Citrus Sinensis ID: 014091

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MDTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG
ccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEccccccccHHHcccccccccEEEccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEccccccHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccHHHHHHHHcccEEEEEccEEccccccccccccccccEEEEEccEEEEccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEcccHHHHHccccccccccc
cccccccccccccccccccccccccHcEHHHHHHHHHHHccccEEEEccccccHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEccHHHcccccEcccccccccccHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEHHHcccEEEccEEcccHHHHccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHcccEEEEHHHccccccccccEEEEEcHHHccccHHHHHHHccEEEEEccccEccccccccccccHHHEEEEcccEEEEcccccccccEHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHcccccccc
mdtanamgstgqpgsapapvrggasvgTLGRHLARRLVEIGakdvfsvpgdfnltlldhliaepelnlvgccnelnagyaadgyarsrgvGACVVTFTVGGLSVLNAIAGaysenlpvicivggpnsndygtnrilhhtiglpdftqELRCFQAITCSQAVVNNLGDAHELIDTAISTAlkeskpvyisiscnlpgiphptfardpvpfflapkvsnqLGLEAAVEATADFLNKAvkpvlvggpniRVAKAQKAFIELadatgypiaimpsgkglvpehhphfigtywgavssSFCGEIVesadayvfvgpifndyssvGYSLLIKKEKaiivqphrvtvgngpslgWVFMADFLSALAKKLRKNTTALenyrriyvppgipvkraqneplrVNVLFKHIQDMLSGDTAVIAETgdswfncqklrlpencg
mdtanamgstgqpgsapapvrgGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKnttalenyrriyvppgipvkraqnePLRVNVLFKHIQDMLSGDTAVIAETGdswfncqklrlpencg
MDTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG
*************************VGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLR******
*****************************GRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARD***************LEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYV************PLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPEN**
*********************GGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG
************************SVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query431 2.2.26 [Sep-21-2011]
P51850 593 Pyruvate decarboxylase is N/A no 0.997 0.725 0.851 0.0
A2XFI3 606 Pyruvate decarboxylase is N/A no 0.958 0.681 0.797 0.0
Q10MW3 605 Pyruvate decarboxylase is yes no 0.958 0.682 0.797 0.0
P51846 614 Pyruvate decarboxylase is N/A no 0.997 0.700 0.767 0.0
A2Y5L9 605 Pyruvate decarboxylase is N/A no 0.946 0.674 0.786 0.0
P28516 610 Pyruvate decarboxylase is N/A no 0.935 0.660 0.794 0.0
Q0DHF6 605 Pyruvate decarboxylase is no no 0.946 0.674 0.784 0.0
A2YQ76 587 Pyruvate decarboxylase is N/A no 0.986 0.724 0.739 0.0
Q0D3D2 587 Pyruvate decarboxylase is no no 0.986 0.724 0.737 0.0
P51845418 Pyruvate decarboxylase is N/A no 0.816 0.842 0.801 1e-165
>sp|P51850|PDC1_PEA Pyruvate decarboxylase isozyme 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1 Back     alignment and function desciption
 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/432 (85%), Positives = 402/432 (93%), Gaps = 2/432 (0%)

Query: 2   DTANAMGSTGQPGSAPA--PVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDH 59
           +T    GST  P SAP+  P+R  +  GT+GRHLARRLVEIG +DVFSVPGDFNLTLLDH
Sbjct: 4   ETETPNGSTPCPTSAPSAIPLRPSSCDGTMGRHLARRLVEIGVRDVFSVPGDFNLTLLDH 63

Query: 60  LIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVI 119
           LIAEPELNLVGCCNELNAGYAADGY R++GVGACVVTFTVGGLS+LNAIAGAYSENLPVI
Sbjct: 64  LIAEPELNLVGCCNELNAGYAADGYGRAKGVGACVVTFTVGGLSILNAIAGAYSENLPVI 123

Query: 120 CIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTA 179
           CIVGGPNSNDYGTNRILHHTIGLPDF+QEL+CFQ ITC QAVVNNL DAHELIDTAISTA
Sbjct: 124 CIVGGPNSNDYGTNRILHHTIGLPDFSQELQCFQTITCFQAVVNNLDDAHELIDTAISTA 183

Query: 180 LKESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPV 239
           LKESKPVYISI CNLP IPHPTFARDPVPFFLAP+VSNQ GLEAAVE  A FLNKAVKPV
Sbjct: 184 LKESKPVYISIGCNLPAIPHPTFARDPVPFFLAPRVSNQAGLEAAVEEAAAFLNKAVKPV 243

Query: 240 LVGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEI 299
           +VGGP +RVAKAQKAF+E A+A+GYPIA+MPSGKGLVPE+HPHFIGTYWGAVS+S+CGEI
Sbjct: 244 IVGGPKLRVAKAQKAFMEFAEASGYPIAVMPSGKGLVPENHPHFIGTYWGAVSTSYCGEI 303

Query: 300 VESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALA 359
           VESADAYVFVGPIFNDYSSVGYSLLIKKEK++IVQP+RVT+GNG SLGWVFMADFL+ALA
Sbjct: 304 VESADAYVFVGPIFNDYSSVGYSLLIKKEKSLIVQPNRVTIGNGLSLGWVFMADFLTALA 363

Query: 360 KKLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWF 419
           KK++ NTTA+ENYRRIYVPPGIP+KR ++EPLRVNVLFKHIQ ++SGDTAVIAETGDSWF
Sbjct: 364 KKVKTNTTAVENYRRIYVPPGIPLKREKDEPLRVNVLFKHIQALISGDTAVIAETGDSWF 423

Query: 420 NCQKLRLPENCG 431
           NCQKLRLPENCG
Sbjct: 424 NCQKLRLPENCG 435

Pisum sativum (taxid: 3888)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|A2XFI3|PDC2_ORYSI Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2 Back     alignment and function description
>sp|Q10MW3|PDC2_ORYSJ Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1 Back     alignment and function description
>sp|P51846|PDC2_TOBAC Pyruvate decarboxylase isozyme 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1 Back     alignment and function description
>sp|A2Y5L9|PDC1_ORYSI Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|P28516|PDC1_MAIZE Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q0DHF6|PDC1_ORYSJ Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|A2YQ76|PDC3_ORYSI Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=2 SV=2 Back     alignment and function description
>sp|Q0D3D2|PDC3_ORYSJ Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1 Back     alignment and function description
>sp|P51845|PDC1_TOBAC Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
70609688 589 pyruvate decarboxylase [Citrus sinensis] 1.0 0.731 1.0 0.0
224116936 593 predicted protein [Populus trichocarpa] 1.0 0.726 0.868 0.0
356549174 589 PREDICTED: pyruvate decarboxylase isozym 1.0 0.731 0.877 0.0
449433768 589 PREDICTED: pyruvate decarboxylase isozym 1.0 0.731 0.851 0.0
255563082 589 pyruvate decarboxylase, putative [Ricinu 1.0 0.731 0.856 0.0
224079117 582 predicted protein [Populus trichocarpa] 0.965 0.714 0.877 0.0
225443847 577 PREDICTED: pyruvate decarboxylase isozym 0.948 0.708 0.877 0.0
1706326 593 RecName: Full=Pyruvate decarboxylase iso 0.997 0.725 0.851 0.0
357446917 582 Pyruvate decarboxylase [Medicago truncat 0.981 0.726 0.862 0.0
224116452 548 predicted protein [Populus trichocarpa] 0.965 0.759 0.860 0.0
>gi|70609688|gb|AAZ05069.1| pyruvate decarboxylase [Citrus sinensis] Back     alignment and taxonomy information
 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/431 (100%), Positives = 431/431 (100%)

Query: 1   MDTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHL 60
           MDTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHL
Sbjct: 1   MDTANAMGSTGQPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHL 60

Query: 61  IAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC 120
           IAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC
Sbjct: 61  IAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC 120

Query: 121 IVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTAL 180
           IVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTAL
Sbjct: 121 IVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTAL 180

Query: 181 KESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVL 240
           KESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVL
Sbjct: 181 KESKPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVL 240

Query: 241 VGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIV 300
           VGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIV
Sbjct: 241 VGGPNIRVAKAQKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIV 300

Query: 301 ESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAK 360
           ESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAK
Sbjct: 301 ESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAK 360

Query: 361 KLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFN 420
           KLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFN
Sbjct: 361 KLRKNTTALENYRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFN 420

Query: 421 CQKLRLPENCG 431
           CQKLRLPENCG
Sbjct: 421 CQKLRLPENCG 431

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224116936|ref|XP_002317431.1| predicted protein [Populus trichocarpa] gi|222860496|gb|EEE98043.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549174|ref|XP_003542972.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449433768|ref|XP_004134669.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus] gi|449479245|ref|XP_004155547.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255563082|ref|XP_002522545.1| pyruvate decarboxylase, putative [Ricinus communis] gi|223538236|gb|EEF39845.1| pyruvate decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224079117|ref|XP_002305755.1| predicted protein [Populus trichocarpa] gi|222848719|gb|EEE86266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443847|ref|XP_002275486.1| PREDICTED: pyruvate decarboxylase isozyme 1 [Vitis vinifera] gi|297740479|emb|CBI30661.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|1706326|sp|P51850.1|PDC1_PEA RecName: Full=Pyruvate decarboxylase isozyme 1; Short=PDC gi|1177603|emb|CAA91444.1| pyruvate decarboxylase [Pisum sativum] Back     alignment and taxonomy information
>gi|357446917|ref|XP_003593734.1| Pyruvate decarboxylase [Medicago truncatula] gi|355482782|gb|AES63985.1| Pyruvate decarboxylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224116452|ref|XP_002331901.1| predicted protein [Populus trichocarpa] gi|222874573|gb|EEF11704.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
TAIR|locus:2160170 607 PDC2 "pyruvate decarboxylase-2 0.937 0.665 0.819 8.7e-182
TAIR|locus:2179132 603 AT5G01320 [Arabidopsis thalian 1.0 0.714 0.760 1.6e-180
TAIR|locus:2123827 607 AT4G33070 [Arabidopsis thalian 0.937 0.665 0.794 7e-180
TAIR|locus:2179147 592 PDC3 "pyruvate decarboxylase-3 0.967 0.704 0.758 2.6e-173
POMBASE|SPAC1F8.07c 569 SPAC1F8.07c "pyruvate decarbox 0.916 0.694 0.420 1.1e-80
POMBASE|SPAC186.09 572 SPAC186.09 "pyruvate decarboxy 0.918 0.692 0.401 8.7e-79
UNIPROTKB|O53865 560 kdc "Alpha-keto-acid decarboxy 0.907 0.698 0.362 3.4e-54
SGD|S000004124 563 PDC5 "Minor isoform of pyruvat 0.911 0.698 0.329 6.3e-53
TIGR_CMR|BA_2486 561 BA_2486 "indolepyruvate decarb 0.911 0.700 0.313 2.1e-52
SGD|S000004034 563 PDC1 "Major of three pyruvate 0.916 0.701 0.334 4.6e-50
TAIR|locus:2160170 PDC2 "pyruvate decarboxylase-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1764 (626.0 bits), Expect = 8.7e-182, P = 8.7e-182
 Identities = 331/404 (81%), Positives = 364/404 (90%)

Query:    28 TLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARS 87
             TLGR+LARRLVEIG  DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARS
Sbjct:    46 TLGRYLARRLVEIGVTDVFSVPGDFNLTLLDHLIAEPNLKLIGCCNELNAGYAADGYARS 105

Query:    88 RGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQ 147
             RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDFTQ
Sbjct:   106 RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFTQ 165

Query:   148 ELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPV 207
             ELRCFQA+TC QAV+NNL +AHELIDTAISTALKESKPVYISISCNLP IP PTF+R PV
Sbjct:   166 ELRCFQAVTCFQAVINNLEEAHELIDTAISTALKESKPVYISISCNLPAIPLPTFSRHPV 225

Query:   208 PFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIA 267
             PF L  KVSNQ+GL+AAVEA A+FLNKAVKPVLVGGP +RVAKA  AF+ELADA+GY +A
Sbjct:   226 PFMLPMKVSNQIGLDAAVEAAAEFLNKAVKPVLVGGPKMRVAKAADAFVELADASGYGLA 285

Query:   268 IMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKK 327
             +MPS KG VPEHH HFIGTYWGAVS++FC EIVESADAY+F GPIFNDYSSVGYSLL+KK
Sbjct:   286 VMPSAKGQVPEHHKHFIGTYWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKK 345

Query:   328 EKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQ 387
             EKAIIVQP RVT+GNGP+ G V M DFLS LAK+++ N T+ ENY RIYVP G P++   
Sbjct:   346 EKAIIVQPDRVTIGNGPAFGCVLMKDFLSELAKRIKHNNTSYENYHRIYVPEGKPLRDNP 405

Query:   388 NEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG 431
             NE LRVNVLF+HIQ+MLS ++AV+AETGDSWFNCQKL+LPE CG
Sbjct:   406 NESLRVNVLFQHIQNMLSSESAVLAETGDSWFNCQKLKLPEGCG 449
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004737 "pyruvate decarboxylase activity" evidence=ISS
GO:0016831 "carboxy-lyase activity" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
GO:0001666 "response to hypoxia" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2179132 AT5G01320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123827 AT4G33070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179147 PDC3 "pyruvate decarboxylase-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC1F8.07c SPAC1F8.07c "pyruvate decarboxylase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
POMBASE|SPAC186.09 SPAC186.09 "pyruvate decarboxylase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|O53865 kdc "Alpha-keto-acid decarboxylase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
SGD|S000004124 PDC5 "Minor isoform of pyruvate decarboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2486 BA_2486 "indolepyruvate decarboxylase, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
SGD|S000004034 PDC1 "Major of three pyruvate decarboxylase isozymes" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51845PDC1_TOBAC4, ., 1, ., 1, ., 10.80110.81670.8421N/Ano
P51846PDC2_TOBAC4, ., 1, ., 1, ., 10.76790.99760.7003N/Ano
Q10MW3PDC2_ORYSJ4, ., 1, ., 1, ., 10.79750.95820.6826yesno
A2XFI3PDC2_ORYSI4, ., 1, ., 1, ., 10.79750.95820.6815N/Ano
A2Y5L9PDC1_ORYSI4, ., 1, ., 1, ., 10.78670.94660.6743N/Ano
P28516PDC1_MAIZE4, ., 1, ., 1, ., 10.79400.93500.6606N/Ano
P51850PDC1_PEA4, ., 1, ., 1, ., 10.85180.99760.7251N/Ano
A2YQ76PDC3_ORYSI4, ., 1, ., 1, ., 10.73950.98600.7240N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.10.991
3rd Layer4.1.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
PLN02573 578 PLN02573, PLN02573, pyruvate decarboxylase 0.0
COG3961 557 COG3961, COG3961, Pyruvate decarboxylase and relat 1e-126
cd07038162 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) b 2e-88
TIGR03393 539 TIGR03393, indolpyr_decarb, indolepyruvate decarbo 4e-71
COG0028 550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 2e-40
TIGR03394 535 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylp 3e-39
pfam02776172 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate en 1e-36
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 1e-28
cd07035155 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) bindin 7e-27
pfam00205136 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate en 3e-20
PRK08266 542 PRK08266, PRK08266, hypothetical protein; Provisio 4e-20
PRK08611 576 PRK08611, PRK08611, pyruvate oxidase; Provisional 1e-16
PRK06456 572 PRK06456, PRK06456, acetolactate synthase catalyti 2e-16
TIGR00118 558 TIGR00118, acolac_lg, acetolactate synthase, large 3e-15
TIGR03457 579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 5e-15
PRK06276 586 PRK06276, PRK06276, acetolactate synthase catalyti 2e-14
PRK07064 544 PRK07064, PRK07064, hypothetical protein; Provisio 4e-14
cd07039164 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding dom 6e-14
PRK07525 588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 1e-12
PRK08155 564 PRK08155, PRK08155, acetolactate synthase catalyti 2e-12
PRK06154 565 PRK06154, PRK06154, hypothetical protein; Provisio 3e-12
PRK08978 548 PRK08978, PRK08978, acetolactate synthase 2 cataly 1e-11
PRK08322 547 PRK08322, PRK08322, acetolactate synthase; Reviewe 8e-11
PRK08979 572 PRK08979, PRK08979, acetolactate synthase 3 cataly 9e-11
COG3962 617 COG3962, COG3962, Acetolactate synthase [Amino aci 1e-10
PRK09107 595 PRK09107, PRK09107, acetolactate synthase 3 cataly 1e-10
PRK06048 561 PRK06048, PRK06048, acetolactate synthase 3 cataly 2e-10
PRK07282 566 PRK07282, PRK07282, acetolactate synthase catalyti 6e-10
PRK06466 574 PRK06466, PRK06466, acetolactate synthase 3 cataly 7e-10
PRK06965 587 PRK06965, PRK06965, acetolactate synthase 3 cataly 8e-10
CHL00099 585 CHL00099, ilvB, acetohydroxyacid synthase large su 8e-10
cd02005 183 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP 9e-10
PRK05858 542 PRK05858, PRK05858, hypothetical protein; Provisio 1e-09
PRK07789 612 PRK07789, PRK07789, acetolactate synthase 1 cataly 2e-09
PRK07524 535 PRK07524, PRK07524, hypothetical protein; Provisio 3e-09
PRK06112 578 PRK06112, PRK06112, acetolactate synthase catalyti 3e-09
PRK06457 549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 6e-09
TIGR02720 575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 2e-08
PRK07092 530 PRK07092, PRK07092, benzoylformate decarboxylase; 1e-07
PLN02470 585 PLN02470, PLN02470, acetolactate synthase 1e-07
PRK08199 557 PRK08199, PRK08199, thiamine pyrophosphate protein 6e-07
PRK06882 574 PRK06882, PRK06882, acetolactate synthase 3 cataly 8e-07
PRK08273 597 PRK08273, PRK08273, thiamine pyrophosphate protein 1e-06
PRK07418 616 PRK07418, PRK07418, acetolactate synthase 3 cataly 2e-06
PRK07979 574 PRK07979, PRK07979, acetolactate synthase 3 cataly 4e-06
PRK06725 570 PRK06725, PRK06725, acetolactate synthase 3 cataly 1e-05
TIGR01504 588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 2e-05
COG3960 592 COG3960, COG3960, Glyoxylate carboligase [General 2e-05
TIGR02418 539 TIGR02418, acolac_catab, acetolactate synthase, ca 2e-05
PRK08527 563 PRK08527, PRK08527, acetolactate synthase 3 cataly 2e-04
PRK11269 591 PRK11269, PRK11269, glyoxylate carboligase; Provis 2e-04
PRK08199 557 PRK08199, PRK08199, thiamine pyrophosphate protein 6e-04
PRK09259 569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 9e-04
PRK07789 612 PRK07789, PRK07789, acetolactate synthase 1 cataly 0.001
TIGR03254 554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 0.002
PRK07710 571 PRK07710, PRK07710, acetolactate synthase catalyti 0.002
>gnl|CDD|215311 PLN02573, PLN02573, pyruvate decarboxylase Back     alignment and domain information 
 Score =  895 bits (2315), Expect = 0.0
 Identities = 344/420 (81%), Positives = 376/420 (89%)

Query: 12  QPGSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGC 71
           Q  +        +S  TLGRHLARRLVEIG  DVFSVPGDFNLTLLDHLIAEP LNL+GC
Sbjct: 1   QSSAPKPATPVSSSDATLGRHLARRLVEIGVTDVFSVPGDFNLTLLDHLIAEPGLNLIGC 60

Query: 72  CNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG 131
           CNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG
Sbjct: 61  CNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG 120

Query: 132 TNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISIS 191
           TNRILHHTIGLPDF+QELRCFQ +TC QAV+NNL DAHELIDTAISTALKESKPVYIS+S
Sbjct: 121 TNRILHHTIGLPDFSQELRCFQTVTCYQAVINNLEDAHELIDTAISTALKESKPVYISVS 180

Query: 192 CNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKA 251
           CNL  IPHPTF+R+PVPFFL P++SN++ LEAAVEA A+FLNKAVKPVLVGGP +RVAKA
Sbjct: 181 CNLAAIPHPTFSREPVPFFLTPRLSNKMSLEAAVEAAAEFLNKAVKPVLVGGPKLRVAKA 240

Query: 252 QKAFIELADATGYPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGP 311
            KAF+ELADA+GYP+A+MPS KGLVPEHHPHFIGTYWGAVS+ FC EIVESADAY+F GP
Sbjct: 241 CKAFVELADASGYPVAVMPSAKGLVPEHHPHFIGTYWGAVSTPFCAEIVESADAYLFAGP 300

Query: 312 IFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALEN 371
           IFNDYSSVGYSLL+KKEKAIIVQP RVT+GNGP+ G V M DFL ALAK+++KNTTA EN
Sbjct: 301 IFNDYSSVGYSLLLKKEKAIIVQPDRVTIGNGPAFGCVLMKDFLEALAKRVKKNTTAYEN 360

Query: 372 YRRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCG 431
           Y+RI+VP G P+K    EPLRVNVLFKHIQ MLSGDTAVIAETGDSWFNCQKL+LPE CG
Sbjct: 361 YKRIFVPEGEPLKSEPGEPLRVNVLFKHIQKMLSGDTAVIAETGDSWFNCQKLKLPEGCG 420

Length = 578
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>gnl|CDD|132434 TIGR03393, indolpyr_decarb, indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|132435 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>gnl|CDD|217224 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|132918 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>gnl|CDD|215786 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132922 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|226471 COG3962, COG3962, Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|238963 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|235931 PRK07092, PRK07092, benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181344 PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|183066 PRK11269, PRK11269, glyoxylate carboligase; Provisional Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 431
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
PLN02573 578 pyruvate decarboxylase 100.0
COG3961 557 Pyruvate decarboxylase and related thiamine pyroph 100.0
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 100.0
KOG1184 561 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 100.0
PLN02470 585 acetolactate synthase 100.0
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK11269 591 glyoxylate carboligase; Provisional 100.0
TIGR03393 539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08155 564 acetolactate synthase catalytic subunit; Validated 100.0
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 100.0
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 100.0
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 100.0
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
PRK08199 557 thiamine pyrophosphate protein; Validated 100.0
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 100.0
PRK08273 597 thiamine pyrophosphate protein; Provisional 100.0
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
PRK08322 547 acetolactate synthase; Reviewed 100.0
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 100.0
PRK08617 552 acetolactate synthase; Reviewed 100.0
PRK06546 578 pyruvate dehydrogenase; Provisional 100.0
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 100.0
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 100.0
PRK08611 576 pyruvate oxidase; Provisional 100.0
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
PRK09124 574 pyruvate dehydrogenase; Provisional 100.0
PRK07524 535 hypothetical protein; Provisional 100.0
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK06154 565 hypothetical protein; Provisional 100.0
PRK05858 542 hypothetical protein; Provisional 100.0
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 100.0
PRK06457 549 pyruvate dehydrogenase; Provisional 100.0
PRK06112 578 acetolactate synthase catalytic subunit; Validated 100.0
PRK07064 544 hypothetical protein; Provisional 100.0
PRK08266 542 hypothetical protein; Provisional 100.0
PRK07092 530 benzoylformate decarboxylase; Reviewed 100.0
PRK08327 569 acetolactate synthase catalytic subunit; Validated 100.0
KOG1185 571 consensus Thiamine pyrophosphate-requiring enzyme 100.0
KOG4166 675 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK07586 514 hypothetical protein; Validated 100.0
PRK12474 518 hypothetical protein; Provisional 100.0
PRK07449 568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
COG3960 592 Glyoxylate carboligase [General function predictio 100.0
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
COG3962 617 Acetolactate synthase [Amino acid transport and me 100.0
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 100.0
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 100.0
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 100.0
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 100.0
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 100.0
COG1165 566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 100.0
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 99.98
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.97
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 99.96
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.94
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 99.61
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 99.59
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.48
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 98.93
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 98.9
COG1880170 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon 98.53
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 98.47
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 98.45
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 98.43
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 98.32
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit al 98.24
PRK08366390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 98.23
PRK08367394 porA pyruvate ferredoxin oxidoreductase subunit al 98.22
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 98.1
PF02552167 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA sy 97.73
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 97.64
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 97.31
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.04
COG1029 429 FwdB Formylmethanofuran dehydrogenase subunit B [E 96.77
COG4231 640 Indolepyruvate ferredoxin oxidoreductase, alpha an 95.96
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 95.85
cd02761 415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the 95.4
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 94.9
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 94.79
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 94.39
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 94.13
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 94.12
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 94.01
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 93.73
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 93.72
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 93.52
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 93.49
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 93.07
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 92.89
smart00861168 Transket_pyr Transketolase, pyrimidine binding dom 92.86
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 92.84
PRK03363313 fixB putative electron transfer flavoprotein FixB; 92.65
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 92.48
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 92.43
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 92.4
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 92.37
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 91.99
PF02233463 PNTB: NAD(P) transhydrogenase beta subunit; InterP 91.5
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 91.39
cd02768 386 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The Nuo 91.09
cd02752 649 MopB_Formate-Dh-Na-like Formate dehydrogenase N, a 91.07
TIGR03129 421 one_C_dehyd_B formylmethanofuran dehydrogenase sub 90.94
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 90.92
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 90.84
PRK06163202 hypothetical protein; Provisional 90.68
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [E 90.67
COG1282463 PntB NAD/NADP transhydrogenase beta subunit [Energ 90.52
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 90.19
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 90.18
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 90.15
PRK00481242 NAD-dependent deacetylase; Provisional 90.01
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 90.01
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 89.91
PRK14138244 NAD-dependent deacetylase; Provisional 89.71
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 89.63
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 89.46
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 89.31
cd02750 461 MopB_Nitrate-R-NarG-like Respiratory nitrate reduc 89.18
PRK11269591 glyoxylate carboligase; Provisional 89.18
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 89.18
PRK12753663 transketolase; Reviewed 89.1
PRK06546578 pyruvate dehydrogenase; Provisional 88.82
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 88.77
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 88.72
PLN02790654 transketolase 88.51
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 88.43
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 88.38
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 88.3
PTZ00089661 transketolase; Provisional 88.16
PRK12754663 transketolase; Reviewed 88.03
cd00368374 Molybdopterin-Binding Molybdopterin-Binding (MopB) 87.99
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 87.98
PTZ00408242 NAD-dependent deacetylase; Provisional 87.98
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 87.93
PRK08611576 pyruvate oxidase; Provisional 87.91
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 87.8
PRK08327569 acetolactate synthase catalytic subunit; Validated 87.73
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 87.54
PRK13012896 2-oxoacid dehydrogenase subunit E1; Provisional 87.39
PRK10886196 DnaA initiator-associating protein DiaA; Provision 87.38
cd02772 414 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second doma 87.19
CHL00099585 ilvB acetohydroxyacid synthase large subunit 87.03
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 86.96
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 86.81
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 86.76
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 86.61
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 86.59
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 86.59
cd02773375 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The s 86.49
PRK09124574 pyruvate dehydrogenase; Provisional 86.43
TIGR01591 671 Fdh-alpha formate dehydrogenase, alpha subunit, ar 86.42
TIGR03479 912 DMSO_red_II_alp DMSO reductase family type II enzy 86.28
PLN02470585 acetolactate synthase 86.26
TIGR00300407 conserved hypothetical protein TIGR00300. All memb 86.25
PRK05333285 NAD-dependent deacetylase; Provisional 86.2
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 86.15
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 85.97
PRK06112578 acetolactate synthase catalytic subunit; Validated 85.92
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 85.81
PRK05899624 transketolase; Reviewed 85.74
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 85.61
PTZ00409271 Sir2 (Silent Information Regulator) protein; Provi 85.52
cd02774366 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: M 85.49
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 85.35
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 85.25
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 85.19
cd02767 574 MopB_ydeP The MopB_ydeP CD includes a group of rel 85.16
PRK08617552 acetolactate synthase; Reviewed 85.01
PRK12571641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 85.01
PRK08155564 acetolactate synthase catalytic subunit; Validated 84.81
PRK05858542 hypothetical protein; Provisional 84.8
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 84.62
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 84.62
PRK05261785 putative phosphoketolase; Provisional 84.47
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 84.42
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 84.31
PRK08322547 acetolactate synthase; Reviewed 84.28
PLN02573578 pyruvate decarboxylase 84.27
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 84.16
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 84.0
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 83.95
cd02753 512 MopB_Formate-Dh-H Formate dehydrogenase H (Formate 83.95
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 83.92
PRK06154565 hypothetical protein; Provisional 83.49
PRK05444580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 83.43
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 83.24
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 83.02
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 82.86
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 82.83
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 82.64
PRK07064544 hypothetical protein; Provisional 82.62
CHL00144327 odpB pyruvate dehydrogenase E1 component beta subu 82.33
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 81.84
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 81.53
PRK07524535 hypothetical protein; Provisional 81.44
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 81.31
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 81.24
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 80.74
PRK13936197 phosphoheptose isomerase; Provisional 80.64
TIGR01701 743 Fdhalpha-like oxidoreductase alpha (molybdopterin) 80.58
PRK09129 776 NADH dehydrogenase subunit G; Validated 80.54
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 80.35
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 80.26
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-76  Score=613.24  Aligned_cols=381  Identities=26%  Similarity=0.381  Sum_probs=320.6

Q ss_pred             cccHHHHHHHHHHHcCCCEEEecCCCchHHHHHhhhcCCCceEEecCchhHHHHhhhhhhhhcC-ccEEEEeCCcchHHH
Q 014091           26 VGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRG-VGACVVTFTVGGLSV  104 (431)
Q Consensus        26 ~~~~a~~l~~~L~~~GV~~vFgvpG~~~~~l~~al~~~~~i~~v~~~hE~~A~~~A~gyar~tg-~gv~~~t~GpG~~n~  104 (431)
                      +|+++|+|++.|+++||++|||+||+.+++|+|+|.++ +||+|+||||++|+||||||+|+|| +|||++|+|||++|+
T Consensus         1 ~~~ga~~lv~~L~~~GV~~VFGiPG~~i~~~~dal~~~-~i~~I~~RHEq~Aa~mAdgyar~TGkpgV~~~tsGPGatN~   79 (550)
T COG0028           1 MMTGAEALVEALEANGVDTVFGIPGGSILPLYDALYDS-GIRHILVRHEQGAAFAADGYARATGKPGVCLVTSGPGATNL   79 (550)
T ss_pred             CCcHHHHHHHHHHHcCCcEEEeCCCccHHHHHHHHHhC-CCcEEEeccHHHHHHHHHHHHHHcCCCEEEEECCCCcHHHH
Confidence            47899999999999999999999999999999999986 8999999999999999999999999 999999999999999


Q ss_pred             HHHHHHhhhcCCcEEEEeCCCCCcccCCCceeeeecCCCChHHHHHHHhhheeeEEEcCCcchHHHHHHHHHHHhhhCC-
Q 014091          105 LNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKES-  183 (431)
Q Consensus       105 ~~gl~~A~~~~~Pvl~I~g~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~k~~~~v~~~~~~~~~i~~A~~~A~~~~-  183 (431)
                      ++||++|+.|++|||+||||+++...+++     .+|   -.|+..+++++|||++++.+++++++.+++||+.|.++| 
T Consensus        80 ~tgla~A~~d~~Pll~itGqv~~~~~g~~-----afQ---e~D~~~l~~p~tk~~~~v~~~~~ip~~i~~Af~~A~sgrp  151 (550)
T COG0028          80 LTGLADAYMDSVPLLAITGQVPTSLIGTD-----AFQ---EVDQVGLFRPITKYNFEVRSPEDIPEVVARAFRIALSGRP  151 (550)
T ss_pred             HHHHHHHHhcCCCEEEEeCCccccccCcc-----hhh---hcchhhHhhhhheeEEEeCCHHHHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999988887     333   348999999999999999999999999999999999975 


Q ss_pred             CcEEEEEccCCCCCCCCCCCCCCCCccCCCCCCChhhHHHHHHHHHHHHHhcCCCEEEeCCccchhchHHHHHHHHHHhC
Q 014091          184 KPVYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATG  263 (431)
Q Consensus       184 GPv~l~iP~dv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~a~rpvI~~G~g~~~~~a~~~l~~lae~~~  263 (431)
                      |||||+||.|++..+.....+..... ....+. ..+. +++++++++|++||||+|++|+|+.++++.+++++|+|+++
T Consensus       152 Gpv~i~iP~Dv~~~~~~~~~~~~~~~-~~~~p~-~~~~-~~i~~aa~~L~~AkrPvIl~G~G~~~a~a~~~l~~lae~~~  228 (550)
T COG0028         152 GPVVVDLPKDVLAAEAEEPGPEPAIL-PPYRPA-PPPP-EAIRKAAELLAEAKRPVILAGGGVRRAGASEELRELAEKLG  228 (550)
T ss_pred             ceEEEEcChhHhhccccccccccccc-ccCCCC-CCcH-HHHHHHHHHHHhCCCCEEEECCCccccccHHHHHHHHHHHC
Confidence            99999999999885322211111111 111111 1122 78999999999999999999999999999999999999999


Q ss_pred             CCeEecCCCcccCCCCCCCcceeecCCCCCHHHHHHhhhCCEEEEeCCccCcccccccccCCCCcceEEEccCceeecCC
Q 014091          264 YPIAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNG  343 (431)
Q Consensus       264 ~Pv~tt~~gkg~~~~~hp~~~G~~~G~~~~~~~~~~~~~aD~vl~lG~~~~~~~~~~~~~~~~~~~~I~Id~d~~~~~~~  343 (431)
                      +||++|++|||++|++||+++|+. |+.|+..+++++++||+||++|+||+++.++ |..|.++.++||||+|+.+++ +
T Consensus       229 ~Pv~~t~~gkg~~p~~hp~~lG~~-g~~g~~~a~~~~~~aDlll~vG~rf~~~~~~-~~~f~~~~~ii~iDidp~ei~-k  305 (550)
T COG0028         229 APVVTTLMGKGAVPEDHPLSLGML-GMHGTKAANEALEEADLLLAVGARFDDRVTG-YSGFAPPAAIIHIDIDPAEIG-K  305 (550)
T ss_pred             CCEEEccCcCccCCCCCccccccc-cccccHHHHHHhhcCCEEEEecCCCcccccc-hhhhCCcCCEEEEeCChHHhC-C
Confidence            999999999999999999999995 9988888999999999999999999999987 776665544999999999998 5


Q ss_pred             Ccccc----ccHHHHHHHHHHHhccc-cchhhhh---hhccCCCCCCCCCCCCCCcCHHHHHHHHHhhCCCCCEEEecCC
Q 014091          344 PSLGW----VFMADFLSALAKKLRKN-TTALENY---RRIYVPPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETG  415 (431)
Q Consensus       344 ~~~~~----~d~~~~L~~L~~~l~~~-~~~~~~~---~~~~~~~~~~~~~~~~~~l~~~~~~~~L~~~l~~~~ivv~D~G  415 (431)
                      ++..+    .|++.+|++|.+.+... ..|+.+.   ++.+.....  ........+|+++++.|++.+++|+|+++|+|
T Consensus       306 ~~~~~~~i~gD~~~~l~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~p~~v~~~l~~~~~~daiv~~d~G  383 (550)
T COG0028         306 NYPVDVPIVGDAKATLEALLEELKPERAAWLEELLEARAAYRDLAL--EELADDGIKPQYVIKVLRELLPDDAIVVTDVG  383 (550)
T ss_pred             CCCCCeeEeccHHHHHHHHHHhhhhcchHHHHHHHHHHHhhhhhhh--hccCCCccCHHHHHHHHHHhCCCCeEEEeCCc
Confidence            54444    29999999999988753 2222222   111111111  11122223899999999999999999999999


Q ss_pred             hhhhhccc
Q 014091          416 DSWFNCQK  423 (431)
Q Consensus       416 ~~~~~~~~  423 (431)
                      ++..|..+
T Consensus       384 ~~~~w~a~  391 (550)
T COG0028         384 QHQMWAAR  391 (550)
T ss_pred             HHHHHHHH
Confidence            99998653

>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>PF02552 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina mazei (Methanosarcina frisia) Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer [] Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PF02233 PNTB: NAD(P) transhydrogenase beta subunit; InterPro: IPR012136 NAD(P) transhydrogenase catalyses the transfer of reducing equivalents between NAD(H) and NADP(H), coupled to the translocation of protons across a membrane [] Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) Back     alignment and domain information
>cd02752 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E Back     alignment and domain information
>TIGR03129 one_C_dehyd_B formylmethanofuran dehydrogenase subunit B Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>COG1282 PntB NAD/NADP transhydrogenase beta subunit [Energy production and conversion] Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>cd00368 Molybdopterin-Binding Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>cd02772 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>cd02773 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1 Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type Back     alignment and domain information
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>TIGR00300 conserved hypothetical protein TIGR00300 Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>cd02774 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: Mitochondrial-encoded NADH-quinone oxidoreductase/respiratory complex I, the second domain of the Nad11/75-kDa subunit of some protists Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd02767 MopB_ydeP The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
2vbi_A 566 Holostructure Of Pyruvate Decarboxylase From Acetob 1e-83
2wva_A 568 Structural Insights Into The Pre-Reaction State Of 2e-76
3oe1_A 568 Pyruvate Decarboxylase Variant Glu473asp From Z. Mo 2e-76
1zpd_A 568 Pyruvate Decarboxylase From Zymomonas Mobilis Lengt 5e-73
2vjy_A 563 Pyruvate Decarboxylase From Kluyveromyces Lactis In 7e-53
2vbf_A 570 The Holostructure Of The Branched-Chain Keto Acid D 3e-50
2vk8_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 3e-49
1pyd_A 556 Catalytic Centers In The Thiamin Diphosphate Depend 4e-49
1pvd_A 555 Crystal Structure Of The Thiamin Diphosphate Depend 4e-49
2w93_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 5e-49
1qpb_A 563 Pyruvate Decarboyxlase From Yeast (Form B) Complexe 1e-48
2vk1_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 3e-48
1ovm_A 552 Crystal Structure Of Indolepyruvate Decarboxylase F 6e-47
2nxw_A 565 Crystal Structure Of Phenylpyruvate Decarboxylase O 3e-24
3e9y_A 584 Arabidopsis Thaliana Acetohydroxyacid Synthase In C 1e-09
1n0h_A 677 Crystal Structure Of Yeast Acetohydroxyacid Synthas 1e-09
1jsc_A 630 Crystal Structure Of The Catalytic Subunit Of Yeast 2e-09
1ybh_A 590 Crystal Structure Of Arabidopsis Thaliana Acetohydr 2e-09
2pgn_A 589 The Crystal Structure Of Fad And Thdp-Dependent Cyc 4e-06
2c31_A 568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 5e-06
1pi3_A 528 E28q Mutant Benzoylformate Decarboxylase From Pseud 4e-05
3fzn_A 534 Intermediate Analogue In Benzoylformate Decarboxyla 4e-05
1mcz_A 528 Benzoylformate Decarboxylase From Pseudomonas Putid 4e-05
2v3w_A 528 Crystal Structure Of The Benzoylformate Decarboxyla 5e-05
3f6b_X 525 Crystal Structure Of Benzoylformate Decarboxylase I 5e-05
1yno_A 527 High Resolution Structure Of Benzoylformate Decarbo 5e-05
2fn3_A 528 High Resolution Structure Of S26a Mutant Of Benzoyl 7e-05
1po7_A 528 High Resolution Structure Of E28a Mutant Benzoylfor 7e-05
2fwn_A 528 Phosphorylation Of An Active Site Serine In A Thdp- 7e-05
2ez4_A 603 Pyruvate Oxidase Variant F479w Length = 603 2e-04
1pow_A 585 The Refined Structures Of A Stabilized Mutant And O 2e-04
4fee_A 603 High-Resolution Structure Of Pyruvate Oxidase In Co 2e-04
1y9d_A 603 Pyruvate Oxidase Variant V265a From Lactobacillus P 5e-04
1pox_A 585 The Refined Structures Of A Stabilized Mutant And O 7e-04
>pdb|2VBI|A Chain A, Holostructure Of Pyruvate Decarboxylase From Acetobacter Pasteurianus Length = 566 Back     alignment and structure 
Iteration: 1

 Score =  306 bits (785), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 170/401 (42%), Positives = 236/401 (58%), Gaps = 6/401 (1%)
Query: 28  TLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARS 87
           T+G +LA RLV+IG K  F+V GD+NL LLD L+   ++  + CCNELN G++A+GYARS
Sbjct: 4   TVGMYLAERLVQIGLKHHFAVAGDYNLVLLDQLLLNKDMKQIYCCNELNCGFSAEGYARS 63
Query: 88  RGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQ 147
            G  A VVTF+VG +S +NA+ GAY+ENLPVI I G PNSND GT  ILHHTIG  D++ 
Sbjct: 64  NGAAAAVVTFSVGAISAMNALGGAYAENLPVILISGAPNSNDQGTGHILHHTIGKTDYSY 123
Query: 148 ELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPV 207
           +L   + +TC+   + +   A   ID  I TAL+E KP Y+ I+CN+     P     PV
Sbjct: 124 QLEMARQVTCAAESITDAHSAPAKIDHVIRTALRERKPAYLDIACNIAS--EPCVRPGPV 181
Query: 208 PFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIA 267
              L+    +   L+AAV+AT   L K+  PV++ G  +R A A  A   LAD     + 
Sbjct: 182 SSLLSEPEIDHTSLKAAVDATVALLEKSASPVMLLGSKLRAANALAATETLADKLQCAVT 241
Query: 268 IMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKK 327
           IM + KG  PE H  F G YWG VS+    E+VE++DA + + P+FNDYS+VG+S   K 
Sbjct: 242 IMAAAKGFFPEDHAGFRGLYWGEVSNPGVQELVETSDALLCIAPVFNDYSTVGWSAWPKG 301
Query: 328 EKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPPGIPVKRAQ 387
              I+ +P RVTV      G+   A FL ALA+K      + +   +  VP       + 
Sbjct: 302 PNVILAEPDRVTVDGRAYDGFTLRA-FLQALAEKAPARPASAQ---KSSVPTCSLTATSD 357
Query: 388 NEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPE 428
              L  + + +HI  +L+ +T ++AETGDSWFN  ++ LP 
Sbjct: 358 EAGLTNDEIVRHINALLTSNTTLVAETGDSWFNAMRMTLPR 398
>pdb|2WVA|A Chain A, Structural Insights Into The Pre-Reaction State Of Pyruvate Decarboxylase From Zymomonas Mobilis Length = 568 Back     alignment and structure
>pdb|3OE1|A Chain A, Pyruvate Decarboxylase Variant Glu473asp From Z. Mobilis In Complex With Reaction Intermediate 2-Lactyl-Thdp Length = 568 Back     alignment and structure
>pdb|1ZPD|A Chain A, Pyruvate Decarboxylase From Zymomonas Mobilis Length = 568 Back     alignment and structure
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In Complex With The Substrate Analogue Methyl Acetylphosphonate Length = 563 Back     alignment and structure
>pdb|2VBF|A Chain A, The Holostructure Of The Branched-Chain Keto Acid Decarboxylase (Kdca) From Lactococcus Lactis Length = 570 Back     alignment and structure
>pdb|2VK8|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|1PYD|A Chain A, Catalytic Centers In The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase At 2.4 Angstroms Resolution Length = 556 Back     alignment and structure
>pdb|1PVD|A Chain A, Crystal Structure Of The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase From The Yeast Saccharomyces Cerevisiae At 2.3 Angstroms Resolution Length = 555 Back     alignment and structure
>pdb|2W93|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With The Surrogate Pyruvamide Length = 563 Back     alignment and structure
>pdb|1QPB|A Chain A, Pyruvate Decarboyxlase From Yeast (Form B) Complexed With Pyruvamide Length = 563 Back     alignment and structure
>pdb|2VK1|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant D28a In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|1OVM|A Chain A, Crystal Structure Of Indolepyruvate Decarboxylase From Enterobacter Cloacae Length = 552 Back     alignment and structure
>pdb|2NXW|A Chain A, Crystal Structure Of Phenylpyruvate Decarboxylase Of Azospirillum Brasilense Length = 565 Back     alignment and structure
>pdb|3E9Y|A Chain A, Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With Monosulfuron Length = 584 Back     alignment and structure
>pdb|1N0H|A Chain A, Crystal Structure Of Yeast Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide, Chlorimuron Ethyl Length = 677 Back     alignment and structure
>pdb|1JSC|A Chain A, Crystal Structure Of The Catalytic Subunit Of Yeast Acetohydroxyacid Synthase: A Target For Herbicidal Inhibitors Length = 630 Back     alignment and structure
>pdb|1YBH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl Length = 590 Back     alignment and structure
>pdb|2PGN|A Chain A, The Crystal Structure Of Fad And Thdp-Dependent Cyclohexane-1,2-Dione Hydrolase In Complex With Cyclohexane-1,2-Dione Length = 589 Back     alignment and structure
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|1PI3|A Chain A, E28q Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|3FZN|A Chain A, Intermediate Analogue In Benzoylformate Decarboxylase Length = 534 Back     alignment and structure
>pdb|1MCZ|A Chain A, Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With An Inhibitor, R-Mandelate Length = 528 Back     alignment and structure
>pdb|2V3W|A Chain A, Crystal Structure Of The Benzoylformate Decarboxylase Variant L461a From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|3F6B|X Chain X, Crystal Structure Of Benzoylformate Decarboxylase In Complex With The Pyridyl Inhibitor Paa Length = 525 Back     alignment and structure
>pdb|1YNO|A Chain A, High Resolution Structure Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 527 Back     alignment and structure
>pdb|2FN3|A Chain A, High Resolution Structure Of S26a Mutant Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 528 Back     alignment and structure
>pdb|1PO7|A Chain A, High Resolution Structure Of E28a Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|2FWN|A Chain A, Phosphorylation Of An Active Site Serine In A Thdp- Dependent Enzyme By Phosphonate Inactivation Length = 528 Back     alignment and structure
>pdb|2EZ4|A Chain A, Pyruvate Oxidase Variant F479w Length = 603 Back     alignment and structure
>pdb|1POW|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|4FEE|A Chain A, High-Resolution Structure Of Pyruvate Oxidase In Complex With Reaction Intermediate 2-Hydroxyethyl-Thiamin Diphosphate Carbanion-Enamine, Crystal B Length = 603 Back     alignment and structure
>pdb|1Y9D|A Chain A, Pyruvate Oxidase Variant V265a From Lactobacillus Plantarum Length = 603 Back     alignment and structure
>pdb|1POX|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 0.0
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 0.0
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 1e-171
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 1e-166
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 1e-162
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 1e-105
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 4e-26
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 6e-21
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 8e-21
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 2e-20
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 8e-18
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 2e-15
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 1e-14
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 1e-12
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 2e-10
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 5e-08
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 9e-07
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 1e-06
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 1e-06
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 8e-06
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 2e-06
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 6e-05
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 2e-06
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 7e-06
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 2e-06
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 3e-05
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 3e-06
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 2e-05
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
 Score =  532 bits (1372), Expect = 0.0
 Identities = 160/404 (39%), Positives = 241/404 (59%), Gaps = 4/404 (0%)

Query: 28  TLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARS 87
           T+G +LA RLV+IG K  F+V GD+NL LLD+L+    +  V CCNELN G++A+GYAR+
Sbjct: 4   TVGTYLAERLVQIGLKHHFAVAGDYNLVLLDNLLLNKNMEQVYCCNELNCGFSAEGYARA 63

Query: 88  RGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQ 147
           +G  A VVT++VG LS  +AI GAY+ENLPVI I G PN+ND+    +LHH +G  D+  
Sbjct: 64  KGAAAAVVTYSVGALSAFDAIGGAYAENLPVILISGAPNNNDHAAGHVLHHALGKTDYHY 123

Query: 148 ELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFARDPV 207
           +L   + IT +   +    +A   ID  I TAL+E KPVY+ I+CN+  +P    A  P 
Sbjct: 124 QLEMAKNITAAAEAIYTPEEAPAKIDHVIKTALREKKPVYLEIACNIASMPCA--APGPA 181

Query: 208 PFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIA 267
                 + S++  L AAVE T  F+    K  ++ G  +R A A++A ++ ADA G  +A
Sbjct: 182 SALFNDEASDEASLNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGAVA 241

Query: 268 IMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKK 327
            M + K   PE +PH+IGT WG VS     + ++ ADA + + P+FNDYS+ G++ +   
Sbjct: 242 TMAAAKSFFPEENPHYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDP 301

Query: 328 EKAIIVQPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPP-GIPVKRA 386
           +K ++ +P  V V  G     V + D+L+ LA+K+ K T AL+ ++ +            
Sbjct: 302 KKLVLAEPRSVVVN-GIRFPSVHLKDYLTRLAQKVSKKTGALDFFKSLNAGELKKAAPAD 360

Query: 387 QNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENC 430
            + PL    + + ++ +L+ +T VIAETGDSWFN Q+++LP   
Sbjct: 361 PSAPLVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGA 404
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Length = 590 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 100.0
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.88
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 99.72
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 99.59
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 97.49
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subun 94.87
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 94.33
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 94.3
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 94.09
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 94.08
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 93.92
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 93.5
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 92.52
1w85_B324 Pyruvate dehydrogenase E1 component, beta subunit; 92.5
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heter 92.36
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 92.21
1efv_A315 Electron transfer flavoprotein; electron transport 92.01
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 91.86
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 90.9
1o97_D320 Electron transferring flavoprotein alpha-subunit; 90.71
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 90.67
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 90.66
2bfd_B342 2-oxoisovalerate dehydrogenase beta subunit; oxido 90.63
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 89.53
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 89.48
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 89.35
3l84_A632 Transketolase; TKT, structural genomics, center fo 89.34
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 89.32
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 89.19
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 89.17
1m2k_A249 Silent information regulator 2; protein-ligand com 88.77
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 88.75
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 88.69
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 88.42
3c2q_A345 Uncharacterized conserved protein; putative LOR/SD 88.38
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 88.16
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 87.84
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 87.61
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 86.94
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 86.85
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 86.28
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 85.89
1gpu_A680 Transketolase; transferase(ketone residues); HET: 85.24
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 85.07
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 84.95
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 84.64
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 84.23
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 83.85
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 83.8
2iv2_X 715 Formate dehydrogenase H; oxidoreductase, 4Fe-4S, a 83.41
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 83.33
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 82.66
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 82.41
3uk1_A711 Transketolase; structural genomics, seattle struct 82.02
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 80.36
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-71  Score=585.56  Aligned_cols=401  Identities=40%  Similarity=0.696  Sum_probs=338.8

Q ss_pred             cccHHHHHHHHHHHcCCCEEEecCCCchHHHHHhhhcCCCceEEecCchhHHHHhhhhhhhhcCccEEEEeCCcchHHHH
Q 014091           26 VGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  105 (431)
Q Consensus        26 ~~~~a~~l~~~L~~~GV~~vFgvpG~~~~~l~~al~~~~~i~~v~~~hE~~A~~~A~gyar~tg~gv~~~t~GpG~~n~~  105 (431)
                      +|+++++|++.|+++||++|||+||+.+++|+++|.++++|++|.++||++|+|||+||+|+||++||++|+|||++|++
T Consensus         2 ~~~~a~~l~~~L~~~GV~~vfg~PG~~~~~l~~al~~~~~i~~i~~~~E~~Aa~~A~Gyar~tg~~v~~~TsGpG~~N~~   81 (568)
T 2wvg_A            2 SYTVGTYLAERLVQIGLKHHFAVAGDYNLVLLDNLLLNKNMEQVYCCNELNCGFSAEGYARAKGAAAAVVTYSVGALSAF   81 (568)
T ss_dssp             CEEHHHHHHHHHHHTTCSEEEECCCTTTHHHHHHHHTCTTSEEEECSSHHHHHHHHHHHHHHHSCEEEEECTTTTHHHHH
T ss_pred             CcCHHHHHHHHHHHcCCCEEEeCCCCccHHHHHHHhccCCceEeccCcHHHHHHHHHHHHHhhCCeEEEEeCCCCHHHHH
Confidence            47899999999999999999999999999999999876689999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhcCCcEEEEeCCCCCcccCCCceeeeecCCCChHHHHHHHhhheeeEEEcCCcchHHHHHHHHHHHhhhCCCc
Q 014091          106 NAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKP  185 (431)
Q Consensus       106 ~gl~~A~~~~~Pvl~I~g~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~k~~~~v~~~~~~~~~i~~A~~~A~~~~GP  185 (431)
                      +||++|+.+++|||+|+|++++..++++..+||.++.+++.||..+|+++|||++++++++++++.+++|++.|.+++||
T Consensus        82 ~gia~A~~~~vPll~itg~~~~~~~~~~~~~~~~~g~~~~~d~~~~~~~~tk~~~~v~~~~~~~~~l~~A~~~A~~~~GP  161 (568)
T 2wvg_A           82 DAIGGAYAENLPVILISGAPNNNDHAAGHVLHHALGKTDYHYQLEMAKNITAAAEAIYTPEEAPAKIDHVIKTALREKKP  161 (568)
T ss_dssp             HHHHHHHHTTCCEEEEEEECCGGGTTTTCBCTTSCSSSCCCHHHHHHTTSCSCEEEECSGGGHHHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHhhhCCCEEEEeCCCChhHhccCcceeeeccccchHHHHHHHHhhEeEEEEeCCHHHHHHHHHHHHHHHHhCCCC
Confidence            99999999999999999999999888887778877666777999999999999999999999999999999999998899


Q ss_pred             EEEEEccCCCCCCCCCCCCCCCCccCCCCCCChhhHHHHHHHHHHHHHhcCCCEEEeCCccchhchHHHHHHHHHHhCCC
Q 014091          186 VYISISCNLPGIPHPTFARDPVPFFLAPKVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYP  265 (431)
Q Consensus       186 v~l~iP~dv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~a~rpvI~~G~g~~~~~a~~~l~~lae~~~~P  265 (431)
                      |||+||.|++..+  .......+...........+.++.+++++++|+++|||+|++|.|+.++++.+++++|||++++|
T Consensus       162 V~l~iP~dv~~~~--~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~a~rpvil~G~g~~~~~a~~~l~~lae~~~~P  239 (568)
T 2wvg_A          162 VYLEIACNIASMP--CAAPGPASALFNDEASDEASLNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGA  239 (568)
T ss_dssp             EEEEEEGGGTTSE--ECEECCTHHHHCCCCCCHHHHHHHHHHHHHHHTTCCCEEEEECTTTTTTTCHHHHHHHHHHHCCE
T ss_pred             EEEEechhHhcCc--ccCCCcccccccCCCCCccccHHHHHHHHHHHHhCCCCEEEECccccccchHHHHHHHHHHhCCC
Confidence            9999999997632  21100111101111112234567899999999999999999999999888999999999999999


Q ss_pred             eEecCCCcccCCCCCCCcceeecCCCCCHHHHHHhhhCCEEEEeCCccCcccccccccCCCCcceEEEccCceeecCCCc
Q 014091          266 IAIMPSGKGLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIVQPHRVTVGNGPS  345 (431)
Q Consensus       266 v~tt~~gkg~~~~~hp~~~G~~~G~~~~~~~~~~~~~aD~vl~lG~~~~~~~~~~~~~~~~~~~~I~Id~d~~~~~~~~~  345 (431)
                      |++|++|||.||++||+++|+|.|..++..++++++++|+||++|+++.++.+..|..+.++.++||||.|+.+++ .+.
T Consensus       240 v~~t~~~kg~~~~~~p~~~G~~~g~~~~~~~~~~l~~aDlvl~iG~~~~~~~~~~~~~~~~~~~~i~id~d~~~~~-~~~  318 (568)
T 2wvg_A          240 VATMAAAKSFFPEENPHYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLAEPRSVVVN-GIR  318 (568)
T ss_dssp             EEEEGGGTTSSCTTSTTEEEEECGGGSCTTHHHHHHHCSEEEEESCCCBTTTTTTTTCCCCTTTEEEECSSEEEET-TEE
T ss_pred             EEEchhcCccCCCCCCceeccccCCcCCHHHHHHHHhCCEEEEECCCcccccccccccCCCCCcEEEEeCChhhcC-Cee
Confidence            9999999999999999999998788888899999999999999999999888877876667789999999999997 566


Q ss_pred             cccccHHHHHHHHHHHhccccchhhhhhhccC-CCCCCCCCCCCCCcCHHHHHHHHHhhCCCCCEEEecCChhhhhcccc
Q 014091          346 LGWVFMADFLSALAKKLRKNTTALENYRRIYV-PPGIPVKRAQNEPLRVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKL  424 (431)
Q Consensus       346 ~~~~d~~~~L~~L~~~l~~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~~~~~~~~L~~~l~~~~ivv~D~G~~~~~~~~~  424 (431)
                      +.+++++++|++|.+.+......|..|.+... ............++++..+++.|++.+++++++++|+|++.++..++
T Consensus       319 ~~~~~~~~~l~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~iv~~d~G~~~~~~~~~  398 (568)
T 2wvg_A          319 FPSVHLKDYLTRLAQKVSKKTGALDFFKSLNAGELKKAAPADPSAPLVNAEIARQVEALLTPNTTVIAETGDSWFNAQRM  398 (568)
T ss_dssp             EESCCHHHHHHHHHHHCCCCCHHHHHHHHTTCCSCCCCCCCCTTSBCCHHHHHHHHHTTCCTTEEEEECSSHHHHHHHTC
T ss_pred             cCCCCHHHHHHHHHHhccccccchhhhhhhhhhcccccccCCCCCccCHHHHHHHHHHhCCCCCEEEEcCcHHHHHHhhc
Confidence            66778999999999887643222333433211 11111111123569999999999999999999999999997666677


Q ss_pred             ccCCC
Q 014091          425 RLPEN  429 (431)
Q Consensus       425 ~~p~g  429 (431)
                      +++++
T Consensus       399 ~~~~~  403 (568)
T 2wvg_A          399 KLPNG  403 (568)
T ss_dssp             CCCTT
T ss_pred             ccCCC
Confidence            66643
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>3c2q_A Uncharacterized conserved protein; putative LOR/SDH, structural genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis S2} Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 431
d1zpda1175 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymom 7e-34
d1zpda2186 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomon 2e-28
d1pvda2180 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's 4e-28
d1pvda1179 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker 1e-25
d1ovma1161 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxyla 4e-25
d1ovma2178 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase 9e-22
d1t9ba2175 c.36.1.5 (A:89-263) Acetohydroxyacid synthase cata 1e-21
d1ybha2195 c.36.1.5 (A:86-280) Acetohydroxyacid synthase cata 1e-20
d2ez9a2174 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus 2e-12
d2djia2184 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus vi 3e-11
d1ozha2181 c.36.1.5 (A:7-187) Catabolic acetolactate synthase 2e-10
d2ihta1177 c.31.1.3 (A:198-374) Carboxyethylarginine synthase 5e-10
d1ytla1158 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synth 1e-09
d1ozha1179 c.31.1.3 (A:188-366) Catabolic acetolactate syntha 2e-09
d2ihta2186 c.36.1.5 (A:12-197) Carboxyethylarginine synthase 2e-07
d1q6za1160 c.31.1.3 (A:182-341) Benzoylformate decarboxylase 7e-07
d2ji7a1175 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxa 7e-07
d1zpda3 204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 2e-06
d2ji7a2188 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalo 6e-06
d1ybha1179 c.31.1.3 (A:281-459) Acetohydroxyacid synthase cat 2e-05
d1q6za2180 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {P 3e-05
d1ovma3 196 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxyla 1e-04
d1pvda3 196 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker 3e-04
d1t9ba1171 c.31.1.3 (A:290-460) Acetohydroxyacid synthase cat 7e-04
d2djia1177 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus 0.002
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Pyruvate oxidase and decarboxylase, middle domain
domain: Pyruvate decarboxylase
species: Zymomonas mobilis [TaxId: 542]

 Score =  122 bits (307), Expect = 7e-34
 Identities = 53/166 (31%), Positives = 93/166 (56%), Gaps = 1/166 (0%)

Query: 214 KVSNQLGLEAAVEATADFLNKAVKPVLVGGPNIRVAKAQKAFIELADATGYPIAIMPSGK 273
           + S++  L AAV+ T  F+    K  ++ G  +R A A++A ++  DA G  +A M + K
Sbjct: 1   EASDEASLNAAVDETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFTDALGGAVATMAAAK 60

Query: 274 GLVPEHHPHFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKAIIV 333
              PE +  +IGT WG VS     + ++ ADA + + P+FNDYS+ G++ +   +K ++ 
Sbjct: 61  SFFPEENALYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLA 120

Query: 334 QPHRVTVGNGPSLGWVFMADFLSALAKKLRKNTTALENYRRIYVPP 379
           +P  V V NG     V + D+L+ LA+K+ K T +L+ ++ +    
Sbjct: 121 EPRSVVV-NGIRFPSVHLKDYLTRLAQKVSKKTGSLDFFKSLNAGE 165
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 186 Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 179 Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 161 Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 178 Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 195 Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 174 Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 184 Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 181 Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 177 Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 158 Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 186 Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 160 Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 175 Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 188 Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 179 Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 180 Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 196 Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 177 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 100.0
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 100.0
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 100.0
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 100.0
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 100.0
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 100.0
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 100.0
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 100.0
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 100.0
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.97
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.97
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.97
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 99.95
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.95
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.95
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.95
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.94
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.94
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.93
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.9
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.81
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 98.25
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 96.15
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 95.79
d1efva2124 C-terminal domain of the electron transfer flavopr 95.55
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 95.45
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 95.39
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 94.83
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 94.46
d3clsd2123 C-terminal domain of the electron transfer flavopr 94.31
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 94.07
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 94.05
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 93.8
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 93.62
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 93.48
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 93.06
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 92.55
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 92.41
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 91.89
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 91.77
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 91.63
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 91.03
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 90.74
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 90.33
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 89.21
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 88.68
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 88.51
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 88.2
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 87.48
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 86.68
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 84.7
d1y5ia2 1074 Respiratory nitrate reductase 1 alpha chain {Esche 81.29
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 81.28
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Pyruvate decarboxylase
species: Zymomonas mobilis [TaxId: 542]

Probab=100.00  E-value=1.2e-45  Score=330.36  Aligned_cols=170  Identities=48%  Similarity=0.837  Sum_probs=161.2

Q ss_pred             ccHHHHHHHHHHHcCCCEEEecCCCchHHHHHhhhcCCCceEEecCchhHHHHhhhhhhhhcC-ccEEEEeCCcchHHHH
Q 014091           27 GTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRG-VGACVVTFTVGGLSVL  105 (431)
Q Consensus        27 ~~~a~~l~~~L~~~GV~~vFgvpG~~~~~l~~al~~~~~i~~v~~~hE~~A~~~A~gyar~tg-~gv~~~t~GpG~~n~~  105 (431)
                      +|++|+|++.|+++||++|||+||+.+++|+++|.++++|++|.+|||++|+||||||+|+|| ++|| +|+|||++|++
T Consensus         2 ~Tv~~~l~~~L~~~Gv~~vFgvpG~~~~~l~dal~~~~~i~~v~~rhE~~A~~mA~gyar~tg~~~v~-~t~GpG~~N~~   80 (186)
T d1zpda2           2 YTVGTYLAERLVQIGLKHHFAVAGDYNLVLLDNLLLNKNMEQVYCCNELNCGFSAEGYARAKGAAAAV-VTYSVGALSAF   80 (186)
T ss_dssp             CBHHHHHHHHHHHTTCSEEEECCCTTTHHHHHHHHTCTTSEEEECSSHHHHHHHHHHHHHHHSCEEEE-ECTTTTHHHHH
T ss_pred             eeHHHHHHHHHHHCCCCEEEEeCChhHHHHHHHHHHcCCceEeeeccccceehhhhhhhhccccceeE-eeccccchhhh
Confidence            689999999999999999999999999999999988778999999999999999999999999 5555 58999999999


Q ss_pred             HHHHHhhhcCCcEEEEeCCCCCcccCCCceeeeecCCCChHHHHHHHhhheeeEEEcCCcchHHHHHHHHHHHhhhCCCc
Q 014091          106 NAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFTQELRCFQAITCSQAVVNNLGDAHELIDTAISTALKESKP  185 (431)
Q Consensus       106 ~gl~~A~~~~~Pvl~I~g~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~k~~~~v~~~~~~~~~i~~A~~~A~~~~GP  185 (431)
                      +||++|+.+++|||+|+|+.++...+++...||.++..++.||.++++++|||++++.+++++++.+++|++.|.++|||
T Consensus        81 ~gl~~A~~~~~Pvl~isg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vtk~~~~v~~~~~~~~~i~~A~~~A~~~~~P  160 (186)
T d1zpda2          81 DAIGGAYAENLPVILISGAPNNNDHAAGHVLHHALGKTDYHYQLEMAKNITAAAEAIYTPEEAPAKIDHVIKTALREKKP  160 (186)
T ss_dssp             HHHHHHHHTTCCEEEEEEECCGGGTTTTCBCTTSCSSSCCCHHHHHHGGGCSCEEEECSGGGHHHHHHHHHHHHHHHTCC
T ss_pred             hhhhhhhhcccceEEEecccCcccccCCCcceeecCCcchhhhhhccCCceeeeeEcCCHHHHHHHHHHHHHHHhhCCCC
Confidence            99999999999999999999999888888888888887888899999999999999999999999999999999998899


Q ss_pred             EEEEEccCCCCC
Q 014091          186 VYISISCNLPGI  197 (431)
Q Consensus       186 v~l~iP~dv~~~  197 (431)
                      |||+||.|++.+
T Consensus       161 V~l~iP~Dv~~~  172 (186)
T d1zpda2         161 VYLEIACNIASM  172 (186)
T ss_dssp             EEEEEETTSTTS
T ss_pred             EEEECCcchhhC
Confidence            999999999874
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y5ia2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure