l~~~~~~~~~~~~~~~~~~~~~~~~~i~YD~LViAtGs~~~~~~ipG~~e~a~~l~t~~dA~~ir~~l  197 (502)
T 4g6h_A          118 ATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTF  197 (502)
T ss_dssp             EEEEEGGGTEEEEEEEEEEEECSSSCCCCCCCTTCCEEEECSEEEECCCCEECCTTCTTHHHHCEECSSHHHHHHHHHHH
T ss_pred             EEEEEhhhCEEEEeecccceeecccccccccccCCceEEeCCEEEEcCCcccccCCccCcccccCCCCCHHHHHHHHHHH
Confidence            9999999999987642110         0000111237999999999999999999999988899999999999999888


Q ss_pred             HHhccccCCCCCChhhhcccCcEEEECCChHHHHHHHHHHHHHHHHHHhhhcCCCCccEEEEEeCC-CCCCcccHHHHHH
Q 013810          211 LLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEAN-EILSSFDDRLRHY  289 (436)
Q Consensus       211 ~~~~~~~~~p~~~~~~~~~~~~vvViG~G~~g~e~A~~l~~~~~~~~~~~~~~~~~~~~V~lv~~~-~~l~~~~~~~~~~  289 (436)
                      ..++.....+......++...+++|||||++|+|+|.+|++++...+++.++......+|+|+++. .+++.+++++.+.
T Consensus       198 ~~~~e~a~~~~~~~~~~~~~~~vvVvGgG~tGvE~A~~l~~~~~~~l~~~~~~~~~~~~V~lve~~~~il~~~~~~~~~~  277 (502)
T 4g6h_A          198 AANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSY  277 (502)
T ss_dssp             HHHHHHHHHSCTTCHHHHHHTEEEEECCSHHHHHHHHHHHHHHHHTHHHHCHHHHHHCEEEEECSSSSSSTTSCHHHHHH
T ss_pred             HHHHHHHhcccccchhhccccceEEECCCcchhhhHHHHHHHHHHHHHhhcccccccceeEEeccccccccCCCHHHHHH
Confidence            666555444333333345556899999999999999999998877666666655566899999995 6889999999999


Q ss_pred             HHHHHHhcCCEEEecc-eEEEeCCeEEE----cCC----cEEecceEEEecCCCCchh----cccCCCCCCCCCcEEeCC
Q 013810          290 ATTQLSKSGVRLVRGI-VKDVDSQKLIL----NDG----TEVPYGLLVWSTGVGPSTL----VKSLDLPKSPGGRIGIDE  356 (436)
Q Consensus       290 ~~~~l~~~gV~i~~~~-v~~i~~~~v~~----~~g----~~i~~D~vi~a~G~~p~~~----~~~~~l~~~~~G~i~vd~  356 (436)
                      +.+.|++.||++++++ |++++++.+.+    .||    +++++|+||||+|.+|+++    ...+++..+.+|+|.||+
T Consensus       278 ~~~~L~~~GV~v~~~~~v~~v~~~~~~~~~~~~dg~~~~~~i~ad~viwa~Gv~~~~~~~~l~~~~~~~~~~~g~I~Vd~  357 (502)
T 4g6h_A          278 AQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVND  357 (502)
T ss_dssp             HHHHHHHTTCEEETTEEEEEECSSEEEEEEECTTSCEEEEEEECSEEEECCCEECCHHHHHHHHHSGGGTTCCSSEEBCT
T ss_pred             HHHHHHhcceeeecCceEEEEeCCceEEEEEecCcccceeeeccCEEEEccCCcCCHHHHhHHHhccccccCCCceeECC
Confidence            9999999999999995 99999887655    355    3699999999999999853    445567778889999999


Q ss_pred             CCCCCCCCCEEEeccccccccCCCCccCCccHHHHHHHHHHHHhhhhh
Q 013810          357 WLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVSYEQLHLFQKPSFL  404 (436)
Q Consensus       357 ~~~~t~~~~Vya~GD~~~~~~~~~~~~~~~~~~~A~~~g~~aa~~i~~  404 (436)
                      +||++++|||||+|||+..+       .|++++.|.+||+.+|+||..
T Consensus       358 ~lq~~~~~~IfAiGD~a~~~-------~p~~a~~A~qqg~~~A~ni~~  398 (502)
T 4g6h_A          358 FLQVKGSNNIFAIGDNAFAG-------LPPTAQVAHQEAEYLAKNFDK  398 (502)
T ss_dssp             TSBBTTCSSEEECGGGEESS-------SCCCHHHHHHHHHHHHHHHHH
T ss_pred             ccccCCCCCEEEEEcccCCC-------CCCchHHHHHHHHHHHHHHHH
Confidence            99977999999999999864       388999999999999999964
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 436
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 1e-10
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 1e-08
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 4e-08
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 2e-07
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 3e-07
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 6e-07
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 7e-06
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 5e-05
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.001
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 1e-04
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 2e-04
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 3e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 4e-04
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 0.003
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Apoptosis-inducing factor (AIF)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.1 bits (137), Expect = 1e-10
 Identities = 22/151 (14%), Positives = 48/151 (31%), Gaps = 34/151 (22%)

Query: 190 VKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGEL 249
           VK   T  R++   + + +                 E   +    ++GGG  G E +  L
Sbjct: 14  VKSRTTLFRKIGDFRSLEKIS--------------REVKSI---TIIGGGFLGSELACAL 56

Query: 250 SDFIMRDVRQRYSHVKDYIHVTLIEANEILSS--FDDRLRHYATTQLSKSGVRL-----V 302
                               V  +   +        + L ++   ++ + GV++     V
Sbjct: 57  GRKAR----------ALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIV 106

Query: 303 RGIVKDVDSQKLILNDGTEVPYGLLVWSTGV 333
           + +        + L DG +V    +V + G+
Sbjct: 107 QSVGVSSGKLLIKLKDGRKVETDHIVAAVGL 137
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.86
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.86
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.86
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.83
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.82
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.81
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.8
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.78
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.78
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.76
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.75
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.75
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.74
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.74
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.73
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.72
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.7
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.7
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.69
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.69
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.69
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.68
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.67
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.67
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.67
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.66
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.65
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.63
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.63
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.62
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.6
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.6
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.59
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.55
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.54
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.51
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.5
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.5
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.49
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.49
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.47
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.44
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.43
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.42
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.38
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.33
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.32
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.26
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.26
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.25
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.23
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.2
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.2
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.19
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.17
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.16
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.16
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.16
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.15
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.15
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.12
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.12
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.12
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.1
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.09
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.05
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.04
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.03
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.03
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.03
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.0
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.0
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.98
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.97
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.95
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.95
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.95
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.94
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.94
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.93
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.93
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.91
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.9
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.87
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.87
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.87
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.86
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.85
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.85
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.85
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.84
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.84
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.82
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.8
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.79
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.79
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.79
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.77
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.77
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.76
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.68
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.65
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.64
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.62
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.61
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.61
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.6
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.59
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.57
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.57
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.56
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.55
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.53
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.52
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.52
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.49
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.46
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.44
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.43
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.42
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.41
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.4
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.4
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.39
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.33
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.31
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.25
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.23
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 98.23
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.12
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.07
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.07
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.06
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.05
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 98.0
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.0
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.98
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.96
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.96
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.96
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.92
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.91
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.9
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.89
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.88
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.88
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.86
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.82
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.81
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.8
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.73
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.72
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.65
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.63
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.57
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.55
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.54
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.46
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.46
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.42
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.39
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.39
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.34
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.34
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.29
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.24
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.21
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.18
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.07
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.01
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.93
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.92
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.78
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.73
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.68
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.67
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.6
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.56
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.4
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.29
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.26
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.17
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.09
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.02
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.85
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.83
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.78
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.77
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.76
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.73
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.73
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.66
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.46
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.39
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.32
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.22
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.2
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 95.15
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.05
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.93
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.88
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.78
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.6
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.55
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.54
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.47
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.42
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.34
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.31
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.24
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.19
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.06
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.03
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.0
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.87
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.86
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 93.79
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.73
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.72
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.72
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.69
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.57
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.42
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.37
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.34
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 93.29
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.22
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.16
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.98
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.88
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.8
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.79
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.58
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.57
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 92.56
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 92.5
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.45
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.42
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.37
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 92.36
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.27
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.15
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.14
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.12
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.0
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.97
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.97
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.97
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.82
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 91.73
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.65
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.47
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.43
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.0
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 90.97
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.92
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 90.83
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.65
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.62
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 90.58
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.54
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 90.38
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 90.31
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 90.25
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.17
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 89.95
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 89.92
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 89.85
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.77
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 89.77
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 89.64
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.6
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 89.6
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.44
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 89.39
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 88.85
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.66
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 88.48
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.46
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 87.91
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 87.84
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.6
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 87.6
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.56
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 87.5
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 87.14
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 86.79
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 86.79
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 86.41
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.35
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 86.32
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.23
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.03
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 85.78
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 85.55
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 85.32
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 85.3
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 85.11
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.89
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 84.89
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.24
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 83.95
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.88
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 83.6
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 83.34
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.03
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 82.97
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 82.87
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.66
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 82.39
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 82.37
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 82.28
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 82.25
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 82.11
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.1
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 81.96
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 81.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.47
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 81.23
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 81.1
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 80.94
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 80.75
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 80.56
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 80.06
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.05
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 80.02
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH peroxidase
species: Enterococcus faecalis [TaxId: 1351]

Probab=99.86  E-value=2.1e-21  Score=168.36  Aligned_cols=163  Identities=23%  Similarity=0.296  Sum_probs=124.6

Q ss_pred             cEEEECCChHHHHHHHHHHHHHHHHHHhhhcCCCCccEEEEEeCCCCCCcccHHHHH--------------HHHHHHHhc
Q 013810          232 HCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRH--------------YATTQLSKS  297 (436)
Q Consensus       232 ~vvViG~G~~g~e~A~~l~~~~~~~~~~~~~~~~~~~~V~lv~~~~~l~~~~~~~~~--------------~~~~~l~~~  297 (436)
                      ||+|||||++|+|+|..|.+++            ++.+|+++++.+..+..+..+..              ...+.+++.
T Consensus         2 KVvIIGgG~~G~e~A~~l~~~~------------~~~~V~v~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~   69 (198)
T d1nhpa1           2 KVIVLGSSHGGYEAVEELLNLH------------PDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESR   69 (198)
T ss_dssp             EEEEECSSHHHHHHHHHHHHHC------------TTSEEEEEESSSSSSBCGGGHHHHHTTSSCCGGGSBSCCHHHHHHT
T ss_pred             EEEEECCcHHHHHHHHHHHhcC------------CCCeEEEEeCCCcccccccCcchhhcccccchHHHHHhhHHHHHHC
Confidence            7999999999999999998764            44799999986543322222221              234568889


Q ss_pred             CCEEEecc-eEEEeC--CeEEE---cCCc--EEecceEEEecCCCCch---------hcccCCCCCCCCCcEEeCCCCCC
Q 013810          298 GVRLVRGI-VKDVDS--QKLIL---NDGT--EVPYGLLVWSTGVGPST---------LVKSLDLPKSPGGRIGIDEWLRV  360 (436)
Q Consensus       298 gV~i~~~~-v~~i~~--~~v~~---~~g~--~i~~D~vi~a~G~~p~~---------~~~~~~l~~~~~G~i~vd~~~~~  360 (436)
                      ||+++.+. |++++.  +.|.+   .+|+  ++++|.+++++|..|+.         +++ .+++++++|+|.||+++| 
T Consensus        70 gi~v~~~~~V~~i~~~~~~v~~~~~~~g~~~~~~~D~li~a~G~~~~~~~g~~~~~~~~~-~~~~~~~~G~i~vd~~~~-  147 (198)
T d1nhpa1          70 GVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDGVRPNTAWLK-GTLELHPNGLIKTDEYMR-  147 (198)
T ss_dssp             TCEEEETEEEEEEETTTTEEEEEETTTCCEEEEECSEEEECCCEEECCCCCEEESCGGGT-TTSCBCTTSCBCCCTTCB-
T ss_pred             CcEEEEeeceeeEeeccccceeeecccccccccccceeeEeecceeeccccccccccccc-ccceeccCCceecCCccc-
Confidence            99999995 999975  45554   3443  58999999999976541         222 357778899999999999 


Q ss_pred             CCCCCEEEecccccccc-CCCCccCCccHHHHHHHHHHHHhhhhhhcCC
Q 013810          361 PSVQDVFAVGDCSGYLE-STGKTVLPALAQVSYEQLHLFQKPSFLLARN  408 (436)
Q Consensus       361 t~~~~Vya~GD~~~~~~-~~~~~~~~~~~~~A~~~g~~aa~~i~~~~~~  408 (436)
                      |+.|+|||+|||+..+. ..+......++..|.+||+.||+||.....+
T Consensus       148 T~~~~IyA~GD~a~~~~~~~~~~~~~~~a~~A~~~g~~aa~ni~~~~~~  196 (198)
T d1nhpa1         148 TSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKP  196 (198)
T ss_dssp             CSSTTEEECGGGSCEEEGGGTEEECCCCHHHHHHHHHHHHHTSSSCCCC
T ss_pred             ccccceEEecceeecccccCCCcccccHHHHHHHHHHHHHHhhCCCCCC
Confidence            89999999999998765 3455555678999999999999999766544
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure