Citrus Sinensis ID: 014200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGCYLYWNL
cHHHHHHcccccEEEccccccccccHHHHHccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccHHHHHcccccccccccccccHHHHHHHHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccccccccccccccccccHHHHccc
ccHHHHcHccccEEEccccccccccHHHHHccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccHcccEEEccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHHcccccEEEEccccccccccHHHcccccccEEEccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccEEEEEEccccccccccHHHHcccc
MDRILKAARtsgslnlsnrslrdvpnevyknfdeagegdkwwEAVDLQKLILAHNNIEKLKEDlrnlplltVLNVSHNKLSELPAAIGELHMlksldvsfnsimkipdeigSATALVkfdcssnqlkelpsslgrclnlsdfkasnncitslpedladcskmskldvegnkltVLSNNLIASWTMLTELIASKnllngmpetIGSLSRLIRLDLhqnrilsipssisgcCSLAefymgnnalsALPAElgklsklgtldlhSNQLKEYCVEACQLRLSVLDlsnnslsglppeigkMTTLRKLLLtgnplrtlrsslvngptpALLKYLRSrlpenedseasttkEDLITMATRLSVTSKELslegmnlsaipseiweageitkldlsrnsiqelppelsscaslQVKFSDlvtnkescisgcylywnl
mdrilkaartsgslnlsnrslrdvpnEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRtlrsslvngptPALLKYLRsrlpenedseasttkedlitMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLvtnkescisgcylywnl
MDRILKAARTSGslnlsnrslrDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQlrlsvldlsnnslsglPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGCYLYWNL
***************************VYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYL*************************************MNLSAIPSEIWEAGEITKLDL************SSCASLQVKFSDLVTNKESCISGCYLYWN*
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENE*****TTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGCYLYWNL
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRL**********TKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGCYLYWNL
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGCYLYWNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDxxxxxxxxxxxxxxxxxxxxxPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGCYLYWNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query429 2.2.26 [Sep-21-2011]
Q5ZLN0 603 Leucine-rich repeat-conta yes no 0.911 0.648 0.364 5e-58
Q6GPJ5 605 Leucine-rich repeat-conta N/A no 0.911 0.646 0.358 4e-56
Q5M8G4 605 Leucine-rich repeat-conta yes no 0.911 0.646 0.367 1e-54
Q5RFE9 602 Leucine-rich repeat-conta yes no 0.965 0.687 0.353 9e-53
Q9H9A6 602 Leucine-rich repeat-conta yes no 0.965 0.687 0.353 2e-52
Q7SXW3 601 Leucine-rich repeat-conta yes no 0.953 0.680 0.330 3e-52
Q4R3P6 602 Leucine-rich repeat-conta N/A no 0.965 0.687 0.350 2e-51
Q9CRC8 602 Leucine-rich repeat-conta yes no 0.965 0.687 0.339 1e-47
Q5F4C4529 Leucine-rich repeat prote no no 0.780 0.633 0.309 2e-35
Q8AVI4577 Leucine-rich repeat prote N/A no 0.853 0.634 0.315 4e-34
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function desciption
 Score =  225 bits (574), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 153/420 (36%), Positives = 237/420 (56%), Gaps = 29/420 (6%)

Query: 4   ILKAARTSGSLNLSNRSLRDVPNEVYK-NFD---EA------GEGDKWWEAVDLQKLILA 53
           +++AAR SG LNL+ R L +VP  V++ N D   EA      G  D+WWE  DL KLILA
Sbjct: 31  LIRAARKSGQLNLAGRGLGEVPQHVWRINLDTPEEAHQNLSFGAADRWWEQTDLTKLILA 90

Query: 54  HNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSA 113
            N +  L ED+R LP LTVL+V  N+L+ LP+A+G+L  L+ LDVS N +  IP+E+   
Sbjct: 91  SNQLRCLSEDVRLLPALTVLDVHDNQLTSLPSALGQLENLQKLDVSHNKLKSIPEELLQL 150

Query: 114 TALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLT 173
           + L       N+L  LP   G+ ++L +   SNN +T +P+  A    + +L++  N+L 
Sbjct: 151 SHLKGLLLQHNELSHLPDGFGQLVSLEELDLSNNHLTDIPKSFALLINLVRLNLACNQLK 210

Query: 174 VLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLA 233
            L  + I++   L +L  +KN L  +P  + S++ L +L L +N++ S+P  +  C  L 
Sbjct: 211 DLPAD-ISAMKSLRQLDCTKNYLESVPSELASMASLEQLYLRKNKLRSLP-ELPSCKLLK 268

Query: 234 EFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEYCVEACQL-RLSVLDLSNNSLSGLP 291
           E + G N +  L AE L  L+ L  L+L  N++K    E   L +L  LDL+NN +S LP
Sbjct: 269 ELHAGENQIEILNAENLKHLNSLSVLELRDNKIKSVPDEITLLQKLERLDLANNDISRLP 328

Query: 292 PEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITM 351
             +G ++ L+ L L GNPLRT+R  L+   T  LLKYLRSR+   +D +AS  +E  +T 
Sbjct: 329 YTLGNLSQLKFLALEGNPLRTIRRDLLQKGTQELLKYLRSRI---QDDKASPNEEPPVTA 385

Query: 352 AT-----RLSV----TSKELSLEGMNLSAIPSEIWEA---GEITKLDLSRNSIQELPPEL 399
            T     R+++    T K L      ++ IP +++ A     +T ++ S+N +  +PP +
Sbjct: 386 MTLPSESRINMHAITTLKLLDYSEKQVAVIPDDVFSAVRSNPVTSVNFSKNQLTAIPPRI 445





Gallus gallus (taxid: 9031)
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=2 SV=2 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
356549743 583 PREDICTED: leucine-rich repeat-containin 0.829 0.610 0.759 1e-175
356544024 586 PREDICTED: leucine-rich repeat-containin 0.946 0.692 0.764 1e-175
224114980 580 predicted protein [Populus trichocarpa] 0.937 0.693 0.784 1e-175
449431828 583 PREDICTED: leucine-rich repeat-containin 0.946 0.696 0.761 1e-172
255575336 571 leucine-rich repeat-containing protein, 0.944 0.709 0.754 1e-171
359493861 584 PREDICTED: leucine-rich repeat-containin 0.948 0.696 0.767 1e-171
225461397 588 PREDICTED: leucine-rich repeat-containin 0.946 0.690 0.751 1e-167
297830120 584 leucine-rich repeat family protein [Arab 0.946 0.695 0.734 1e-167
7021726 562 unknown protein [Arabidopsis thaliana] 0.946 0.722 0.732 1e-166
15795106 594 leucine-rich repeat protein; contains si 0.946 0.683 0.732 1e-166
>gi|356549743|ref|XP_003543250.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
 Score =  621 bits (1602), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 309/407 (75%), Positives = 359/407 (88%)

Query: 1   MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKL 60
           MDRILKAAR SGSLNLSNRSL ++P+EVY+N +  G  DKWWEA +LQKLILAHN+I  L
Sbjct: 1   MDRILKAARASGSLNLSNRSLTEIPDEVYRNLEGLGGDDKWWEAAELQKLILAHNSIASL 60

Query: 61  KEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFD 120
           KEDLRNLP L+VLN+SHN LS+LPAAIGEL  LK LDVSFNSI+KIP+EIGSA +LVK D
Sbjct: 61  KEDLRNLPFLSVLNLSHNSLSQLPAAIGELPQLKMLDVSFNSIVKIPEEIGSAVSLVKLD 120

Query: 121 CSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLI 180
           CS+N+L ELPSSLGRCL LSD K SNN IT+LPEDLA+CSK+SKLD+EGN+LTV+S NLI
Sbjct: 121 CSNNRLTELPSSLGRCLELSDLKGSNNLITNLPEDLANCSKLSKLDMEGNRLTVMSENLI 180

Query: 181 ASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNN 240
           +SWTMLTE  +SKNLLNG+P +IG LSRLIRLDLHQNRI +IPSSI GC SL E Y+GNN
Sbjct: 181 SSWTMLTEFNSSKNLLNGIPTSIGGLSRLIRLDLHQNRISAIPSSIIGCHSLTELYLGNN 240

Query: 241 ALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTL 300
            +S LP E+G LS+LGTLDLHSNQLK+Y VEAC+L L VLDLSNNSLSGLPPE+GKMTTL
Sbjct: 241 NISTLPVEIGALSRLGTLDLHSNQLKDYPVEACKLSLLVLDLSNNSLSGLPPEMGKMTTL 300

Query: 301 RKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSK 360
           RKLLL+GNP+RTLRSSLV+GPTPALLK+LRSRL E+EDSEA TT +++ITMATRLS++SK
Sbjct: 301 RKLLLSGNPMRTLRSSLVSGPTPALLKFLRSRLSEDEDSEAVTTTKEVITMATRLSISSK 360

Query: 361 ELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQV 407
           ELS+E + LSA+PSE+WE+GE+ KL+LSRNSIQELP ELSSC SLQ 
Sbjct: 361 ELSMEELGLSAVPSEVWESGEVIKLNLSRNSIQELPVELSSCVSLQT 407




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356544024|ref|XP_003540456.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|224114980|ref|XP_002316909.1| predicted protein [Populus trichocarpa] gi|222859974|gb|EEE97521.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449431828|ref|XP_004133702.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] gi|449478165|ref|XP_004155239.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255575336|ref|XP_002528571.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223532015|gb|EEF33826.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359493861|ref|XP_003634682.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 2 [Vitis vinifera] gi|302143032|emb|CBI20327.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461397|ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297830120|ref|XP_002882942.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328782|gb|EFH59201.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7021726|gb|AAF35407.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15795106|dbj|BAB02370.1| leucine-rich repeat protein; contains similarity to elicitor-inducible receptor EIR [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
ZFIN|ZDB-GENE-030131-6062 601 lrrc40 "leucine rich repeat co 0.953 0.680 0.300 6.9e-53
MGI|MGI:1914394 602 Lrrc40 "leucine rich repeat co 0.965 0.687 0.309 3.4e-45
UNIPROTKB|E1BU15582 SHOC2 "Leucine-rich repeat pro 0.820 0.604 0.309 1.2e-35
ZFIN|ZDB-GENE-050208-523561 shoc2 "soc-2 suppressor of cle 0.808 0.618 0.308 2.1e-34
RGD|1308146582 Shoc2 "soc-2 (suppressor of cl 0.808 0.596 0.306 1.4e-33
UNIPROTKB|Q8AVI4577 shoc2 "Leucine-rich repeat pro 0.808 0.601 0.306 1.7e-33
MGI|MGI:1927197582 Shoc2 "soc-2 (suppressor of cl 0.808 0.596 0.303 1.9e-33
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.811 0.497 0.298 3.5e-33
UNIPROTKB|O61967 699 let-413 "Protein lap1" [Caenor 0.811 0.497 0.298 3.5e-33
UNIPROTKB|A6QLV3582 SHOC2 "Leucine-rich repeat pro 0.808 0.596 0.303 6.7e-33
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 488 (176.8 bits), Expect = 6.9e-53, Sum P(2) = 6.9e-53
 Identities = 131/436 (30%), Positives = 213/436 (48%)

Query:     4 ILKAARTSGXXXXXXXXXXDVPNEVYK-NFD---EA------GEGDKWWEAVDLQKLILA 53
             +LKAAR SG          +VP  V++ N D   EA      G  D+WWE  DL KL+L+
Sbjct:    29 LLKAARKSGQLNLSGRGLTEVPASVWRLNLDTPQEAKQNVSFGAEDRWWEQTDLTKLLLS 88

Query:    54 HNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSA 113
              N ++ + +D++ LP L VL++  N+LS LP +IG+L  L+ L +S N + ++P  +   
Sbjct:    89 SNKLQSIPDDVKLLPALVVLDIHDNQLSSLPDSIGDLEQLQKLILSHNKLTELPSGVWRL 148

Query:   114 TALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLT 173
             T L       N ++++P  LG+ +NL +   SNN +  +PE LA+   + KLD+  NKL 
Sbjct:   149 TNLRCLHLQQNLIEQIPRDLGQLVNLDELDLSNNHLIDIPESLANLQNLVKLDLSCNKLK 208

Query:   174 VLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLA 233
              L    I+    L  L  S+N +  +P  +  +  L +L L  N++  +P  +  C +L 
Sbjct:   209 SLPP-AISQMKNLRMLDCSRNQMESIPPVLAQMESLEQLYLRHNKLRYLPE-LPCCKTLK 266

Query:   234 EFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEYCVE-ACQXXXXXXXXXXXXXXXXP 291
             E + GNN +  L AE L  L+ L  L+L  N++K    E                    P
Sbjct:   267 ELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVKSLPEEITLLQGLERLDLTNNDISSLP 326

Query:   292 PEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITM 351
               +G +  L+ L L GNPLR +R  L+   T  LLKYLRSR+ E  +       +  +T 
Sbjct:   327 CGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGELLKYLRSRVQEPPNGGLKEEPKTAMTF 386

Query:   352 ATRLSV------TSKELSLEGMNLSAIPSEIWEAGE---ITKLDLSRNSIQELPPEL--- 399
              ++  +      T K L       + IP ++++A +   +  ++ S+N +  +P  +   
Sbjct:   387 PSQAKINVHAIKTLKTLDYSEKQDATIPDDVFDAVDGNPVANVNFSKNQLTAVPHRIVDL 446

Query:   400 -SSCASLQVKFSDLVT 414
               S A + + F+ L T
Sbjct:   447 KDSLADINLGFNKLTT 462


GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
MGI|MGI:1914394 Lrrc40 "leucine rich repeat containing 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU15 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1308146 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8AVI4 shoc2 "Leucine-rich repeat protein SHOC-2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O61967 let-413 "Protein lap1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00110941
hypothetical protein (581 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.8595.1.1
hypothetical protein (375 aa)
       0.490
eugene3.00410223
hypothetical protein (478 aa)
       0.488
eugene3.00131095
annotation not avaliable (394 aa)
       0.484
eugene3.00190610
annotation not avaliable (370 aa)
       0.483
fgenesh4_pg.C_LG_XVIII001032
hypothetical protein (534 aa)
       0.478
eugene3.100750001
hypothetical protein (275 aa)
       0.478
fgenesh4_pg.C_scaffold_11988000001
hypothetical protein (315 aa)
       0.455
fgenesh4_pg.C_scaffold_13412000001
hypothetical protein (444 aa)
       0.453
eugene3.06320001
hypothetical protein (344 aa)
       0.450
gw1.XI.3221.1
hypothetical protein (380 aa)
       0.445

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-14
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 7e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-10
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 7e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 90.7 bits (225), Expect = 2e-19
 Identities = 111/390 (28%), Positives = 175/390 (44%), Gaps = 54/390 (13%)

Query: 67  LPLLTVLNVSHNKLS-ELPAAIGELHMLKSLDVSFNSIM-KIPDEIGSATALVKFDCSSN 124
           +P L  L++S+N LS E+P  IG    LK LD+  N ++ KIP+ + + T+L     +SN
Sbjct: 139 IPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN 198

Query: 125 QL-KELPSSLGRCLNLS-DFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIAS 182
           QL  ++P  LG+  +L   +   NN    +P ++   + ++ LD+  N LT    + + +
Sbjct: 199 QLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGN 258

Query: 183 WTMLTELIASKNLLNG-MPETIGSLSRLIRLDLHQN----------------RIL----- 220
              L  L   +N L+G +P +I SL +LI LDL  N                 IL     
Sbjct: 259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN 318

Query: 221 ----SIPSSISGCCSLAEFYMGNNALSA-LPAELGKLSKLGTLDLHSNQLKEYCVEA-CQ 274
                IP +++    L    + +N  S  +P  LGK + L  LDL +N L     E  C 
Sbjct: 319 NFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS 378

Query: 275 L-RLSVLDLSNNSLSG-LPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSR 332
              L  L L +NSL G +P  +G   +LR++ L  N   +    L +  T   L Y    
Sbjct: 379 SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDN---SFSGELPSEFTKLPLVYFLDI 435

Query: 333 LPENEDSEASTTKEDLITMAT----------RLSVTSKELSLEGMNLS------AIPSEI 376
              N     ++ K D+ ++             L  +     LE ++LS      A+P ++
Sbjct: 436 SNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKL 495

Query: 377 WEAGEITKLDLSRNSIQ-ELPPELSSCASL 405
               E+ +L LS N +  E+P ELSSC  L
Sbjct: 496 GSLSELMQLKLSENKLSGEIPDELSSCKKL 525


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 429
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.39
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.36
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.33
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.62
PLN03150623 hypothetical protein; Provisional 98.58
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.48
PLN03150623 hypothetical protein; Provisional 98.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.35
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.25
PRK15386 426 type III secretion protein GogB; Provisional 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.16
PRK15386 426 type III secretion protein GogB; Provisional 98.05
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.9
KOG4341483 consensus F-box protein containing LRR [General fu 97.89
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.77
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.25
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.68
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.75
KOG4308 478 consensus LRR-containing protein [Function unknown 95.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.46
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.45
KOG4308478 consensus LRR-containing protein [Function unknown 95.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.44
smart0037026 LRR Leucine-rich repeats, outliers. 94.44
smart0037026 LRR Leucine-rich repeats, outliers. 93.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.57
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.15
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.97
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.89
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.05
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.42
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.2
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=5.4e-43  Score=306.93  Aligned_cols=419  Identities=48%  Similarity=0.723  Sum_probs=366.4

Q ss_pred             hHHHHHhhhcCeeeccCCCCccCChhhhhhhccccCCCcccccCCccEEEcCCCCCCccchhccCCCCCCEEECCCCCCC
Q 014200            2 DRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLS   81 (429)
Q Consensus         2 ~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~~~i~   81 (429)
                      +++.+.+++--.++++++.+..+|..+......-.+.+.||.-..++.+.++.|.+..+.+.+.++..++++++++|.+.
T Consensus         2 ~~l~k~arksg~lnlsnr~l~~vp~~vyq~~~t~~e~e~wW~qv~l~~lils~N~l~~l~~dl~nL~~l~vl~~~~n~l~   81 (565)
T KOG0472|consen    2 QRLLKAARKSGSLNLSNRSLKDVPTEVYQINLTTGEGENWWEQVDLQKLILSHNDLEVLREDLKNLACLTVLNVHDNKLS   81 (565)
T ss_pred             chHHHHHHhhcccccccchhhhccHHHHHHHhhccchhhhhhhcchhhhhhccCchhhccHhhhcccceeEEEeccchhh
Confidence            56788899999999999999999999998887778899999999999999999999999889999999999999999999


Q ss_pred             CcchhhhCCCCCcEeecCCCcCccCCccccCCCCcCEEecCCCCCCcCCccccCCCCCCEEEcCCCccccCCccccccCC
Q 014200           82 ELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSK  161 (429)
Q Consensus        82 ~~~~~l~~l~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l~~~~~  161 (429)
                      .+|++++.+..++.+++++|.+..+|+.++...++..++++.|.+..+++.++.+..+..++..+|++.++|.++..+.+
T Consensus        82 ~lp~aig~l~~l~~l~vs~n~ls~lp~~i~s~~~l~~l~~s~n~~~el~~~i~~~~~l~dl~~~~N~i~slp~~~~~~~~  161 (565)
T KOG0472|consen   82 QLPAAIGELEALKSLNVSHNKLSELPEQIGSLISLVKLDCSSNELKELPDSIGRLLDLEDLDATNNQISSLPEDMVNLSK  161 (565)
T ss_pred             hCCHHHHHHHHHHHhhcccchHhhccHHHhhhhhhhhhhccccceeecCchHHHHhhhhhhhccccccccCchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEccCCcccccChhhhhcccccceeecCCccCCcCCccccCCccCCeEeccCCcCccCCccccccCCCcEEEcCCCC
Q 014200          162 MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNA  241 (429)
Q Consensus       162 L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~n~  241 (429)
                      +..+++.+|.+...++..+. +..|++++...|-++.+|+.++.+.+|..|++..|++..+| .|.+|..|++++++.|.
T Consensus       162 l~~l~~~~n~l~~l~~~~i~-m~~L~~ld~~~N~L~tlP~~lg~l~~L~~LyL~~Nki~~lP-ef~gcs~L~Elh~g~N~  239 (565)
T KOG0472|consen  162 LSKLDLEGNKLKALPENHIA-MKRLKHLDCNSNLLETLPPELGGLESLELLYLRRNKIRFLP-EFPGCSLLKELHVGENQ  239 (565)
T ss_pred             HHHhhccccchhhCCHHHHH-HHHHHhcccchhhhhcCChhhcchhhhHHHHhhhcccccCC-CCCccHHHHHHHhcccH
Confidence            99999999999999888555 99999999999999999999999999999999999999998 79999999999999999


Q ss_pred             CCccChhh-cCCCCCCEEECCCCcCccccchhhccc-cCEEEccCCCCCCCCccccCCCCCCEEEccCCCCCCccccccC
Q 014200          242 LSALPAEL-GKLSKLGTLDLHSNQLKEYCVEACQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVN  319 (429)
Q Consensus       242 i~~~~~~~-~~~~~L~~L~l~~n~l~~~~~~~~~~~-L~~l~l~~n~l~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~~~  319 (429)
                      +.-+|... ..++++.+||+.+|+++++|...+..+ |+++|+++|.++++|..++++ .|+.|.+.||++.++...+..
T Consensus       240 i~~lpae~~~~L~~l~vLDLRdNklke~Pde~clLrsL~rLDlSNN~is~Lp~sLgnl-hL~~L~leGNPlrTiRr~ii~  318 (565)
T KOG0472|consen  240 IEMLPAEHLKHLNSLLVLDLRDNKLKEVPDEICLLRSLERLDLSNNDISSLPYSLGNL-HLKFLALEGNPLRTIRREIIS  318 (565)
T ss_pred             HHhhHHHHhcccccceeeeccccccccCchHHHHhhhhhhhcccCCccccCCcccccc-eeeehhhcCCchHHHHHHHHc
Confidence            99888765 589999999999999999999998877 999999999999999999999 999999999999999999999


Q ss_pred             CCcHHHHHHHHhcCCCCCcccc-----cCCh-hhHHhhhhccc--------------------------cccccccc---
Q 014200          320 GPTPALLKYLRSRLPENEDSEA-----STTK-EDLITMATRLS--------------------------VTSKELSL---  364 (429)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~~~~-----~~~~-~~~~~~~~~~~--------------------------~~L~~l~l---  364 (429)
                      +++.+.+.|+...+.....+..     .+.. ...........                          .-++.+++   
T Consensus       319 ~gT~~vLKyLrs~~~~dglS~se~~~e~~~t~~~~~~~~~~~~i~tkiL~~s~~qlt~VPdEVfea~~~~~Vt~VnfskN  398 (565)
T KOG0472|consen  319 KGTQEVLKYLRSKIKDDGLSQSEGGTETAMTLPSESFPDIYAIITTKILDVSDKQLTLVPDEVFEAAKSEIVTSVNFSKN  398 (565)
T ss_pred             ccHHHHHHHHHHhhccCCCCCCcccccccCCCCCCcccchhhhhhhhhhcccccccccCCHHHHHHhhhcceEEEecccc
Confidence            9999999999873322222111     0000 00000000000                          11233333   


Q ss_pred             ---------------------cCCccccCChhhhccCCCcEEeCCCCccccCChhhcccccceeeccccCCCcccccccc
Q 014200          365 ---------------------EGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCISGC  423 (429)
Q Consensus       365 ---------------------~~~~i~~~~~~~~~~~~L~~L~ls~n~i~~~~~~l~~l~~L~~L~~~l~~n~i~~i~~~  423 (429)
                                           ++|.++-+|..+..++.|+.|++++|-+.++|.+++.+..||.||  +++|+|.++|.|
T Consensus       399 qL~elPk~L~~lkelvT~l~lsnn~isfv~~~l~~l~kLt~L~L~NN~Ln~LP~e~~~lv~Lq~Ln--lS~NrFr~lP~~  476 (565)
T KOG0472|consen  399 QLCELPKRLVELKELVTDLVLSNNKISFVPLELSQLQKLTFLDLSNNLLNDLPEEMGSLVRLQTLN--LSFNRFRMLPEC  476 (565)
T ss_pred             hHhhhhhhhHHHHHHHHHHHhhcCccccchHHHHhhhcceeeecccchhhhcchhhhhhhhhheec--ccccccccchHH
Confidence                                 344444444456677889999999999999999999999999999  999999999998


Q ss_pred             cc
Q 014200          424 YL  425 (429)
Q Consensus       424 ~~  425 (429)
                      .+
T Consensus       477 ~y  478 (565)
T KOG0472|consen  477 LY  478 (565)
T ss_pred             Hh
Confidence            64



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 4e-09
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 4e-09
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 7e-07
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 7e-07
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 1e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-06
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-06
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-06
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-06
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 9e-06
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 1e-05
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 2e-05
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 5e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-05
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 2e-05
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 5e-04
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 2e-05
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 6e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 7e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 7e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 3e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 4e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 4e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 4e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 7e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 6e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 5e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 5e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 6e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-04
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 3e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-04
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 8e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 1/103 (0%) Query: 165 LDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPS 224 LD+ ++ +S N I + LT L + N L +P I +LS L LDL NR+ S+P+ Sbjct: 229 LDLSNLQIFNISAN-IFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPA 287 Query: 225 SISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKE 267 + C L FY +N ++ LP E G L L L + N L++ Sbjct: 288 ELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEK 330
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-51
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-51
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-39
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-40
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-38
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-46
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-40
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-27
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-43
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-42
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-39
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-31
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-30
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-35
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-30
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-33
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  174 bits (443), Expect = 3e-51
 Identities = 57/289 (19%), Positives = 97/289 (33%), Gaps = 25/289 (8%)

Query: 39  DKWWEAVDLQKLILAHNNIEKLKEDLRNL-----PLLTVLNVSHNKLSELPAAIGELHML 93
              W   +     +       LK     L     P    L +    L + P     L  L
Sbjct: 47  HSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHL 106

Query: 94  KSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKAS-NNCITSL 152
           + + +    +M++PD +     L     + N L+ LP+S+     L +        +T L
Sbjct: 107 QHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTEL 166

Query: 153 PEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRL 212
           PE LA                  ++        L  L      +  +P +I +L  L  L
Sbjct: 167 PEPLASTD---------------ASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSL 211

Query: 213 DLHQNRILSIPSSISGCCSLAEFYM-GNNALSALPAELGKLSKLGTLDL-HSNQLKEYCV 270
            +  + + ++  +I     L E  + G  AL   P   G  + L  L L   + L    +
Sbjct: 212 KIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPL 271

Query: 271 EACQLR-LSVLDLSNNS-LSGLPPEIGKMTTLRKLLLTGNPLRTLRSSL 317
           +  +L  L  LDL     LS LP  I ++     +L+  +    L    
Sbjct: 272 DIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQLDQHR 320


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.1
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.89
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.85
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.98
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=100.00  E-value=5e-41  Score=337.95  Aligned_cols=342  Identities=22%  Similarity=0.284  Sum_probs=270.5

Q ss_pred             CCcccccCCccEEEcCCCCCCc------------------cchhcc--CCCCCCEEECCCCCCC-CcchhhhCCCCCcEe
Q 014200           38 GDKWWEAVDLQKLILAHNNIEK------------------LKEDLR--NLPLLTVLNVSHNKLS-ELPAAIGELHMLKSL   96 (429)
Q Consensus        38 ~~~~~~~~~L~~L~l~~~~i~~------------------l~~~~~--~~~~L~~L~l~~~~i~-~~~~~l~~l~~L~~L   96 (429)
                      +..+.++++|++|++++|.++.                  +|..+.  ++++|++|++++|.+. .+|..+.++++|++|
T Consensus       199 p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  278 (636)
T 4eco_A          199 SKAVMRLTKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEMQLI  278 (636)
T ss_dssp             CGGGGGCTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTCSSCCEE
T ss_pred             CHHHhcccCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcCCCCCEE
Confidence            4457778888888888888887                  888777  8888888888888755 677788888888888


Q ss_pred             ecCCCc-Ccc--CCccccCC------CCcCEEecCCCCCCcCCc--cccCCCCCCEEEcCCCccc-cCCccccccCCCcE
Q 014200           97 DVSFNS-IMK--IPDEIGSA------TALVKFDCSSNQLKELPS--SLGRCLNLSDFKASNNCIT-SLPEDLADCSKMSK  164 (429)
Q Consensus        97 ~l~~~~-i~~--l~~~~~~~------~~L~~L~l~~~~l~~~~~--~~~~~~~L~~L~l~~~~~~-~~~~~l~~~~~L~~  164 (429)
                      ++++|. ++.  +|..++.+      ++|++|++++|++..+|.  .+..+++|++|++++|.+. .+| .+..+++|+.
T Consensus       279 ~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~~ip~~~~l~~l~~L~~L~L~~N~l~g~ip-~~~~l~~L~~  357 (636)
T 4eco_A          279 NVACNRGISGEQLKDDWQALADAPVGEKIQIIYIGYNNLKTFPVETSLQKMKKLGMLECLYNQLEGKLP-AFGSEIKLAS  357 (636)
T ss_dssp             ECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCSSCCCHHHHTTCTTCCEEECCSCCCEEECC-CCEEEEEESE
T ss_pred             ECcCCCCCccccchHHHHhhhccccCCCCCEEECCCCcCCccCchhhhccCCCCCEEeCcCCcCccchh-hhCCCCCCCE
Confidence            888887 764  67766665      888888888888888887  7888888888888888888 777 7788888888


Q ss_pred             EEccCCcccccChhhhhcccc-cceeecCCccCCcCCccccCCc--cCCeEeccCCcCcc-CCcccc-------ccCCCc
Q 014200          165 LDVEGNKLTVLSNNLIASWTM-LTELIASKNLLNGMPETIGSLS--RLIRLDLHQNRILS-IPSSIS-------GCCSLA  233 (429)
Q Consensus       165 L~l~~~~~~~~~~~~~~~~~~-L~~L~l~~~~l~~~~~~~~~~~--~L~~L~l~~~~~~~-~~~~~~-------~~~~L~  233 (429)
                      |++++|.+..++.. +..++. |++|++++|.++.+|..+...+  +|+.|++++|.+.. .|..+.       .+++|+
T Consensus       358 L~L~~N~l~~lp~~-l~~l~~~L~~L~Ls~N~l~~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L~  436 (636)
T 4eco_A          358 LNLAYNQITEIPAN-FCGFTEQVENLSFAHNKLKYIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINVS  436 (636)
T ss_dssp             EECCSSEEEECCTT-SEEECTTCCEEECCSSCCSSCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCEE
T ss_pred             EECCCCccccccHh-hhhhcccCcEEEccCCcCcccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccCCCCC
Confidence            88888888876655 777777 8888888888888887665544  78888888888874 455565       677888


Q ss_pred             EEEcCCCCCCccChh-hcCCCCCCEEECCCCcCccccchhhcc---------ccCEEEccCCCCCCCCcccc--CCCCCC
Q 014200          234 EFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEYCVEACQL---------RLSVLDLSNNSLSGLPPEIG--KMTTLR  301 (429)
Q Consensus       234 ~L~l~~n~i~~~~~~-~~~~~~L~~L~l~~n~l~~~~~~~~~~---------~L~~l~l~~n~l~~l~~~l~--~~~~L~  301 (429)
                      +|++++|.++.+|.. +..+++|+.|++++|.++.++...+..         +|++|++++|.++.+|..+.  .+++|+
T Consensus       437 ~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~lp~~~~~~~l~~L~  516 (636)
T 4eco_A          437 SINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLTKLSDDFRATTLPYLV  516 (636)
T ss_dssp             EEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSSSSEETTEECTTGGGCCEEECCSSCCCBCCGGGSTTTCTTCC
T ss_pred             EEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHHHhccccccccccCCccEEECcCCcCCccChhhhhccCCCcC
Confidence            888888888888765 456888888888888888776654431         68888888888888888776  888888


Q ss_pred             EEEccCCCCCCccccccCCCcHHHHHHHHhcCCCCCcccccCChhhHHhhhhcccccccccccc------CCccc-cCCh
Q 014200          302 KLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLE------GMNLS-AIPS  374 (429)
Q Consensus       302 ~L~l~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~l~------~~~i~-~~~~  374 (429)
                      .|++++|.++++|....                                    ..++|+.|+++      +|++. .+|.
T Consensus       517 ~L~Ls~N~l~~ip~~~~------------------------------------~l~~L~~L~Ls~N~~ls~N~l~~~~p~  560 (636)
T 4eco_A          517 GIDLSYNSFSKFPTQPL------------------------------------NSSTLKGFGIRNQRDAQGNRTLREWPE  560 (636)
T ss_dssp             EEECCSSCCSSCCCGGG------------------------------------GCSSCCEEECCSCBCTTCCBCCCCCCT
T ss_pred             EEECCCCCCCCcChhhh------------------------------------cCCCCCEEECCCCcccccCcccccChH
Confidence            88888888876553322                                    12578888884      45555 7888


Q ss_pred             hhhccCCCcEEeCCCCccccCChhhcccccceeeccccCCCcccccc
Q 014200          375 EIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTNKESCIS  421 (429)
Q Consensus       375 ~~~~~~~L~~L~ls~n~i~~~~~~l~~l~~L~~L~~~l~~n~i~~i~  421 (429)
                      .+..+++|++|+|++|+++.+|..+.  ++|++|+  +++|++++++
T Consensus       561 ~l~~l~~L~~L~Ls~N~l~~ip~~~~--~~L~~L~--Ls~N~l~~~~  603 (636)
T 4eco_A          561 GITLCPSLTQLQIGSNDIRKVNEKIT--PNISVLD--IKDNPNISID  603 (636)
T ss_dssp             TGGGCSSCCEEECCSSCCCBCCSCCC--TTCCEEE--CCSCTTCEEE
T ss_pred             HHhcCCCCCEEECCCCcCCccCHhHh--CcCCEEE--CcCCCCcccc
Confidence            88889999999999999977888765  7899999  9999888754



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 429
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 80.9 bits (198), Expect = 1e-17
 Identities = 58/280 (20%), Positives = 109/280 (38%), Gaps = 25/280 (8%)

Query: 68  PLLTVLNVSHNKLSELPA-AIGELHMLKSLDVSFNSIMKI-PDEIGSATALVKFDCSSNQ 125
           P   +L++ +NK++E+       L  L +L +  N I KI P        L +   S NQ
Sbjct: 31  PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQ 90

Query: 126 LKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTM 185
           LKELP  + +   L + +   N IT + + + +      +   G      S     ++  
Sbjct: 91  LKELPEKMPKT--LQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQG 148

Query: 186 LTELIA---SKNLLNGMPETIGSLSRLIRLDLHQNRILS-IPSSISGCCSLAEFYMGNNA 241
           + +L     +   +  +P+  G    L  L L  N+I     +S+ G  +LA+  +  N+
Sbjct: 149 MKKLSYIRIADTNITTIPQ--GLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNS 206

Query: 242 -LSALPAELGKLSKLGTLDLHSNQLKEYCVEACQL-RLSVLDLSNNSLSGLPPE------ 293
             +     L     L  L L++N+L +          + V+ L NN++S +         
Sbjct: 207 ISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPG 266

Query: 294 -IGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSR 332
              K  +   + L  NP++           P+  + +  R
Sbjct: 267 YNTKKASYSGVSLFSNPVQYWEIQ------PSTFRCVYVR 300


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.79
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.97  E-value=3.2e-28  Score=228.16  Aligned_cols=321  Identities=24%  Similarity=0.348  Sum_probs=245.2

Q ss_pred             cCCccEEEcCCCCCCccchhccCCCCCCEEECCCCCCCCcchhhhCCCCCcEeecCCCcCccCCccccCCCCcCEEecCC
Q 014200           44 AVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSS  123 (429)
Q Consensus        44 ~~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~~~i~~~~~~l~~l~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~  123 (429)
                      +.+|++|++++++|+.+. .+..+++|++|++++|.++.+++ ++++++|++|++++|.+..+++ +.++++|+.+++.+
T Consensus        43 l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          43 LDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             hCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccccccccc-cccccccccccccc
Confidence            567999999999998874 67889999999999999988864 8899999999999998887754 78899999999988


Q ss_pred             CCCCcCCccccCCCCCCEEEcCCCccccCC--------------------ccccccCCCcEEEccCCcccccChhhhhcc
Q 014200          124 NQLKELPSSLGRCLNLSDFKASNNCITSLP--------------------EDLADCSKMSKLDVEGNKLTVLSNNLIASW  183 (429)
Q Consensus       124 ~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~--------------------~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~  183 (429)
                      +.+..++. ......+.......+.+....                    ..+.............+....  ......+
T Consensus       120 ~~~~~~~~-~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~l  196 (384)
T d2omza2         120 NQITDIDP-LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSD--ISVLAKL  196 (384)
T ss_dssp             SCCCCCGG-GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCC--CGGGGGC
T ss_pred             cccccccc-ccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccc--ccccccc
Confidence            88776543 233345555544433332110                    112222333333333333222  2235677


Q ss_pred             cccceeecCCccCCcCCccccCCccCCeEeccCCcCccCCccccccCCCcEEEcCCCCCCccChhhcCCCCCCEEECCCC
Q 014200          184 TMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSN  263 (429)
Q Consensus       184 ~~L~~L~l~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~L~~L~l~~n  263 (429)
                      +.++.+.++++.++.++. ....++|+.+++++|.+..++ .+..+++++.+++++|.++.+++ +..+++|++++++++
T Consensus       197 ~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~-~~~~~~L~~L~l~~~  273 (384)
T d2omza2         197 TNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGAN  273 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCSS
T ss_pred             cccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCc-ccccccCCEeeccCc
Confidence            888999999988877654 456678999999999888764 57788999999999999887764 778899999999999


Q ss_pred             cCccccchhhccccCEEEccCCCCCCCCccccCCCCCCEEEccCCCCCCccccccCCCcHHHHHHHHhcCCCCCcccccC
Q 014200          264 QLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEAST  343 (429)
Q Consensus       264 ~l~~~~~~~~~~~L~~l~l~~n~l~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  343 (429)
                      .+..++.......++.+.++.|.+++++ .+..+++++.+++++|.+++++.                            
T Consensus       274 ~l~~~~~~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n~l~~l~~----------------------------  324 (384)
T d2omza2         274 QISNISPLAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFNNISDISP----------------------------  324 (384)
T ss_dssp             CCCCCGGGTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSSCCSCCGG----------------------------
T ss_pred             ccCCCCcccccccccccccccccccccc-ccchhcccCeEECCCCCCCCCcc----------------------------
Confidence            9988876666666999999999888864 47888999999999998876531                            


Q ss_pred             ChhhHHhhhhccccccccccccCCccccCChhhhccCCCcEEeCCCCccccCChhhcccccceeeccccCCC
Q 014200          344 TKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQVKFSDLVTN  415 (429)
Q Consensus       344 ~~~~~~~~~~~~~~~L~~l~l~~~~i~~~~~~~~~~~~L~~L~ls~n~i~~~~~~l~~l~~L~~L~~~l~~n  415 (429)
                               ....++|++|++++|+++.++ .+..+++|++|++++|++++++. +.++++|++|+  +++|
T Consensus       325 ---------l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~--L~~N  383 (384)
T d2omza2         325 ---------VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLG--LNDQ  383 (384)
T ss_dssp             ---------GGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEE--CCCE
T ss_pred             ---------cccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEee--CCCC
Confidence                     112368999999999999877 58899999999999999999765 88999999999  9987



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure