Citrus Sinensis ID: 014047


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPATKKRIRSAGSSDSLAQEGGDSTQTDPLLTPSSSAAYLGSFYETEDFSDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSFRVPQASDR
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHccHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ccccccccccEEEEHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHEHHHHHHcHHcccccccccccccccccccccccccccccccccHHHccccccccccccHcHHHHHccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mrnfplsrgtvsgILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFiractpasgedssehghfVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMlsplaipvkmtlfpATKKrirsagssdslaqeggdstqtdplltpsssaaylgsfyetedfsdVEILLAIGegavkekrrprrgedfklgEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNfagrlgsgvlsehyvrskaiprtVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLmvptaselfglkhFGLIYNFILLGNPIGALLFSGLLagklydaeatkqgsstcigaeCFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMlyaggsfrvpqasdr
mrnfplsrgTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPATKKRIRSAgssdslaqeggdstqtdplltPSSSAAYLGSFYETEDFSDVEILLAigegavkekrrprrgedfklgEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAggsfrvpqasdr
MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTlllflalgipliclVTTYFIRACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPATKKRIRSAGSSDSLAQEGGDSTQTDPLLTPSSSAAYLGSFYETEDFSDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCglgtilsiiltirirPVYQMLYAGGSFRVPQASDR
*********TVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTPA*******HGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPA**********************************AYLGSFYETEDFSDVEILLAIGEGAV**********DFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSF********
*RNF**SRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACT**************FTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFP***********************************************************************DFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVY*****************
MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTP********HGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPATKK*********************DPLLTPSSSAAYLGSFYETEDFSDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSFRVPQASDR
*RNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPAT************************************************EILLA*GEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGG**********
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFMLSPLAIPVKMTLFPATKKRIRSAGSSDSLAQEGGDSTQTDPLLTPSSSAAYLGSFYETEDFSDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSFRVPQASDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query431 2.2.26 [Sep-21-2011]
P37662402 Inner membrane protein Yh N/A no 0.371 0.398 0.252 3e-05
>sp|P37662|YHJX_ECOLI Inner membrane protein YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 Back     alignment and function desciption
 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 81/174 (46%), Gaps = 14/174 (8%)

Query: 191 EGAVKEKRRPRRG---EDFKLGEAFVKADFWLLWFVYFLGVGAGVTVL---NNLAQIGVA 244
           + A K++ +   G   +D+ L E+  K  +W+L  ++     +G+ V+    ++AQ    
Sbjct: 187 KDAPKQEVKTSNGVVEKDYTLAESMRKPQYWMLAVMFLTACMSGLYVIGVAKDIAQSLAH 246

Query: 245 LGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMI--LTFLLYA 302
           L V      + + S+ N +GRL  G+LS+   R + I      T   ++ +  +  LL+A
Sbjct: 247 LDVVSAANAVTVISIANLSGRLVLGILSDKIARIRVI------TIGQVISLVGMAALLFA 300

Query: 303 SALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGAL 356
              + T +AA   +   +G   ++     SE FGL +    Y  I LG  IG++
Sbjct: 301 PLNAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSI 354





Escherichia coli (strain K12) (taxid: 83333)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
24461856 564 nodulin-like protein [Citrus trifoliata] 1.0 0.764 0.988 0.0
224134428 564 predicted protein [Populus trichocarpa] 0.990 0.757 0.697 1e-177
225443039 564 PREDICTED: uncharacterized membrane prot 1.0 0.764 0.715 1e-177
147775997504 hypothetical protein VITISV_014065 [Viti 0.983 0.841 0.708 1e-172
224054332 564 predicted protein [Populus trichocarpa] 0.997 0.762 0.699 1e-171
359484689 573 PREDICTED: uncharacterized protein LOC10 1.0 0.752 0.647 1e-169
296084552512 unnamed protein product [Vitis vinifera] 0.983 0.828 0.643 1e-166
449468956 565 PREDICTED: uncharacterized protein LOC10 0.995 0.759 0.653 1e-164
449516077 565 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.995 0.759 0.653 1e-164
255581273 570 conserved hypothetical protein [Ricinus 0.986 0.745 0.634 1e-161
>gi|24461856|gb|AAN62343.1|AF506028_10 nodulin-like protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/431 (98%), Positives = 428/431 (99%)

Query: 1   MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFI 60
           MRNFPLSRGTV+GILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFI
Sbjct: 134 MRNFPLSRGTVAGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFI 193

Query: 61  RACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFML 120
           RACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFML
Sbjct: 194 RACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFML 253

Query: 121 SPLAIPVKMTLFPATKKRIRSAGSSDSLAQEGGDSTQTDPLLTPSSSAAYLGSFYETEDF 180
           SPLAIPVKMTLFPATKKRIRSA SSDSLAQEGGDST TDPLLTPSSSAAYLGSFYETEDF
Sbjct: 254 SPLAIPVKMTLFPATKKRIRSADSSDSLAQEGGDSTPTDPLLTPSSSAAYLGSFYETEDF 313

Query: 181 SDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQ 240
           SDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQ
Sbjct: 314 SDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQ 373

Query: 241 IGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLL 300
           IGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLL
Sbjct: 374 IGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLL 433

Query: 301 YASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSG 360
           YASALSGTLYAAT+LLGVC GVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSG
Sbjct: 434 YASALSGTLYAATILLGVCCGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSG 493

Query: 361 LLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAG 420
           LLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAG
Sbjct: 494 LLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAG 553

Query: 421 GSFRVPQASDR 431
           GSFRVPQASDR
Sbjct: 554 GSFRVPQASDR 564




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224134428|ref|XP_002327403.1| predicted protein [Populus trichocarpa] gi|222835957|gb|EEE74378.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443039|ref|XP_002270754.1| PREDICTED: uncharacterized membrane protein YMR155W [Vitis vinifera] gi|297743570|emb|CBI36437.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147775997|emb|CAN69082.1| hypothetical protein VITISV_014065 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224054332|ref|XP_002298207.1| predicted protein [Populus trichocarpa] gi|222845465|gb|EEE83012.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484689|ref|XP_002268798.2| PREDICTED: uncharacterized protein LOC100251745 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084552|emb|CBI25573.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449468956|ref|XP_004152187.1| PREDICTED: uncharacterized protein LOC101211550 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516077|ref|XP_004165074.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223430 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255581273|ref|XP_002531448.1| conserved hypothetical protein [Ricinus communis] gi|223528941|gb|EEF30935.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
TAIR|locus:2198938561 AT1G80530 "AT1G80530" [Arabido 0.986 0.757 0.562 4.8e-126
TAIR|locus:2116855567 AT4G34950 [Arabidopsis thalian 0.902 0.686 0.362 1.2e-65
TAIR|locus:2078643584 AT3G01930 [Arabidopsis thalian 0.969 0.715 0.338 2.3e-62
TAIR|locus:2174683579 AT5G14120 [Arabidopsis thalian 0.948 0.706 0.326 1.3e-59
TAIR|locus:2059829546 AT2G16660 [Arabidopsis thalian 0.672 0.531 0.391 1.2e-49
TAIR|locus:2027284533 AT1G74780 [Arabidopsis thalian 0.443 0.358 0.402 2.3e-44
TAIR|locus:2011241526 AT1G18940 [Arabidopsis thalian 0.496 0.406 0.350 2.9e-44
TAIR|locus:2046238577 AT2G28120 [Arabidopsis thalian 0.454 0.339 0.344 1e-41
TAIR|locus:2040809525 AT2G34350 [Arabidopsis thalian 0.440 0.361 0.373 4e-40
TAIR|locus:2056103601 AT2G39210 "AT2G39210" [Arabido 0.454 0.326 0.358 2e-38
TAIR|locus:2198938 AT1G80530 "AT1G80530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1238 (440.9 bits), Expect = 4.8e-126, P = 4.8e-126
 Identities = 242/430 (56%), Positives = 305/430 (70%)

Query:     1 MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTXXXXXXXXXXXXXXVTTYFI 60
             MRNFP+SRG V+G+LKGY GI+ A +TVL++MVL +SA                   YFI
Sbjct:   134 MRNFPMSRGPVAGLLKGYIGISGAAFTVLFSMVLHHSAMDLLLFLTVGIPVICLTVMYFI 193

Query:    61 RACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFML 120
             R C PA+GED SE  +F F    S+  A Y+V  ++ S+   L   L Y+LVAIMV+ +L
Sbjct:   194 RPCIPATGEDPSEPMYFAFLLVTSILFAAYLVVTTVLSEVFILPSILKYVLVAIMVLLLL 253

Query:   121 SPLAIPVKMTLFPATKKRIRSAGSSDSLAQEGGDSTQTDPLLTPSSSAAYLGSFYETEDF 180
             SPLA+P+KMTLF +  K     GSSD+LA+E G  T  +PLLTPS+SA+ LG  +E +D 
Sbjct:   254 SPLAVPIKMTLFRSNAKS-SPLGSSDNLAKEEG--THEEPLLTPSTSASNLGPIFEGDDE 310

Query:   181 SDVEILLAIGEGAVKEKRRPRRGEDFKLGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQ 240
             SD+EILLA  EGAVK+KR+PRRGEDFK G+ FVKADFWLLWFVYFLG+G+GVTV NNLAQ
Sbjct:   311 SDMEILLAEAEGAVKKKRKPRRGEDFKFGQVFVKADFWLLWFVYFLGMGSGVTVSNNLAQ 370

Query:   241 IGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLL 300
             IG A G+ DTT LLCLFS  NF GRL SG +SEH+VRS+ +PRT+W+    ++M+ TFLL
Sbjct:   371 IGFAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVRSRTLPRTLWMGAAQLVMVFTFLL 430

Query:   301 YASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSG 360
             +A A+  T+Y AT L+G+C G  + L + T SELFGL+HFG+ +NFILLGNP+GA +FS 
Sbjct:   431 FAMAIDHTIYVATALIGICMGFQF-LSIATISELFGLRHFGINFNFILLGNPLGATIFSA 489

Query:   361 LLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCXXXXXXXXXXXXXXXPVYQMLYAG 420
             +LAG +YD EA KQG  TCIG +CFR+TFLVLAGVC               PVYQ LYA 
Sbjct:   490 ILAGYIYDKEADKQGKMTCIGPDCFRVTFLVLAGVCGLGTLLSIILTVRIRPVYQALYAS 549

Query:   421 GSFRV-PQAS 429
             GSFR+ PQ++
Sbjct:   550 GSFRLQPQST 559




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=IDA
GO:0080167 "response to karrikin" evidence=IEP
TAIR|locus:2116855 AT4G34950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078643 AT3G01930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174683 AT5G14120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059829 AT2G16660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027284 AT1G74780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011241 AT1G18940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046238 AT2G28120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040809 AT2G34350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056103 AT2G39210 "AT2G39210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00440011
hypothetical protein (564 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
pfam06813248 pfam06813, Nodulin-like, Nodulin-like 2e-46
TIGR00890377 TIGR00890, 2A0111, oxalate/formate antiporter fami 2e-12
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-05
TIGR04259405 TIGR04259, oxa_formateAnti, oxalate/formate antipo 2e-05
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 0.002
PTZ00207591 PTZ00207, PTZ00207, hypothetical protein; Provisio 0.002
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 0.004
>gnl|CDD|219187 pfam06813, Nodulin-like, Nodulin-like Back     alignment and domain information
 Score =  160 bits (406), Expect = 2e-46
 Identities = 66/127 (51%), Positives = 82/127 (64%)

Query: 1   MRNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFI 60
           +RNFP SRG V GILKGYAG++AAIYT LY  +  N A++LLL  AL   ++ LV  YFI
Sbjct: 122 IRNFPESRGVVLGILKGYAGLSAAIYTQLYTAIFGNDASSLLLLNALVPLVVSLVALYFI 181

Query: 61  RACTPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMVVFML 120
           R C    GE  SE   F+     SV LA+Y+VA+SI S    LS A  Y L AIMV+ +L
Sbjct: 182 RPCPGKVGEQRSESVVFLVFNVLSVALAVYLVAMSILSKSFDLSSAEYYALGAIMVLLLL 241

Query: 121 SPLAIPV 127
            PLA+P+
Sbjct: 242 VPLAVPI 248


This family represents a conserved region within plant nodulin-like proteins. Length = 248

>gnl|CDD|233171 TIGR00890, 2A0111, oxalate/formate antiporter family transporter Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|234525 TIGR04259, oxa_formateAnti, oxalate/formate antiporter Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|140234 PTZ00207, PTZ00207, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 431
PTZ00207591 hypothetical protein; Provisional 100.0
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.9
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.87
PRK10504471 putative transporter; Provisional 99.86
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.86
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.85
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.85
PRK11663434 regulatory protein UhpC; Provisional 99.84
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.84
TIGR00893399 2A0114 d-galactonate transporter. 99.84
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.84
PRK09705393 cynX putative cyanate transporter; Provisional 99.83
PRK10642490 proline/glycine betaine transporter; Provisional 99.81
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.8
PRK03545390 putative arabinose transporter; Provisional 99.8
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 99.8
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.79
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.79
PRK05122399 major facilitator superfamily transporter; Provisi 99.79
PRK03699394 putative transporter; Provisional 99.79
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.78
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.78
PRK10489417 enterobactin exporter EntS; Provisional 99.78
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.78
TIGR00897402 2A0118 polyol permease family. This family of prot 99.77
PRK12382392 putative transporter; Provisional 99.77
PRK09528420 lacY galactoside permease; Reviewed 99.76
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.76
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.76
PRK12307426 putative sialic acid transporter; Provisional 99.76
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.76
PRK09874408 drug efflux system protein MdtG; Provisional 99.75
PLN00028476 nitrate transmembrane transporter; Provisional 99.75
PRK09952438 shikimate transporter; Provisional 99.75
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.74
PRK11010491 ampG muropeptide transporter; Validated 99.74
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.74
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.74
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.74
TIGR00900365 2A0121 H+ Antiporter protein. 99.74
PRK03893496 putative sialic acid transporter; Provisional 99.74
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.73
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.73
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.73
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.73
PRK15075434 citrate-proton symporter; Provisional 99.72
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.72
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.72
TIGR00898505 2A0119 cation transport protein. 99.71
PRK15011393 sugar efflux transporter B; Provisional 99.71
PRK10091382 MFS transport protein AraJ; Provisional 99.71
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.71
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.71
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.7
PRK03633381 putative MFS family transporter protein; Provision 99.69
TIGR00896355 CynX cyanate transporter. This family of proteins 99.69
KOG2532466 consensus Permease of the major facilitator superf 99.69
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.69
TIGR00891405 2A0112 putative sialic acid transporter. 99.69
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.68
TIGR00895398 2A0115 benzoate transport. 99.68
PRK11646400 multidrug resistance protein MdtH; Provisional 99.68
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.67
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.66
PRK11902402 ampG muropeptide transporter; Reviewed 99.65
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.65
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.64
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.64
KOG0569485 consensus Permease of the major facilitator superf 99.64
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.64
PRK11195393 lysophospholipid transporter LplT; Provisional 99.63
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.63
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.62
PRK11663 434 regulatory protein UhpC; Provisional 99.62
PRK10054395 putative transporter; Provisional 99.62
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.61
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.61
TIGR00901356 2A0125 AmpG-related permease. 99.6
PRK11043401 putative transporter; Provisional 99.59
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.59
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.59
PRK10504 471 putative transporter; Provisional 99.59
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.59
PRK03545 390 putative arabinose transporter; Provisional 99.58
PRK10054 395 putative transporter; Provisional 99.58
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.57
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.57
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.56
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.56
TIGR00900 365 2A0121 H+ Antiporter protein. 99.56
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.56
PRK10091 382 MFS transport protein AraJ; Provisional 99.55
TIGR00891 405 2A0112 putative sialic acid transporter. 99.54
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.54
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.54
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.54
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.54
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.53
PRK10133438 L-fucose transporter; Provisional 99.53
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.53
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.53
TIGR00893 399 2A0114 d-galactonate transporter. 99.53
PRK12307 426 putative sialic acid transporter; Provisional 99.52
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.52
KOG2533495 consensus Permease of the major facilitator superf 99.52
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.52
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.52
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.52
PRK03699 394 putative transporter; Provisional 99.52
PRK09874 408 drug efflux system protein MdtG; Provisional 99.51
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.51
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.5
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.5
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.5
PRK10489 417 enterobactin exporter EntS; Provisional 99.49
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.49
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.49
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.49
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.49
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.49
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.48
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.48
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.48
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.48
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.48
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.48
PLN00028 476 nitrate transmembrane transporter; Provisional 99.48
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.47
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.47
PRK03893 496 putative sialic acid transporter; Provisional 99.47
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.47
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.46
TIGR00895 398 2A0115 benzoate transport. 99.46
PRK11043 401 putative transporter; Provisional 99.46
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.46
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.46
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.45
PRK10642 490 proline/glycine betaine transporter; Provisional 99.45
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.45
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.44
PRK12382 392 putative transporter; Provisional 99.44
PRK09848448 glucuronide transporter; Provisional 99.43
PRK05122 399 major facilitator superfamily transporter; Provisi 99.43
PRK11652394 emrD multidrug resistance protein D; Provisional 99.43
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.43
PRK09705 393 cynX putative cyanate transporter; Provisional 99.41
PRK09528 420 lacY galactoside permease; Reviewed 99.4
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.4
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.4
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.4
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.39
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 99.39
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.39
PRK09952 438 shikimate transporter; Provisional 99.39
PRK03633 381 putative MFS family transporter protein; Provision 99.38
PRK09669444 putative symporter YagG; Provisional 99.38
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.37
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.37
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.36
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 99.36
PF13347428 MFS_2: MFS/sugar transport protein 99.35
KOG3764464 consensus Vesicular amine transporter [Intracellul 99.34
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.33
COG2270438 Permeases of the major facilitator superfamily [Ge 99.33
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.32
PRK15075 434 citrate-proton symporter; Provisional 99.32
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.31
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.31
PRK10429473 melibiose:sodium symporter; Provisional 99.31
PRK11010 491 ampG muropeptide transporter; Validated 99.31
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.3
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.3
PTZ00207 591 hypothetical protein; Provisional 99.28
PRK10133 438 L-fucose transporter; Provisional 99.27
TIGR00805 633 oat sodium-independent organic anion transporter. 99.27
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.26
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.25
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.24
PRK15011 393 sugar efflux transporter B; Provisional 99.23
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.23
KOG3764 464 consensus Vesicular amine transporter [Intracellul 99.22
COG2211467 MelB Na+/melibiose symporter and related transport 99.22
KOG2615 451 consensus Permease of the major facilitator superf 99.21
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.21
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.19
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.19
PRK11462460 putative transporter; Provisional 99.19
TIGR00898 505 2A0119 cation transport protein. 99.18
PRK11902 402 ampG muropeptide transporter; Reviewed 99.17
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.16
PRK15462493 dipeptide/tripeptide permease D; Provisional 99.16
KOG0254513 consensus Predicted transporter (major facilitator 99.14
TIGR00901 356 2A0125 AmpG-related permease. 99.14
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.11
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.11
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.11
KOG0254 513 consensus Predicted transporter (major facilitator 99.1
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 99.1
TIGR00805633 oat sodium-independent organic anion transporter. 99.08
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 99.07
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 99.05
KOG2532 466 consensus Permease of the major facilitator superf 99.05
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 99.05
KOG0569 485 consensus Permease of the major facilitator superf 98.92
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.9
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.87
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 98.86
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 98.86
KOG1330493 consensus Sugar transporter/spinster transmembrane 98.81
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.8
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 98.77
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.76
KOG2615451 consensus Permease of the major facilitator superf 98.76
KOG2533 495 consensus Permease of the major facilitator superf 98.75
KOG2563480 consensus Permease of the major facilitator superf 98.72
KOG3762618 consensus Predicted transporter [General function 98.69
PRK10429 473 melibiose:sodium symporter; Provisional 98.63
PRK09669 444 putative symporter YagG; Provisional 98.62
PF13347 428 MFS_2: MFS/sugar transport protein 98.6
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.57
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.56
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.53
KOG2325 488 consensus Predicted transporter/transmembrane prot 98.52
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.47
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.44
PRK11462 460 putative transporter; Provisional 98.39
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.38
PRK09848 448 glucuronide transporter; Provisional 98.36
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.35
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.35
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 98.32
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 98.28
COG2211 467 MelB Na+/melibiose symporter and related transport 98.26
KOG2816463 consensus Predicted transporter ADD1 (major facili 98.16
KOG2816 463 consensus Predicted transporter ADD1 (major facili 98.06
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.05
COG0477 338 ProP Permeases of the major facilitator superfamil 97.94
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.88
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.86
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.84
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.81
PF1283277 MFS_1_like: MFS_1 like family 97.71
KOG2325488 consensus Predicted transporter/transmembrane prot 97.66
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.63
KOG3626 735 consensus Organic anion transporter [Secondary met 97.54
PRK03612 521 spermidine synthase; Provisional 97.53
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 97.45
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.24
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 97.22
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 97.19
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.14
KOG2563 480 consensus Permease of the major facilitator superf 97.08
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.0
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 96.97
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 96.94
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 96.85
KOG0637 498 consensus Sucrose transporter and related proteins 96.83
KOG3626 735 consensus Organic anion transporter [Secondary met 96.76
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 96.68
KOG3098461 consensus Uncharacterized conserved protein [Funct 96.61
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 96.58
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 96.49
TIGR00880141 2_A_01_02 Multidrug resistance protein. 96.16
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 95.93
KOG3098 461 consensus Uncharacterized conserved protein [Funct 95.38
KOG3810433 consensus Micronutrient transporters (folate trans 94.72
KOG3762 618 consensus Predicted transporter [General function 94.57
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 94.32
KOG1479406 consensus Nucleoside transporter [Nucleotide trans 93.99
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 93.98
KOG1479 406 consensus Nucleoside transporter [Nucleotide trans 93.58
KOG1237 571 consensus H+/oligopeptide symporter [Amino acid tr 93.46
KOG3574 510 consensus Acetyl-CoA transporter [Inorganic ion tr 93.09
PF03547385 Mem_trans: Membrane transport protein; InterPro: I 92.76
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 92.63
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 90.16
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 89.02
COG3202 509 ATP/ADP translocase [Energy production and convers 87.79
KOG3574510 consensus Acetyl-CoA transporter [Inorganic ion tr 86.85
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 86.04
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 84.89
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.8e-38  Score=316.90  Aligned_cols=379  Identities=21%  Similarity=0.310  Sum_probs=297.5

Q ss_pred             CCCCCCCCchhhhhhhhhhhhHHHHHHHHHHHcCCCchHHHHHHHHHHHHHHHhhhheecccCCCCC---C---CCCCcc
Q 014047            2 RNFPLSRGTVSGILKGYAGIAAAIYTVLYNMVLQNSATTLLLFLALGIPLICLVTTYFIRACTPASG---E---DSSEHG   75 (431)
Q Consensus         2 ~~fp~~rg~~~gi~~~~~gl~~~i~~~l~~~~~~~~~~~~~~~l~~~~~~v~~~~~~~~~~~~~~~~---~---~~~~~~   75 (431)
                      +|||++||+++|+.+++.|+|++++++++..++.++.+.+++++++...+++++...++|.+|++..   +   +++++.
T Consensus       147 ~~Fp~~RG~a~Gi~~~~~gLGsaI~~~l~~~l~~~~~~~~fl~l~vl~~vv~ll~~~~vr~p~~~~~~~~~~~~~~~~~~  226 (591)
T PTZ00207        147 SVFPSNRGAVVAIMKTFTGLGSAILGSIQLAFFSDNTSAYFFFLMSFALVVGILAIVFMRLPPFHLTGYQEKHLDEEEKA  226 (591)
T ss_pred             HhChhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhheeCCcchhhcccccCCCHHHHH
Confidence            6899999999999999999999999999998887666677888888888889999998887765431   1   122332


Q ss_pred             -----------------chHHHHHHHHHHHHHHHHHHhhccccccchhHHHHHHHHHH-HHHHhh-hhhccccccccccc
Q 014047           76 -----------------HFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMV-VFMLSP-LAIPVKMTLFPATK  136 (431)
Q Consensus        76 -----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~~~~-~~~~~~~~~~~~~~  136 (431)
                                       ++...+.++++++.|++..++..++++.++..+..+.++++ +++..+ +.+|.+...+ .++
T Consensus       227 ~~~~~~~~y~~q~~p~~~f~~~~~i~~~l~~yl~~~~~~~~~~~~~~~~~~~~~~v~~~lll~~p~l~ip~~~~~~-~~~  305 (591)
T PTZ00207        227 QRLMRKGVYLKQKAPMWRFVYGFVILIILIVFLPLQGALVAYLKLGSNFKVGFAVTVIVLTVIFPFMAFPLTTFDG-KRP  305 (591)
T ss_pred             HHhhhhhhhhhcCCCceehhhHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHHHHHhhhHHHhcc-CCc
Confidence                             78899999999999999999999888888888888888776 666677 6888865211 100


Q ss_pred             cccccCCCCCcccccCCCCCCCCCCCCCCCcccccCCCCCCCCchhhHHHHHhccccc-ccc-CCCCCCCCCCHHHHhhh
Q 014047          137 KRIRSAGSSDSLAQEGGDSTQTDPLLTPSSSAAYLGSFYETEDFSDVEILLAIGEGAV-KEK-RRPRRGEDFKLGEAFVK  214 (431)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~~~~p~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~-~~~~~~~~~~~~~~l~~  214 (431)
                           ++.     .++++  .+++  +    .+.+.  .+  +         +++... +.+ +.|+  .+.++++.+++
T Consensus       306 -----~~~-----~~~~~--~~~~--~----~~~~~--~~--~---------~~~~~~~~~~~~~P~--~~~t~~q~l~~  352 (591)
T PTZ00207        306 -----HDD-----SDGKA--KEHV--E----AGEEV--SA--A---------EDKVVETDVDYIAPQ--FQETFIEGLKT  352 (591)
T ss_pred             -----CCC-----ccccc--cccc--c----ccccc--cc--c---------ccccccccccCCCCC--CcchHHHHHhc
Confidence                 000     00000  0000  0    00000  00  0         000000 011 1123  22399999999


Q ss_pred             HhHHHHHHHHHHhhhhHHHHHhhHHHHHHHh-CC-Ccc--hh-HHHHHHHHHhhhhhhhhHHhHhhhccc---CcchHHH
Q 014047          215 ADFWLLWFVYFLGVGAGVTVLNNLAQIGVAL-GV-NDT--TE-LLCLFSLCNFAGRLGSGVLSEHYVRSK---AIPRTVW  286 (431)
Q Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~-g~-s~~--~~-~~s~~~i~~~ig~~~~G~lsDr~grr~---~~~r~~~  286 (431)
                      .+||++++.++|..+.+..+++|+.++.+++ |+ ++.  .. ++++.++++++||+..|+++...-+|+   .+||+.+
T Consensus       353 ~d~Wll~~~~~cg~g~gl~~~~N~~qI~~sl~g~~~~~~~~~~~vsL~si~~~~GRl~~g~~~~~~~~~~~~~r~prt~~  432 (591)
T PTZ00207        353 ARLWCLLWSIFCCVGAHFVIIFNARFIYTALAGEAPDDALNTLLTVLNGVGSAVGRLCMSYFEIWSQKRRAEDRVPITIA  432 (591)
T ss_pred             hhHHHHHHHHHHhhCchheeeecHHHHHHHhcCCCCCccceeeehhhhhHHHHhhHHHHHHHHHHHHhhccccccchhHH
Confidence            9999999999999999999999999999999 88 333  23 799999999999999999994433333   2899999


Q ss_pred             HHHHHHHHHHHHHHHHhhhh-hHHHHHHHHHHHHhhhhhhhHHHHHHHhhcCCchhhHHHHHHHHHHhHHHHHhhhHHHH
Q 014047          287 ITCTHIMMILTFLLYASALS-GTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGK  365 (431)
Q Consensus       287 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~lg~~i~~p~i~g~  365 (431)
                      +.+..+ +.++.++++...+ ..+++..++.|+++|..++..+.+++|+|+ ++.|+.+.+..++..+|+.+++..+.|.
T Consensus       433 l~~~~~-~~~~~lll~~~~p~~~L~~~~~lvg~~~G~~~~~~~~i~selFg-k~~g~~yN~~~~a~pigs~~~n~~l~G~  510 (591)
T PTZ00207        433 LFIPSV-CIITMLTLFLTLPKAALPLPYFIAAFANGFMAATIALVTRTIFA-KDPAKHYNFCFLGSVLSAIFLNRLLYGE  510 (591)
T ss_pred             HHHHHH-HHHHHHHHHHHCCccHhHHHHHHHHHHhhHhHHHHHHHHHHHhc-cchHHHhhHHhHHHHHHHHHHHHHHHHH
Confidence            999888 7777777766666 789999999999999999999999999999 9999999999999999999999999999


Q ss_pred             HHhhhhcccCCcccccccccHHHHHHHHHHHHHHHHHHHHHHhhchHHHHH
Q 014047          366 LYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQM  416 (431)
Q Consensus       366 i~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~i~~i~~~~~~~~~~~~~~~  416 (431)
                      +||+...++++..|.|.+||+.+|+++++++++++++..+++.|+|+.+++
T Consensus       511 ~Yd~ea~k~~~~~C~G~~C~~~~~~v~~~~~~~g~~~s~~l~~R~r~~y~~  561 (591)
T PTZ00207        511 WYTQQADKLGQDVCTERVCVVMPLAFLLGLSFLAFITSTYVHLQYRRLCLK  561 (591)
T ss_pred             HHHHHHhhCCCCeeCCceeeHhHHHHHHHHHHHHHHHHhheeeehHHHHHH
Confidence            999998877778999999999999999999999999999999999888764



>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03547 Mem_trans: Membrane transport protein; InterPro: IPR004776 This entry represents a mostly uncharacterised family of membrane transport proteins found in eukaryotes, bacteria and archaea Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 9e-06
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 46.6 bits (111), Expect = 9e-06
 Identities = 33/204 (16%), Positives = 59/204 (28%), Gaps = 28/204 (13%)

Query: 208 LGEAFVKADFWLL--WFVYFLGVGAGVTVLNNLAQIGVALGVNDTTELLCLFSLCNFAGR 265
           +   FV    + +  W   +L           L +   A           L+      G 
Sbjct: 259 IANVFVYLLRYGILDWSPTYLKEVKHF----ALDKSSWAYF---------LYEYAGIPGT 305

Query: 266 LGSGVLSEHYVRSKAIPRTVWITCTHIMMILTFLLYASALSGTLYAATVLLGVCYGVIYS 325
           L  G +S+   R       V+      +  + + +  +          +++G        
Sbjct: 306 LLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVM 365

Query: 326 LMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGLLAGKLYDAEATKQGSSTCIGAECF 385
           L+   A EL   K  G    F  L   +G  + +  + G          G          
Sbjct: 366 LIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYT----VDFFGWDG------- 414

Query: 386 RLTFLVLAGVCGLGTILSIILTIR 409
              F+V+ G   L  IL I++ I 
Sbjct: 415 --GFMVMIGGSILAVILLIVVMIG 436


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.88
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.82
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.75
2cfq_A417 Lactose permease; transport, transport mechanism, 99.71
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.68
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.66
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.62
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.6
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.59
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.56
2xut_A 524 Proton/peptide symporter family protein; transport 99.52
2xut_A524 Proton/peptide symporter family protein; transport 99.42
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.26
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.17
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.88  E-value=1.3e-21  Score=194.15  Aligned_cols=181  Identities=16%  Similarity=0.126  Sum_probs=146.3

Q ss_pred             HHHhhhHhHHHHHHHHHHhhhhHHHHHhhHHHHHHH-hCCCcchh--HHHHHHHHHhhhhhhhhHHhHhh--hcccCcch
Q 014047          209 GEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVA-LGVNDTTE--LLCLFSLCNFAGRLGSGVLSEHY--VRSKAIPR  283 (431)
Q Consensus       209 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~g~s~~~~--~~s~~~i~~~ig~~~~G~lsDr~--grr~~~~r  283 (431)
                      ++.+|++.+|...+..++.......+..++|.++++ +|++....  ..++..++..+++++.|+++||+  +||+.+  
T Consensus       246 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~~~~~~~~~~~~--  323 (451)
T 1pw4_A          246 QYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGAT--  323 (451)
T ss_dssp             HHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHH--
T ss_pred             HHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhH--
Confidence            567889999999999888888888888999999987 58887654  78888999999999999999999  887654  


Q ss_pred             HHHHHHHHHHHH-HHHHHHHhh---hhhHHHHHHHHHHHHhhhhhhhHHHHHHHhhcCCchhhHHHHHHHHHHh-HHHHH
Q 014047          284 TVWITCTHIMMI-LTFLLYASA---LSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPI-GALLF  358 (431)
Q Consensus       284 ~~~~~~~~~~~~-~~~~~~~~~---~~~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~l-g~~i~  358 (431)
                          .++..+.. ++++.+...   +.....+..++.|++.+...+....++.|.+|++++|++.|+.+....+ |..+ 
T Consensus       324 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~-  398 (451)
T 1pw4_A          324 ----GVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA-  398 (451)
T ss_dssp             ----HHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHH-
T ss_pred             ----HHHHHHHHHHHHHHHHHhcccCHHHHHHHHHHHHHHHhchHHHHHHHHHHHhchhhhhhHHHHHHHHHHHHHHHH-
Confidence                33333333 444444332   2234566667888888888888889999999999999999999999999 9999 


Q ss_pred             hhhHHHHHHhhhhcccCCcccccccccHHHHHHHHHHHHHHHHHHHHHHhh
Q 014047          359 SGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIR  409 (431)
Q Consensus       359 ~p~i~g~i~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~i~~i~~~~~~~~  409 (431)
                      +|.+.|.+.|..+             |+..|++.+++.+++.++.++..++
T Consensus       399 ~~~~~g~l~~~~g-------------~~~~~~~~~~~~~~~~~~~~~~~~~  436 (451)
T 1pw4_A          399 ASAIVGYTVDFFG-------------WDGGFMVMIGGSILAVILLIVVMIG  436 (451)
T ss_dssp             HHHHHHHHHHSSC-------------SHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcC-------------cHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            8999999999876             9999999998888887776665443



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.84
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.69
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.6
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.33
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.84  E-value=2.4e-19  Score=174.65  Aligned_cols=191  Identities=15%  Similarity=0.098  Sum_probs=143.7

Q ss_pred             HHHHhhhHhHHHHHHHHHHhhhhHHHHHhhHHHHHHHh-CCCcchh--HHHHHHHHHhhhhhhhhHHhHhhhcccCcchH
Q 014047          208 LGEAFVKADFWLLWFVYFLGVGAGVTVLNNLAQIGVAL-GVNDTTE--LLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRT  284 (431)
Q Consensus       208 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~-g~s~~~~--~~s~~~i~~~ig~~~~G~lsDr~grr~~~~r~  284 (431)
                      .++.++++.+|......++.....+....+.|.++++. +.+....  ..++..++..++++++|+++||++|++..   
T Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~---  318 (447)
T d1pw4a_         242 MQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRG---  318 (447)
T ss_dssp             HHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHH---
T ss_pred             HHHHHcCchHHHHHHHhhhhhhhhhcchhhhhhhcccccccccchhhhhhhcchhhhhhhhhhhhhhhhhccccccc---
Confidence            35677899999999998888888888889999988765 7776654  78888899999999999999999987644   


Q ss_pred             HHHHHHHHHHHHHHHHHHhh---hhhHHHHHHHHHHHHhhhhhhhHHHHHHHhhcCCchhhHHHHHHHHHHhHHHHHhhh
Q 014047          285 VWITCTHIMMILTFLLYASA---LSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPIGALLFSGL  361 (431)
Q Consensus       285 ~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~lg~~i~~p~  361 (431)
                      ........+..++...+...   +....++..++.|++.++..+....+..|.+|++.+|++.|+.+....+++.+.+|.
T Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~  398 (447)
T d1pw4a_         319 ATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASA  398 (447)
T ss_dssp             HHHHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccchhHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            22222222222222222211   123455666777888888888888999999999999999999998888765554898


Q ss_pred             HHHHHHhhhhcccCCcccccccccHHHHHHHHHHHHHHHHHHHHHHhhchHHH
Q 014047          362 LAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVY  414 (431)
Q Consensus       362 i~g~i~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~i~~i~~~~~~~~~~~~~  414 (431)
                      +.|.+.|..+             |+..|++.+++++++.++..++..+++|+.
T Consensus       399 ~~g~~~~~~g-------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  438 (447)
T d1pw4a_         399 IVGYTVDFFG-------------WDGGFMVMIGGSILAVILLIVVMIGEKRRH  438 (447)
T ss_dssp             HHHHHHHSSC-------------SHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhC-------------hHHHHHHHHHHHHHHHHHHHHHHHhccccH
Confidence            9999999887             999999888888888777666655544433



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure