Citrus Sinensis ID: 014222

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSRNQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQVLQA
cccccccccccccccEEEEcccEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHccccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccccccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEccccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEEccccccEEEEEEEcccccEEEccccccccccccEEEEccEEEEEEcccccEEEEEEccccEEEEcccccccccccccccEEEEEEEccEEEEEEcccccEEEEEEccccccccccccEEEEEcccccccccccccEEEEEEccccccEEEEEEEEEc
cccccccccccccEEEEEHHHHHHHHHccccccccccHEEEHEHccccccccccccccHHccccccccccccHHHHHHHHHHccHHHcccHHHHcHHHHHHHcccccccccccccccccEEEEEEcccccccEEEEEccccccEEEcccccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccccEEcccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEccccccEEEEEEccccccEEEcccccccccccEEEEEccEEEEEEcccccEEEEEccccccEEEEccccccccccccccEEEEEEEccEEEEEEccccccEEEEEcccccccccccccccHcccccEEccccccEEEEEcccccccccEEEEEEEEc
mdrmiqpplvdttaCLCRVDAGLKTVAgakkyvpgtklclqpdikpsihptrskpasgsrsrnqspllpglpddlaiaclirvprvehcklrLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDregkiswhafdpiyqlwqplppipkeyseaLGFGCAVLSGchlylfggkdplkgsmRRVIFYSARtnkwhrapdmlrrrHFFGscvinnclyvaggenggvhrslrsaevydpnknrwsfisdmstaMVPFIGVVYEGKWFLKGLGSHRQVLSeayqpetdswfpvydgmvagwrnpsaslnrhlyaldckdgckirvydevTDSWSKHIdskmhlgnsrALEAAALvplngklciirnnmSISLVDvsksngergasAEHLWETISGKGQFKTLVTNLWSsiagrnrlkSHIVHCQVLQA
mdrmiqpplvdttacLCRVDAGLKTvagakkyvpgtklclqpdikpsihptrskpasgsrsrnqspllpGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSartnkwhrapdMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSiagrnrlkshivhcqvlqa
MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSRNQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQVLQA
********LVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQ*****************************LPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDV**********AEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQV***
********LVDTTACLCRVDAGLKTVAGAKKYVP**********************************PGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKM**GNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWE**S****FKTLVTNLWSSIAGRNRLKSHIVHCQVLQA
MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSI*****************PLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQVLQA
*****QPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIH*************NQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQVLQA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSRNQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQVLQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query428 2.2.26 [Sep-21-2011]
Q93W93434 F-box/kelch-repeat protei yes no 0.974 0.960 0.745 0.0
Q9C6Z0398 F-box/kelch-repeat protei no no 0.621 0.668 0.316 5e-32
Q9LM55475 F-box/kelch-repeat protei no no 0.813 0.732 0.289 2e-30
Q9CAG8376 F-box/kelch-repeat protei no no 0.628 0.715 0.296 6e-28
Q9M2C9358 F-box/kelch-repeat protei no no 0.714 0.854 0.263 8e-25
Q8LAW2372 F-box protein AFR OS=Arab no no 0.670 0.771 0.241 8e-24
Q9FZJ3346 Putative F-box/kelch-repe no no 0.619 0.765 0.276 8e-24
Q9LI89422 F-box/kelch-repeat protei no no 0.672 0.682 0.275 2e-21
Q0WW40383 F-box/kelch-repeat protei no no 0.537 0.600 0.286 6e-21
Q9FKJ0393 F-box/kelch-repeat protei no no 0.607 0.661 0.281 2e-19
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function desciption
 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/424 (74%), Positives = 365/424 (86%), Gaps = 7/424 (1%)

Query: 5   IQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSRNQ 64
           +Q PLVD+ +C CRVD+GLKTV  A+K+VPG+KLC+QPDI P+ H  R K +   R+R Q
Sbjct: 18  LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH--RRKNSKRERTRIQ 75

Query: 65  SPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVI 124
            PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRW+RL SGNF+YS RK LG++EEW+YV 
Sbjct: 76  PPLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVF 135

Query: 125 KRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR 184
           KRDR+GKISW+ FDPI QLWQPLPP+P+EYSEA+GFGCAVLSGCHLYLFGGKDPL+GSMR
Sbjct: 136 KRDRDGKISWNTFDPISQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR 195

Query: 185 RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNR 244
           RVIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE  G+ R+LRSAEVYDPNKNR
Sbjct: 196 RVIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNR 255

Query: 245 WSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNP 304
           WSFI+DMSTAMVP IGVVY+ KWFLKGLGSH+ V+SEAY PE +SW PV DGMVAGWRNP
Sbjct: 256 WSFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNP 315

Query: 305 SASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCII 364
             SLN  LY LDC+DGCK+RV+DE TDSW+K +DSK HLGNS++LEAAALVPL+ KLCII
Sbjct: 316 CTSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGNSKSLEAAALVPLHNKLCII 375

Query: 365 RNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQ 424
           RNNMS+SLVDVS  +     +   LWE I+ KGQ K++++N+WSSIAGR  LKSHIVHCQ
Sbjct: 376 RNNMSMSLVDVSNPD----KNNPRLWENIAVKGQSKSILSNIWSSIAGRA-LKSHIVHCQ 430

Query: 425 VLQA 428
           VLQA
Sbjct: 431 VLQA 434

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C6Z0|FBK17_ARATH F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2C9|SKIP4_ARATH F-box/kelch-repeat protein SKIP4 OS=Arabidopsis thaliana GN=SKIP4 PE=1 SV=1 Back     alignment and function description
>sp|Q8LAW2|AFR_ARATH F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2 Back     alignment and function description
>sp|Q9FZJ3|FBK16_ARATH Putative F-box/kelch-repeat protein At1g27420 OS=Arabidopsis thaliana GN=At1g27420 PE=4 SV=2 Back     alignment and function description
>sp|Q9LI89|FBK70_ARATH F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKJ0|FK132_ARATH F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
147821403428 hypothetical protein VITISV_011673 [Viti 1.0 1.0 0.918 0.0
356572010428 PREDICTED: F-box/kelch-repeat protein At 1.0 1.0 0.904 0.0
356511684428 PREDICTED: F-box/kelch-repeat protein At 1.0 1.0 0.899 0.0
225445454437 PREDICTED: F-box/kelch-repeat protein At 0.978 0.958 0.921 0.0
255566973436 Protein AFR, putative [Ricinus communis] 0.978 0.961 0.918 0.0
449464602428 PREDICTED: F-box/kelch-repeat protein At 1.0 1.0 0.857 0.0
357478015442 F-box/kelch-repeat protein [Medicago tru 0.978 0.947 0.875 0.0
297738932398 unnamed protein product [Vitis vinifera] 0.929 1.0 0.859 0.0
356573363442 PREDICTED: LOW QUALITY PROTEIN: F-box/ke 0.976 0.945 0.849 0.0
225435706437 PREDICTED: F-box/kelch-repeat protein At 0.983 0.963 0.804 0.0
>gi|147821403|emb|CAN63498.1| hypothetical protein VITISV_011673 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/428 (91%), Positives = 413/428 (96%)

Query: 1   MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSR 60
           MDR+IQPPLVDTTACLCRVDAGLKTVAGAKK+VPGTKLCLQPDIKPSIHPTR KP+ G R
Sbjct: 1   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKKFVPGTKLCLQPDIKPSIHPTRHKPSRGDR 60

Query: 61  SRNQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEW 120
           SR+QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRW+RLL GNFYYSLRK+LGIAEEW
Sbjct: 61  SRSQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLVGNFYYSLRKNLGIAEEW 120

Query: 121 IYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLK 180
           IYVIKRDREGKISWHAFDPIYQLWQPLPP+PKEYSEALGFGCAVLSGCHLYLFGGKDPLK
Sbjct: 121 IYVIKRDREGKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK 180

Query: 181 GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDP 240
           GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGEN G+HRSLRSAE YDP
Sbjct: 181 GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEXYDP 240

Query: 241 NKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAG 300
           N+NRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSE YQPETDSW+PVYDGMVAG
Sbjct: 241 NRNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPETDSWYPVYDGMVAG 300

Query: 301 WRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGK 360
           WRNPSASLN  LYALDCKDGCK+RVYDEV+DSWSKHIDSKMHLGNS+ALEAAALVPL+GK
Sbjct: 301 WRNPSASLNGQLYALDCKDGCKLRVYDEVSDSWSKHIDSKMHLGNSQALEAAALVPLHGK 360

Query: 361 LCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHI 420
           LCIIRNNMSISLV+VSKS    G +AEHLWETI+G+GQFKTLVTNLWSS+AGRNRLKSHI
Sbjct: 361 LCIIRNNMSISLVNVSKSEDMTGPTAEHLWETIAGRGQFKTLVTNLWSSLAGRNRLKSHI 420

Query: 421 VHCQVLQA 428
           VHCQVLQA
Sbjct: 421 VHCQVLQA 428

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356572010|ref|XP_003554163.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine max] Back     alignment and taxonomy information
>gi|356511684|ref|XP_003524553.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine max] Back     alignment and taxonomy information
>gi|225445454|ref|XP_002281929.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566973|ref|XP_002524469.1| Protein AFR, putative [Ricinus communis] gi|223536257|gb|EEF37909.1| Protein AFR, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449464602|ref|XP_004150018.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis sativus] gi|449521802|ref|XP_004167918.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357478015|ref|XP_003609293.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355510348|gb|AES91490.1| F-box/kelch-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297738932|emb|CBI28177.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356573363|ref|XP_003554831.1| PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-repeat protein At1g55270-like [Glycine max] Back     alignment and taxonomy information
>gi|225435706|ref|XP_002283484.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Vitis vinifera] gi|147841213|emb|CAN64353.1| hypothetical protein VITISV_013831 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.974 0.960 0.747 1e-178
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.233 0.210 0.44 4.8e-34
TAIR|locus:2198304398 AT1G30090 "AT1G30090" [Arabido 0.614 0.660 0.321 1.1e-32
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.691 0.787 0.302 1.4e-30
TAIR|locus:2098926358 SKIP4 "AT3G61350" [Arabidopsis 0.707 0.846 0.273 1.7e-27
TAIR|locus:2015979346 AT1G27420 "AT1G27420" [Arabido 0.619 0.765 0.276 4e-26
TAIR|locus:2046683372 AFR "ATTENUATED FAR-RED RESPON 0.780 0.897 0.238 4e-26
TAIR|locus:2095138422 AT3G27150 "AT3G27150" [Arabido 0.672 0.682 0.281 1.4e-21
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.535 0.597 0.285 5.5e-21
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.609 0.664 0.288 1.4e-20
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1735 (615.8 bits), Expect = 1.0e-178, P = 1.0e-178
 Identities = 317/424 (74%), Positives = 367/424 (86%)

Query:     5 IQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSRNQ 64
             +Q PLVD+ +C CRVD+GLKTV  A+K+VPG+KLC+QPDI P+ H  R K +   R+R Q
Sbjct:    18 LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH--RRKNSKRERTRIQ 75

Query:    65 SPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVI 124
              PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRW+RL SGNF+YS RK LG++EEW+YV 
Sbjct:    76 PPLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVF 135

Query:   125 KRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR 184
             KRDR+GKISW+ FDPI QLWQPLPP+P+EYSEA+GFGCAVLSGCHLYLFGGKDPL+GSMR
Sbjct:   136 KRDRDGKISWNTFDPISQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR 195

Query:   185 RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNR 244
             RVIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE  G+ R+LRSAEVYDPNKNR
Sbjct:   196 RVIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNR 255

Query:   245 WSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNP 304
             WSFI+DMSTAMVP IGVVY+ KWFLKGLGSH+ V+SEAY PE +SW PV DGMVAGWRNP
Sbjct:   256 WSFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNP 315

Query:   305 SASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCII 364
               SLN  LY LDC+DGCK+RV+DE TDSW+K +DSK HLGNS++LEAAALVPL+ KLCII
Sbjct:   316 CTSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGNSKSLEAAALVPLHNKLCII 375

Query:   365 RNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHIVHCQ 424
             RNNMS+SLVDVS  N ++  +   LWE I+ KGQ K++++N+WSSIAGR  LKSHIVHCQ
Sbjct:   376 RNNMSMSLVDVS--NPDK--NNPRLWENIAVKGQSKSILSNIWSSIAGR-ALKSHIVHCQ 430

Query:   425 VLQA 428
             VLQA
Sbjct:   431 VLQA 434
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198304 AT1G30090 "AT1G30090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098926 SKIP4 "AT3G61350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015979 AT1G27420 "AT1G27420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046683 AFR "ATTENUATED FAR-RED RESPONSE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095138 AT3G27150 "AT3G27150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93W93FBK22_ARATHNo assigned EC number0.74520.97420.9608yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016869001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (428 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-13
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-11
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-10
smart0061247 smart00612, Kelch, Kelch domain 5e-08
smart0061247 smart00612, Kelch, Kelch domain 2e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-05
pfam0064648 pfam00646, F-box, F-box domain 5e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 7e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.001
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 0.002
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 70.2 bits (172), Expect = 5e-13
 Identities = 54/241 (22%), Positives = 100/241 (41%), Gaps = 26/241 (10%)

Query: 121 IYVIK---RDREGKISWHAFDPIYQLWQPLPPI--PKEYSEALGFGCAVLSGCHLYLFGG 175
           IY I    ++     S  ++D   + W  +P +  P++       G  V +   +Y+ GG
Sbjct: 297 IYFIGGMNKNNLSVNSVVSYDTKTKSWNKVPELIYPRK-----NPGVTVFNN-RIYVIGG 350

Query: 176 KDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSA 235
                 S+  V  +    +KW   P ++  R+      +NN +YV GG +      L++ 
Sbjct: 351 IYN-SISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKN-DELLKTV 408

Query: 236 EVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLS-----EAYQPETDSW 290
           E +  N N+WS  S +  +      + ++GK ++ G  S+   +      E+Y P T+ W
Sbjct: 409 ECFSLNTNKWSKGSPLPISHYGGCAIYHDGKIYVIGGISYIDNIKVYNIVESYNPVTNKW 468

Query: 291 FPVYDGMVAGWR-NPS-ASLNRHLYAL-DCKDGCKIR---VYDEVTDSWSKHIDSKMHLG 344
             +    +   R N S    N  +Y +   K    I    VYD+ T++W+        +G
Sbjct: 469 TELS--SLNFPRINASLCIFNNKIYVVGGDKYEYYINEIEVYDDKTNTWTLFCKFPKVIG 526

Query: 345 N 345
           +
Sbjct: 527 S 527

Length = 534
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 428
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 99.96
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.92
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.92
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.91
KOG1230521 consensus Protein containing repeated kelch motifs 99.89
KOG1230 521 consensus Protein containing repeated kelch motifs 99.88
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.82
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.75
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.63
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.28
PF1396450 Kelch_6: Kelch motif 99.19
PF1396450 Kelch_6: Kelch motif 99.18
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 99.07
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.99
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.97
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.91
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.9
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.86
PF1341549 Kelch_3: Galactose oxidase, central domain 98.8
PF1341549 Kelch_3: Galactose oxidase, central domain 98.76
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.74
smart0061247 Kelch Kelch domain. 98.69
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.68
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.66
smart0061247 Kelch Kelch domain. 98.65
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.52
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.48
PLN02772 398 guanylate kinase 98.39
PLN02772 398 guanylate kinase 98.15
PF1385442 Kelch_5: Kelch motif 98.12
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.07
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.06
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.98
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.94
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 97.92
PF1385442 Kelch_5: Kelch motif 97.87
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.71
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.71
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.65
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.62
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.47
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.36
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.33
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.28
PF12768281 Rax2: Cortical protein marker for cell polarity 97.06
PRK04792448 tolB translocation protein TolB; Provisional 96.93
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.85
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.79
PRK04792448 tolB translocation protein TolB; Provisional 96.72
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.68
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.67
PF12768281 Rax2: Cortical protein marker for cell polarity 96.54
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 96.44
PRK11028330 6-phosphogluconolactonase; Provisional 96.43
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.42
PRK05137435 tolB translocation protein TolB; Provisional 96.34
PRK00178430 tolB translocation protein TolB; Provisional 96.32
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.29
PRK05137435 tolB translocation protein TolB; Provisional 96.21
KOG0310 487 consensus Conserved WD40 repeat-containing protein 96.12
PRK00178430 tolB translocation protein TolB; Provisional 96.09
PRK04922433 tolB translocation protein TolB; Provisional 96.06
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 96.0
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.0
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.93
KOG2055514 consensus WD40 repeat protein [General function pr 95.93
PRK13684334 Ycf48-like protein; Provisional 95.86
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.72
PRK04922433 tolB translocation protein TolB; Provisional 95.69
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.67
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.67
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.5
KOG2055514 consensus WD40 repeat protein [General function pr 95.49
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.48
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.47
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.37
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.15
PRK02889427 tolB translocation protein TolB; Provisional 95.11
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 95.01
PRK04043419 tolB translocation protein TolB; Provisional 94.98
PF03089337 RAG2: Recombination activating protein 2; InterPro 94.95
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 94.93
PRK04043419 tolB translocation protein TolB; Provisional 94.56
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.51
PRK02889427 tolB translocation protein TolB; Provisional 94.5
COG4946668 Uncharacterized protein related to the periplasmic 94.37
PRK03629429 tolB translocation protein TolB; Provisional 94.31
PTZ00421 493 coronin; Provisional 94.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.85
PRK10115 686 protease 2; Provisional 93.72
PRK03629429 tolB translocation protein TolB; Provisional 93.72
PLN029191057 haloacid dehalogenase-like hydrolase family protei 93.55
PRK11028330 6-phosphogluconolactonase; Provisional 93.4
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 93.39
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.39
PLN00181793 protein SPA1-RELATED; Provisional 92.64
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.49
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.85
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.65
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.43
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.33
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.24
KOG0316307 consensus Conserved WD40 repeat-containing protein 91.02
KOG2997366 consensus F-box protein FBX9 [General function pre 90.93
PF12217367 End_beta_propel: Catalytic beta propeller domain o 90.75
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 90.59
smart00284255 OLF Olfactomedin-like domains. 90.42
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 90.35
PRK13684334 Ycf48-like protein; Provisional 89.84
PLN00033398 photosystem II stability/assembly factor; Provisio 89.83
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 89.81
KOG0289506 consensus mRNA splicing factor [General function p 89.36
KOG0286343 consensus G-protein beta subunit [General function 88.9
COG1520370 FOG: WD40-like repeat [Function unknown] 88.61
KOG0281499 consensus Beta-TrCP (transducin repeats containing 88.4
smart00284255 OLF Olfactomedin-like domains. 88.26
KOG0296 399 consensus Angio-associated migratory cell protein 88.22
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 88.16
COG3386307 Gluconolactonase [Carbohydrate transport and metab 88.09
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 87.74
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 87.59
PRK01029428 tolB translocation protein TolB; Provisional 87.17
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 86.57
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 86.29
PLN00181793 protein SPA1-RELATED; Provisional 85.64
KOG0316307 consensus Conserved WD40 repeat-containing protein 85.28
PF12217367 End_beta_propel: Catalytic beta propeller domain o 84.71
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 83.88
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 83.83
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 83.72
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 83.47
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 83.42
PTZ00421 493 coronin; Provisional 83.06
COG0823425 TolB Periplasmic component of the Tol biopolymer t 82.15
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 81.56
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 81.51
PTZ00420 568 coronin; Provisional 81.0
COG3391381 Uncharacterized conserved protein [Function unknow 80.39
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-48  Score=389.50  Aligned_cols=343  Identities=24%  Similarity=0.335  Sum_probs=280.0

Q ss_pred             cceeeccccccccCCCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCChHH--HHHHhcccccCCccchhhhchHhHH
Q 014222           22 GLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSRNQSPLLPGLPDD--LAIACLIRVPRVEHCKLRLVCKRWH   99 (428)
Q Consensus        22 ~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lpdd--l~~~il~rlp~~~l~~~~~v~k~W~   99 (428)
                      -+++++.|.+|+...|..++|+++..+|+|...+..+.......+++...+..  ++.+..                .|.
T Consensus       200 vf~a~~~Wv~~d~~~R~~~~~~ll~~vr~~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~----------------~~~  263 (571)
T KOG4441|consen  200 VFEAAMRWVKHDFEEREEHLPALLEAVRLPLLPPQFLVEIVESEPLIKRDSACRDLLDEAK----------------KYH  263 (571)
T ss_pred             HHHHHHHHHhcCHhhHHHHHHHHHHhcCccCCCHHHHHHHHhhhhhhccCHHHHHHHHHHH----------------HHh
Confidence            47788999999999999999999999999888777765544444444443332  122211                222


Q ss_pred             hhhcCCh-hHHHHHhhC-cccceEEEEeeCCC---CceeEEEEeCCCCceEeCCCCCCCCccccccEEEEEeCCEEEEEe
Q 014222          100 RLLSGNF-YYSLRKSLG-IAEEWIYVIKRDRE---GKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFG  174 (428)
Q Consensus       100 ~l~~~~~-f~~~r~~~~-~~~~~l~v~gg~~~---~~~~~~~yd~~~~~W~~l~~~~~~~~~r~~~~~~~~~~~~lyv~G  174 (428)
                      .+..... ...++.... ...+.||++||...   ....+.+|||.+++|..+++|+.+   |..+++++++| +||++|
T Consensus       264 ~~~~~~~~~~~~~t~~r~~~~~~l~~vGG~~~~~~~~~~ve~yd~~~~~w~~~a~m~~~---r~~~~~~~~~~-~lYv~G  339 (571)
T KOG4441|consen  264 LLPQRRPVMQSPRTRPRRSVSGKLVAVGGYNRQGQSLRSVECYDPKTNEWSSLAPMPSP---RCRVGVAVLNG-KLYVVG  339 (571)
T ss_pred             hCcccCccccCCCcccCcCCCCeEEEECCCCCCCcccceeEEecCCcCcEeecCCCCcc---cccccEEEECC-EEEEEc
Confidence            2222110 111222222 44688999998553   346899999999999999999976   88999999999 999999


Q ss_pred             eeCCCCCCCceEEEEECCCCceeeCCCCCcCCcceeeEEECCEEEEEccccCCCCCCCCeEEEEeCCCCceEEcCCCCCC
Q 014222          175 GKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTA  254 (428)
Q Consensus       175 G~~~~~~~~~~v~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~  254 (428)
                      |.+.....++++++|||.+|+|..+++|+.+|..+++++++|+||++||.+.  ...++++|+|||.+++|+.+++|+..
T Consensus       340 G~~~~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg--~~~l~svE~YDp~~~~W~~va~m~~~  417 (571)
T KOG4441|consen  340 GYDSGSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDG--EKSLNSVECYDPVTNKWTPVAPMLTR  417 (571)
T ss_pred             cccCCCcccceEEEecCCCCceeccCCccCccccceeEEECCEEEEEecccc--ccccccEEEecCCCCcccccCCCCcc
Confidence            9984334789999999999999999999999999999999999999999973  56788999999999999999999999


Q ss_pred             ccceEEEEECCEEEEEecCCCCc---eeEEEEeCCCCCeEecCCCCcCCCCCceEEECCeEEEEEccCC----cEEEEEe
Q 014222          255 MVPFIGVVYEGKWFLKGLGSHRQ---VLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDG----CKIRVYD  327 (428)
Q Consensus       255 ~~~~~~~~~~g~lyv~Gg~~~~~---~~i~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~lyv~gG~~~----~~i~~yd  327 (428)
                      |+++++++++|+||++||.....   .++++|||.+++|+.++++...+..+++++++++||++||.++    ..+++||
T Consensus       418 r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~yd  497 (571)
T KOG4441|consen  418 RSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYD  497 (571)
T ss_pred             eeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCcccccccceEEEECCEEEEECCccCCCccceEEEEc
Confidence            99999999999999999954443   5699999999999999998888888888999999999999876    3599999


Q ss_pred             CCCCceeeCcccccccCCcccccceEEEEeCCeEEEEeCCCe---EEEEEeecCCCCCCCccccccceeccCCcc
Q 014222          328 EVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRNNMS---ISLVDVSKSNGERGASAEHLWETISGKGQF  399 (428)
Q Consensus       328 ~~~~~W~~v~~~~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~---~~~v~~yd~~~~~~~~~~~~W~~~~~~~~~  399 (428)
                      |++++|+.+..|....      .+++++..+++||++||...   .+.+++|||.+       ++|+..++|...
T Consensus       498 p~~~~W~~v~~m~~~r------s~~g~~~~~~~ly~vGG~~~~~~l~~ve~ydp~~-------d~W~~~~~~~~~  559 (571)
T KOG4441|consen  498 PETNQWTMVAPMTSPR------SAVGVVVLGGKLYAVGGFDGNNNLNTVECYDPET-------DTWTEVTEPESG  559 (571)
T ss_pred             CCCCceeEcccCcccc------ccccEEEECCEEEEEecccCccccceeEEcCCCC-------CceeeCCCcccc
Confidence            9999999998776553      45788999999999999654   67899999999       999999885433

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-13
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 9e-12
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 3e-07
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 1e-11
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 1e-06
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 1e-11
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 1e-06
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 1e-11
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 4e-07
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 6e-10
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 3e-06
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 8e-09
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-07
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 8e-08
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 1e-05
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 7e-05
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 96/242 (39%), Gaps = 25/242 (10%)
Query: 133 SWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSAR 192
           S   +D   + W  +  +P     A   G   ++G    + G    L+  +R V  Y   
Sbjct: 31  SVECYDFKEERWHQVAELPSRRCRA---GMVYMAGLVFAVGGFNGSLR--VRTVDSYDPV 85
Query: 193 TNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMS 252
            ++W    +M  RR   G+ V+N  LY  GG +G     L S E Y+   N W  ++ M+
Sbjct: 86  KDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGST--GLSSVEAYNIKSNEWFHVAPMN 143
Query: 253 TAMVPFIGVVYEGKWFLKGLGSH----RQVLS--EAYQPETDSWFPVYDGMVAGWRNPSA 306
           T        V      L  +G +    RQ LS  E Y   T+ W  + +           
Sbjct: 144 TRRSSVG--VGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVG 201
Query: 307 SLNRHLYALDCKDGCKIR----VYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLC 362
            LN  LYA+   DG  +R    VYD  T++W +  D  M   N      A +  +NG L 
Sbjct: 202 VLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRN------AGVCAVNGLLY 255
Query: 363 II 364
           ++
Sbjct: 256 VV 257
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-43
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-36
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-26
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 5e-15
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-40
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-25
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-08
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-40
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-26
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-25
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-08
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-40
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-35
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-38
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-28
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-08
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-37
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-29
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-13
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-12
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-10
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 7e-13
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-07
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-05
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-10
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 2e-05
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score =  152 bits (386), Expect = 4e-43
 Identities = 61/239 (25%), Positives = 97/239 (40%), Gaps = 23/239 (9%)

Query: 135 HAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTN 194
             +D   + W  +  +P         G   ++G  ++  GG +     +R V  Y    +
Sbjct: 33  ECYDFKEERWHQVAELPSRRC---RAGMVYMAG-LVFAVGGFNG-SLRVRTVDSYDPVKD 87

Query: 195 KWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTA 254
           +W    +M  RR   G+ V+N  LY  GG +G     L S E Y+   N W  ++ M+T 
Sbjct: 88  QWTSVANMRDRRSTLGAAVLNGLLYAVGGFDG--STGLSSVEAYNIKSNEWFHVAPMNTR 145

Query: 255 MVPFIGVVYEGKWFLKG--LGSHRQVLS--EAYQPETDSWFPVYDGMVAGWRNPS-ASLN 309
                  V  G  +  G    + RQ LS  E Y   T+ W  + + M           LN
Sbjct: 146 RSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAE-MSTRRSGAGVGVLN 204

Query: 310 RHLYALDCKDGCKIR----VYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCII 364
             LYA+   DG  +R    VYD  T++W +  D  M++        A +  +NG L ++
Sbjct: 205 NLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVAD--MNMCRR----NAGVCAVNGLLYVV 257
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.98
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.83
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.76
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.76
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.6
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.43
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.37
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.17
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.13
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.13
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.0
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.89
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.87
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.82
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.81
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.7
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.68
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.66
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.63
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.62
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.6
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.56
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.52
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.51
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.5
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.46
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.44
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.39
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.39
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.38
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.36
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.34
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.34
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.32
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.3
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.27
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.25
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.24
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.24
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.23
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.23
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.23
3jrp_A379 Fusion protein of protein transport protein SEC13 97.15
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.14
3jro_A 753 Fusion protein of protein transport protein SEC13 97.14
3jrp_A379 Fusion protein of protein transport protein SEC13 97.14
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.13
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.13
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.13
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 97.1
2pm7_B297 Protein transport protein SEC13, protein transport 97.1
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.08
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.08
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.06
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.96
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.96
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.95
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.88
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.87
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.86
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.85
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.8
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.8
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.79
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.78
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.78
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.77
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.73
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.73
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.7
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.68
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.67
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.67
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.66
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.65
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.65
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.63
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.63
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.61
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.58
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.58
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.52
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.51
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.5
2pm7_B297 Protein transport protein SEC13, protein transport 96.5
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.47
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.44
3jro_A 753 Fusion protein of protein transport protein SEC13 96.44
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.44
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.38
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.35
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.35
3v65_B386 Low-density lipoprotein receptor-related protein; 96.34
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.34
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 96.33
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.3
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.3
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.27
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.26
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.26
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.24
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.22
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.18
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.18
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.17
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.16
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.07
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.06
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.05
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.05
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.03
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.02
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.98
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.98
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.94
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.93
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.93
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.92
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.92
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.91
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.9
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.89
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.87
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.87
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.86
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.84
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.83
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.77
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.72
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.7
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.69
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.67
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.67
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.64
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.64
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.63
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.61
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.6
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.6
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.59
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.56
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.55
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.42
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.41
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.37
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.37
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.33
3ott_A758 Two-component system sensor histidine kinase; beta 95.32
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.32
3v65_B386 Low-density lipoprotein receptor-related protein; 95.3
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.3
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.28
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.18
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.18
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.12
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.09
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.07
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.04
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.02
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 95.02
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.97
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.96
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.94
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.81
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.81
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 94.79
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.79
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.75
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.7
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.59
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 94.58
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.5
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.48
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.46
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.45
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 94.43
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 94.2
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.15
2ymu_A577 WD-40 repeat protein; unknown function, two domain 94.13
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.08
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.07
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.04
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.03
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.98
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 93.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.96
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.77
3p5b_L400 Low density lipoprotein receptor variant; B-propel 93.77
2xyi_A430 Probable histone-binding protein CAF1; transcripti 93.76
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.62
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.6
2ymu_A577 WD-40 repeat protein; unknown function, two domain 93.58
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 93.57
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.53
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.47
2ece_A 462 462AA long hypothetical selenium-binding protein; 93.46
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 93.41
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.4
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 93.4
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 93.11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 92.97
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.96
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.93
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.65
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.38
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 92.34
1itv_A195 MMP9; adaptive molecular recognition, beta propell 92.22
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 91.98
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 91.95
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 91.92
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 91.85
1k32_A 1045 Tricorn protease; protein degradation, substrate g 91.81
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.81
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 91.55
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.46
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 91.28
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 91.22
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 91.03
2xyi_A430 Probable histone-binding protein CAF1; transcripti 91.03
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.74
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 90.59
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 90.58
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 90.56
1itv_A195 MMP9; adaptive molecular recognition, beta propell 90.41
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 90.39
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 90.37
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 90.28
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.24
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.09
3ott_A 758 Two-component system sensor histidine kinase; beta 89.92
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 89.89
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 89.76
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 89.64
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 89.53
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 89.53
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 89.26
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 89.02
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 88.75
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 88.54
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 88.54
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 88.49
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 88.49
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 87.71
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 87.64
1k32_A 1045 Tricorn protease; protein degradation, substrate g 87.29
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 87.27
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 86.84
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 86.31
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 85.35
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 85.24
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 85.21
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 85.16
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 84.97
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 84.93
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 84.58
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.43
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 83.91
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 83.66
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 83.06
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 82.69
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 82.54
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 81.96
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 81.96
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 81.2
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 80.21
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 80.12
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.3e-43  Score=330.60  Aligned_cols=265  Identities=15%  Similarity=0.260  Sum_probs=230.5

Q ss_pred             cceEEEEeeCCCCceeEEEEeCCCCceEeCCCCCCCCccccccEEEEEeCCEEEEEeeeCCCCCCCceEEEEECCCCcee
Q 014222          118 EEWIYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWH  197 (428)
Q Consensus       118 ~~~l~v~gg~~~~~~~~~~yd~~~~~W~~l~~~~~~~~~r~~~~~~~~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~  197 (428)
                      .+.||++||... .+++++||+.+++|..++++|.+   |..|++++.++ +||++||.+  ....+++++||+.+++|+
T Consensus        11 ~~~l~~~GG~~~-~~~~~~~d~~~~~W~~~~~~p~~---r~~~~~~~~~~-~lyv~GG~~--~~~~~~~~~~d~~~~~W~   83 (306)
T 3ii7_A           11 HDYRIALFGGSQ-PQSCRYFNPKDYSWTDIRCPFEK---RRDAACVFWDN-VVYILGGSQ--LFPIKRMDCYNVVKDSWY   83 (306)
T ss_dssp             CCEEEEEECCSS-TTSEEEEETTTTEEEECCCCSCC---CBSCEEEEETT-EEEEECCBS--SSBCCEEEEEETTTTEEE
T ss_pred             cceEEEEeCCCC-CceEEEecCCCCCEecCCCCCcc---cceeEEEEECC-EEEEEeCCC--CCCcceEEEEeCCCCeEE
Confidence            578999998544 67899999999999999998875   88999999988 899999987  346789999999999999


Q ss_pred             eCCCCCcCCcceeeEEECCEEEEEccccCCCCCCCCeEEEEeCCCCceEEcCCCCCCccceEEEEECCEEEEEecCCCC-
Q 014222          198 RAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHR-  276 (428)
Q Consensus       198 ~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~~~~~~~~~~~g~lyv~Gg~~~~-  276 (428)
                      .++++|.+|..|++++++++||++||.+.+ ....+++++||+.+++|+.++++|.+|..+++++++++||++||.... 
T Consensus        84 ~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~-~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~  162 (306)
T 3ii7_A           84 SKLGPPTPRDSLAACAAEGKIYTSGGSEVG-NSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNN  162 (306)
T ss_dssp             EEECCSSCCBSCEEEEETTEEEEECCBBTT-BSCCCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCEESCT
T ss_pred             ECCCCCccccceeEEEECCEEEEECCCCCC-CcEeeeEEEEeCCCCceEeCCCCcCCcceeEEEEECCEEEEECCCCCCC
Confidence            999999999999999999999999998632 456789999999999999999999999999999999999999984322 


Q ss_pred             -----ceeEEEEeCCCCCeEecCCCCcCCCCCceEEECCeEEEEEccCC----cEEEEEeCCCCceeeCcccccccCCcc
Q 014222          277 -----QVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDG----CKIRVYDEVTDSWSKHIDSKMHLGNSR  347 (428)
Q Consensus       277 -----~~~i~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~lyv~gG~~~----~~i~~yd~~~~~W~~v~~~~~~~~~~~  347 (428)
                           ...+++||+.+++|+.+++++.++..+++++++++||++||.+.    +++++||+++++|+.++.+|.+.    
T Consensus       163 ~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r----  238 (306)
T 3ii7_A          163 VSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKG----  238 (306)
T ss_dssp             TTCEECCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCEETTEEBCCEEEEETTTTEEEECCCCSCCB----
T ss_pred             CcccccceEEEeCCCCCeEEECCCccchhhcceEEEECCEEEEEeCCCCCCCCceEEEeeCCCCcEEECCCCCCCc----
Confidence                 44589999999999999987776767778889999999999754    46999999999999998766432    


Q ss_pred             cccceEEEEeCCeEEEEeCCC---eEEEEEeecCCCCCCCccccccceeccCCccccch
Q 014222          348 ALEAAALVPLNGKLCIIRNNM---SISLVDVSKSNGERGASAEHLWETISGKGQFKTLV  403 (428)
Q Consensus       348 ~~~~~~~~~~~~~lyv~GG~~---~~~~v~~yd~~~~~~~~~~~~W~~~~~~~~~~~f~  403 (428)
                        .+++++.++++|||+||..   ...++++||+.+       ++|+.++.||..+...
T Consensus       239 --~~~~~~~~~~~i~v~GG~~~~~~~~~~~~yd~~~-------~~W~~~~~~~~~r~~~  288 (306)
T 3ii7_A          239 --VTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTET-------DKWVANSKVRAFPVTS  288 (306)
T ss_dssp             --SCCEEEEETTEEEEEECBCSSSBCCEEEEEETTT-------TEEEEEEEEECCSCTT
T ss_pred             --cceeEEEECCEEEEEeCcCCCeeeeeEEEEcCCC-------CeEEeCCCccccccee
Confidence              3578888899999999964   356899999999       9999999998775543
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 428
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-10
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 0.004
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 1e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.8 bits (140), Expect = 3e-10
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 168 CHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGG 227
             +Y  GG D  +  +  V  Y   T  W     M  RR   G  V    +YV GG +G 
Sbjct: 196 NCIYAAGGYDG-QDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDG- 253

Query: 228 VHRSLRSAEVYDPNKNRWSFISDMSTA 254
            H  L S E YDP+ + WS ++ M++ 
Sbjct: 254 -HTFLDSVECYDPDTDTWSEVTRMTSG 279
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.47
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.35
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.15
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 96.95
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.95
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.87
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.86
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.69
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.66
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.58
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.49
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.48
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.43
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.42
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.35
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.33
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.12
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.08
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.99
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.8
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.78
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.59
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.4
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.21
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.12
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.74
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.71
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 94.3
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.27
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.09
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.02
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 93.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.91
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.58
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.24
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 92.67
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.69
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 90.57
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 90.39
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 89.75
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 89.17
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 89.1
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 89.03
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 88.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 88.86
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.84
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 88.6
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.45
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 88.01
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 87.93
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.58
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 86.04
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.99
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 84.67
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 83.83
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.5
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 83.45
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 82.53
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 82.32
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 81.18
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5e-39  Score=295.81  Aligned_cols=267  Identities=21%  Similarity=0.335  Sum_probs=228.1

Q ss_pred             cceEEEEeeCC-CCceeEEEEeCCCCceEeCCCCCCCCccccccEEEEEeCCEEEEEeeeCCCC---CCCceEEEEECCC
Q 014222          118 EEWIYVIKRDR-EGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLK---GSMRRVIFYSART  193 (428)
Q Consensus       118 ~~~l~v~gg~~-~~~~~~~~yd~~~~~W~~l~~~~~~~~~r~~~~~~~~~~~~lyv~GG~~~~~---~~~~~v~~yd~~t  193 (428)
                      ...||++||.. ...+.+++||+.+++|+.++++|.+   |.+|++++.++ +||++||.....   ...+++++||+.+
T Consensus         4 g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~---R~~~~~~~~~~-~iyv~GG~~~~~~~~~~~~~~~~yd~~~   79 (288)
T d1zgka1           4 GRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVP---RSGLAGCVVGG-LLYAVGGRNNSPDGNTDSSALDCYNPMT   79 (288)
T ss_dssp             CCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSC---CBSCEEEEETT-EEEEECCEEEETTEEEECCCEEEEETTT
T ss_pred             CCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCCc---cceeEEEEECC-EEEEEeCcccCCCCccccchhhhccccc
Confidence            56899999854 3345799999999999999999876   88999999888 999999974321   2467899999999


Q ss_pred             CceeeCCCCCcCCcceeeEEECCEEEEEccccCCCCCCCCeEEEEeCCCCceEEcCCCCCCccceEEEEECCEEEEEecC
Q 014222          194 NKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLG  273 (428)
Q Consensus       194 ~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~~~~~~~~~~~g~lyv~Gg~  273 (428)
                      ++|+.+++||.+|..|+++++++++|++||...  ....+.++.||+.++.|...+.++..|..++++..++++|++||.
T Consensus        80 ~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~  157 (288)
T d1zgka1          80 NQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHG--CIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF  157 (288)
T ss_dssp             TEEEECCCCSSCCBTCEEEEETTEEEEECCEET--TEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCB
T ss_pred             ccccccccccceecceeccccceeeEEecceec--ccccceeeeeccccCccccccccccccccceeeeeeecceEecCc
Confidence            999999999999999999999999999999863  455788999999999999999999999999999999999999985


Q ss_pred             CCC--ceeEEEEeCCCCCeEecCCCCcCCCCCceEEECCeEEEEEccCC----cEEEEEeCCCCceeeCcccccccCCcc
Q 014222          274 SHR--QVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLYALDCKDG----CKIRVYDEVTDSWSKHIDSKMHLGNSR  347 (428)
Q Consensus       274 ~~~--~~~i~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~lyv~gG~~~----~~i~~yd~~~~~W~~v~~~~~~~~~~~  347 (428)
                      ...  ...++.||+.+++|......+.....+++++.+++||++||.+.    ...+.||..+++|+.++.+|...    
T Consensus       158 ~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r----  233 (288)
T d1zgka1         158 DGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRR----  233 (288)
T ss_dssp             CSSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSSCC----
T ss_pred             ccccccceEEEeeccccccccccccccccccccccceeeeEEEecCccccccccceeeeeecceeeecccCccCcc----
Confidence            433  33489999999999999876666666677899999999998765    46899999999999998654332    


Q ss_pred             cccceEEEEeCCeEEEEeCCCe---EEEEEeecCCCCCCCccccccceeccCCccccch
Q 014222          348 ALEAAALVPLNGKLCIIRNNMS---ISLVDVSKSNGERGASAEHLWETISGKGQFKTLV  403 (428)
Q Consensus       348 ~~~~~~~~~~~~~lyv~GG~~~---~~~v~~yd~~~~~~~~~~~~W~~~~~~~~~~~f~  403 (428)
                        .+++++.++++|||+||.+.   ...+++||+++       ++|++++.||..|...
T Consensus       234 --~~~~~~~~~~~l~v~GG~~~~~~~~~v~~yd~~~-------~~W~~~~~~p~~R~~~  283 (288)
T d1zgka1         234 --SALGITVHQGRIYVLGGYDGHTFLDSVECYDPDT-------DTWSEVTRMTSGRSGV  283 (288)
T ss_dssp             --BSCEEEEETTEEEEECCBCSSCBCCEEEEEETTT-------TEEEEEEECSSCCBSC
T ss_pred             --cceEEEEECCEEEEEecCCCCeecceEEEEECCC-------CEEEECCCCCCCcEeE
Confidence              45788889999999999533   56799999999       9999999999986653
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure