Citrus Sinensis ID: 014524

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---

MPGSSALDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVNDKGEF

cccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccEEEcccccccccHHHHHHHHHccccccccccEEEccccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccccHHHHHHHcccccccEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccccccc

ccccccHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHcccccEEcccccccccHHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEcccccccHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEcccccHccHHHHHHHHHHcccccEEEEcccccccHHccc

mpgssaldvLTEDLLVRVREKIGDELDSKTWRLVCKEfsrvdsvtrttLRVLRVEFLFILLdkypyiktldlsvcprvndgtVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARAcpllesvdlsyccgfgdREAAALSFASGlkevkldkclnvtdVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYlkltndsfcSIATLAKLESLVmvgcpcvddtglrflesgcpLLKTIFVSRCKFVSSTGLISVIRghsgllqldaghcFSELSTTLLHHMRDLKNLeaitmdgarisdscfQTISFNCKSLVEIGLSkclgvtntgITQLVSGCvnlktidltcchsiTDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLrleeidltdcngvndkgef

mpgssaldvlteDLLVRVREkigdeldsktwrlvckefsrvdsvtrttlrvLRVEFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEeidltdcngvndkgef

MPGSSALDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIdllckkcldlksldVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVNDKGEF

*******DVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNG*******

****SALDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVNDKGEF

***SSALDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVND**E*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		423	2.2.26 [Sep-21-2011]
Q8RWU5		665	F-box/LRR-repeat protein	no	no	0.971	0.618	0.371	3e-60
Q9C5D2		610	F-box/LRR-repeat protein	no	no	0.843	0.585	0.279	3e-25
Q96IG2		436	F-box/LRR-repeat protein	yes	no	0.645	0.626	0.263	3e-21
Q58DG6		436	F-box/LRR-repeat protein	yes	no	0.645	0.626	0.263	3e-21
Q9CZV8		436	F-box/LRR-repeat protein	yes	no	0.645	0.626	0.263	6e-21
Q8BH16		423	F-box/LRR-repeat protein	no	no	0.643	0.643	0.256	2e-20
Q5R3Z8		423	F-box/LRR-repeat protein	yes	no	0.706	0.706	0.292	2e-19
Q9UKC9		423	F-box/LRR-repeat protein	no	no	0.706	0.706	0.292	2e-19
Q5BJ29		491	F-box/LRR-repeat protein	no	no	0.699	0.602	0.253	4e-19
A1A5X2		489	F-box/LRR-repeat protein	no	no	0.659	0.570	0.253	5e-19

>sp\|Q8RWU5\|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1	Back alignment and function desciption

 Score =  232 bits (592), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 155/417 (37%), Positives = 243/417 (58%), Gaps = 6/417 (1%)

Query: 6   ALDVLTEDLLVRVREKIG-DELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKY 64
             D+L+E+L+  + + I  +  D K++ L CK F +++S  R +L+ LR ++L  +L +Y
Sbjct: 12  PFDLLSEELVFIILDLISPNPSDLKSFSLTCKSFYQLESKHRGSLKPLRSDYLPRILTRY 71

Query: 65  PYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLL 124
                LDL+ CPRV D    + LS +      +L+SL LSRS      GL  LA  C  L
Sbjct: 72  RNTTDLDLTFCPRVTD----YALSVVGCLSGPTLRSLDLSRSGSFSAAGLLRLALKCVNL 127

Query: 125 ESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCM 184
             +DLS      D +AA ++ A  L+ +KL +C  +TD+G+  IAV C  L  +SLKWC+
Sbjct: 128 VEIDLSNATEMRDADAAVVAEARSLERLKLGRCKMLTDMGIGCIAVGCKKLNTVSLKWCV 187

Query: 185 EISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFL 244
            + DLG+ LL  KC D+++LD+SYL +T      I  L  LE L++ GC  VDD  L+ L
Sbjct: 188 GVGDLGVGLLAVKCKDIRTLDLSYLPITGKCLHDILKLQHLEELLLEGCFGVDDDSLKSL 247

Query: 245 ESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLE 304
              C  LK +  S C+ ++  GL S++ G   L +LD  HC S +S      ++ +  L+
Sbjct: 248 RHDCKSLKKLDASSCQNLTHRGLTSLLSGAGYLQRLDLSHCSSVISLDFASSLKKVSALQ 307

Query: 305 AITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHS 364
           +I +DG  ++    + I   C SL E+ LSKC+ VT+ G++ LV    +L+ +D+TCC  
Sbjct: 308 SIRLDGCSVTPDGLKAIGTLCNSLKEVSLSKCVSVTDEGLSSLVMKLKDLRKLDITCCRK 367

Query: 365 ITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVNDKG 421
           ++  +I+ IA+SC  LV LK+ESC++++ +  + +G  C  LEE+DLTD N ++D+G
Sbjct: 368 LSRVSITQIANSCPLLVSLKMESCSLVSREAFWLIGQKCRLLEELDLTD-NEIDDEG 423

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9C5D2\|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1	Back alignment and function description

>sp\|Q96IG2\|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2	Back alignment and function description

>sp\|Q58DG6\|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2	Back alignment and function description

>sp\|Q9CZV8\|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3	Back alignment and function description

>sp\|Q8BH16\|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1	Back alignment and function description

>sp\|Q5R3Z8\|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q9UKC9\|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3	Back alignment and function description

>sp\|Q5BJ29\|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1	Back alignment and function description

>sp\|A1A5X2\|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		423
224123030		646	predicted protein [Populus trichocarpa]	0.981	0.642	0.677	1e-152
356505803		641	PREDICTED: F-box/LRR-repeat protein 3-li	0.985	0.650	0.670	1e-149
356572954		641	PREDICTED: F-box/LRR-repeat protein 3-li	0.985	0.650	0.658	1e-148
255542802		644	ubiquitin-protein ligase, putative [Rici	0.995	0.653	0.661	1e-146
224123854		646	predicted protein [Populus trichocarpa]	0.981	0.642	0.677	1e-146
357511815		623	F-box/LRR-repeat protein [Medicago trunc	0.962	0.653	0.658	1e-145
357511817		605	F-box/LRR-repeat protein [Medicago trunc	0.962	0.672	0.658	1e-145
357511813		679	F-box/LRR-repeat protein [Medicago trunc	0.962	0.599	0.658	1e-145
359487645		1700	PREDICTED: uncharacterized protein LOC10	0.945	0.235	0.643	1e-142
296089716		643	unnamed protein product [Vitis vinifera]	0.981	0.645	0.643	1e-141

>gi\|224123030\|ref\|XP_002318976.1\| predicted protein [Populus trichocarpa] gi\|222857352\|gb\|EEE94899.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 282/416 (67%), Positives = 331/416 (79%), Gaps = 1/416 (0%)

Query: 7   LDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPY 66
           L VLTEDLL+RV EK+  + D K WRL+CKEF RVDS+TR TLRVL VEFL  LL  Y  
Sbjct: 9   LSVLTEDLLIRVNEKLVQDSDRKIWRLICKEFHRVDSITRKTLRVLHVEFLPTLLKNYTN 68

Query: 67  IKTLDLSVCPRVNDGTVSFLLSQLSLS-WTRSLKSLILSRSTGLRYRGLEMLARACPLLE 125
           + TLDLSVCP + DGT++ LL ++  S W R+LK L L R+ GL++ GLEML  AC  LE
Sbjct: 69  LLTLDLSVCPCIEDGTITLLLHRVDHSMWARNLKFLNLRRANGLKFAGLEMLVGACKGLE 128

Query: 126 SVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCME 185
           SVD+SYC GFGDREAAA+S   GLKE+ +DKCL V+DVGLAKI V C  L RLSLKWCME
Sbjct: 129 SVDVSYCRGFGDREAAAISGCGGLKELSMDKCLGVSDVGLAKIVVGCGRLVRLSLKWCME 188

Query: 186 ISDLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLE 245
           ISDLG++LLCKKCL+LK LDVSYLK+T+DS  SIA L KLE L MVGCP V+D GL+FLE
Sbjct: 189 ISDLGVELLCKKCLELKFLDVSYLKVTSDSLRSIAALPKLEDLAMVGCPLVNDVGLQFLE 248

Query: 246 SGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEA 305
           +GCPLL+ I VSRC  VSS GL ++IRGH+GLLQ+DAG+  SE S   +  M++LKNL A
Sbjct: 249 NGCPLLQKIDVSRCDCVSSYGLSALIRGHNGLLQIDAGYTISEFSANFVECMQELKNLNA 308

Query: 306 ITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSI 365
           I +DGAR+SD+ FQTIS NC+SL+EIGLSKC GVTN  I QLVSGCVNLKTI+LTCC SI
Sbjct: 309 IIIDGARVSDTVFQTISNNCRSLIEIGLSKCTGVTNMRIMQLVSGCVNLKTINLTCCRSI 368

Query: 366 TDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVNDKG 421
           TD AISAIADSCR L+CLK+ESCNMITEK L QLGS C  LE++DLTDC G+ND+G
Sbjct: 369 TDAAISAIADSCRNLLCLKLESCNMITEKSLEQLGSHCALLEDLDLTDCFGINDRG 424

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356505803\|ref\|XP_003521679.1\| PREDICTED: F-box/LRR-repeat protein 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|356572954\|ref\|XP_003554630.1\| PREDICTED: F-box/LRR-repeat protein 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|255542802\|ref\|XP_002512464.1\| ubiquitin-protein ligase, putative [Ricinus communis] gi\|223548425\|gb\|EEF49916.1\| ubiquitin-protein ligase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224123854\|ref\|XP_002330225.1\| predicted protein [Populus trichocarpa] gi\|222871681\|gb\|EEF08812.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357511815\|ref\|XP_003626196.1\| F-box/LRR-repeat protein [Medicago truncatula] gi\|355501211\|gb\|AES82414.1\| F-box/LRR-repeat protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357511817\|ref\|XP_003626197.1\| F-box/LRR-repeat protein [Medicago truncatula] gi\|355501212\|gb\|AES82415.1\| F-box/LRR-repeat protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357511813\|ref\|XP_003626195.1\| F-box/LRR-repeat protein [Medicago truncatula] gi\|355501210\|gb\|AES82413.1\| F-box/LRR-repeat protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|359487645\|ref\|XP_002279164.2\| PREDICTED: uncharacterized protein LOC100249393 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296089716\|emb\|CBI39535.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		423
TAIR\|locus:2143320		642	AT5G27920 "AT5G27920" [Arabido	0.981	0.646	0.565	6e-119
TAIR\|locus:2149805		665	AT5G01720 "AT5G01720" [Arabido	0.966	0.615	0.356	2.9e-64
TAIR\|locus:2166978		405	AT5G23340 [Arabidopsis thalian	0.680	0.711	0.292	2.6e-31
TAIR\|locus:505006471		610	AT4G15475 "AT4G15475" [Arabido	0.903	0.626	0.268	1.1e-28
UNIPROTKB\|Q58DG6		436	FBXL20 "F-box/LRR-repeat prote	0.836	0.811	0.248	3.9e-28
UNIPROTKB\|Q96IG2		436	FBXL20 "F-box/LRR-repeat prote	0.836	0.811	0.248	3.9e-28
MGI\|MGI:1919444		436	Fbxl20 "F-box and leucine-rich	0.836	0.811	0.248	3.9e-28
TAIR\|locus:2145512		623	EBF2 "EIN3-binding F box prote	0.721	0.489	0.269	4.9e-24
UNIPROTKB\|F1NHD2		423	FBXL2 "Uncharacterized protein	0.834	0.834	0.248	8e-24
UNIPROTKB\|F1PWK1		422	FBXL2 "Uncharacterized protein	0.834	0.836	0.24	1.1e-23

TAIR\|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1171 (417.3 bits), Expect = 6.0e-119, P = 6.0e-119
 Identities = 236/417 (56%), Positives = 307/417 (73%)

Query:     5 SALDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKY 64
             S L VL+EDLLVRV E + D    KTWRL+ K+F RVDS+TRTT+R+LRVEFL  LL KY
Sbjct:     6 SILSVLSEDLLVRVYECL-DPPCRKTWRLISKDFLRVDSLTRTTIRILRVEFLPTLLFKY 64

Query:    65 PYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLL 124
             P + +LDLSVCP+++D  V  L    ++S T  +KSL LSRST +R RGLE LAR C  L
Sbjct:    65 PNLSSLDLSVCPKLDDDVVLRLALDGAIS-TLGIKSLNLSRSTAVRARGLETLARMCHAL 123

Query:   125 ESVDLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCM 184
             E VD+S+C GFGDREAAALS A+GL+E+K+DKCL+++DVGLA+I V C NL ++SLKWCM
Sbjct:   124 ERVDVSHCWGFGDREAAALSSATGLRELKMDKCLSLSDVGLARIVVGCSNLNKISLKWCM 183

Query:   185 EISDLGIXXXXXXXXXXXXXXVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFL 244
             EISDLGI              VSYLK+TNDS  SIA L KLE L MV CP +DD GL+FL
Sbjct:   184 EISDLGIDLLCKICKGLKSLDVSYLKITNDSIRSIALLVKLEVLDMVSCPLIDDGGLQFL 243

Query:   245 ESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLE 304
             E+G P L+ + V+RC  VS +GLIS++RGH  +  L A HC SE+S + L +++ LK+L+
Sbjct:   244 ENGSPSLQEVDVTRCDRVSLSGLISIVRGHPDIQLLKASHCVSEVSGSFLKYIKGLKHLK 303

Query:   305 AITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHS 364
              I +DGA +SDS   ++S +C+SL+EIGLS+C+ VT+ G+  L   C+NLKT++L CC  
Sbjct:   304 TIWIDGAHVSDSSLVSLSSSCRSLMEIGLSRCVDVTDIGMISLARNCLNLKTLNLACCGF 363

Query:   365 ITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVNDKG 421
             +TD AISA+A SCR L  LK+ESC++ITEKGL  LG + + ++E+DLTDC GVND+G
Sbjct:   364 VTDVAISAVAQSCRNLGTLKLESCHLITEKGLQSLGCYSMLVQELDLTDCYGVNDRG 420

GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0009407 "toxin catabolic process" evidence=RCA

TAIR\|locus:2149805 AT5G01720 "AT5G01720" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

TAIR\|locus:2145512 EBF2 "EIN3-binding F box protein 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00130121	hypothetical protein (646 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		423
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-12
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	1e-11
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	5e-11
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-10
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	9e-05

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score = 65.4 bits (160), Expect = 3e-12
 Identities = 52/203 (25%), Positives = 90/203 (44%), Gaps = 39/203 (19%)

Query: 199 LDLKSLDVSYLKLTNDSFCSIATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSR 258
           L+L    +S   L   S C      KL+ L++ G   +DD GL  L   CP L+ + +  
Sbjct: 33  LELYMCPISDPPLDQLSNC-----NKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRA 87

Query: 259 CKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRDLKNLEAI----TMDGARIS 314
           C+ ++ +G++++           A +C                 L+ I      +G  I+
Sbjct: 88  CENITDSGIVAL-----------ATNC---------------PKLQTINLGRHRNGHLIT 121

Query: 315 DSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCV-NLKTIDLTCCHSITDDAISAI 373
           D     +  NC  L  +G + C  VT+ G+ +L SGC  +L+ + L  C ++TD +I AI
Sbjct: 122 DVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAI 180

Query: 374 --ADSCRGLVCLKIESCNMITEK 394
             ++    L  L+   C +IT+ 
Sbjct: 181 LASNYFPNLSVLEFRGCPLITDF 203

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		423
KOG4341		483	consensus F-box protein containing LRR [General fu	100.0
KOG4341		483	consensus F-box protein containing LRR [General fu	99.97
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.95
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.84
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.83
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.79
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.78
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.77
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.77
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.74
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.7
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.64
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.54
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.53
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.47
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.38
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.37
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.26
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.26
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.25
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.08
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	99.01
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	98.95
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.95
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.94
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.84
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.76
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.69
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.68
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.68
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.67
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.58
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	98.57
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.53
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.49
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.47
smart00256		41	FBOX A Receptor for Ubiquitination Targets.	98.46
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.46
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.27
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.26
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.21
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.18
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.08
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.08
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.9
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.84
KOG0472		565	consensus Leucine-rich repeat protein [Function un	97.83
KOG0472		565	consensus Leucine-rich repeat protein [Function un	97.8
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.46
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.41
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.34
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.24
KOG4308		478	consensus LRR-containing protein [Function unknown	97.18
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.12
PLN03150		623	hypothetical protein; Provisional	97.12
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.99
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.95
PRK15386		426	type III secretion protein GogB; Provisional	96.93
KOG4308		478	consensus LRR-containing protein [Function unknown	96.91
PLN03150		623	hypothetical protein; Provisional	96.7
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.66
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.65
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.61
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.6
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	96.56
PLN03215		373	ascorbic acid mannose pathway regulator 1; Provisi	96.54
KOG2997		366	consensus F-box protein FBX9 [General function pre	96.33
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	96.05
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.99
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	95.66
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	95.66
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.64
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	94.93
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	94.05
PRK15386		426	type III secretion protein GogB; Provisional	94.05
PF13013		109	F-box-like_2: F-box-like domain	93.79
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	93.71
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	93.31
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	92.92
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	92.63
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	91.99
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	91.54
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	90.98
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	90.65
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	88.12
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	85.38
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	84.35

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1e-36  Score=253.34  Aligned_cols=380  Identities=23%  Similarity=0.387  Sum_probs=296.6

Q ss_pred             ccchHHHHHHHHHhcCCcchhhHHHHHHHHHHHHHhhhccccccchHHHHHHHhhcCCCcceEeecCCC-CCChhHHHHH
Q 014524            8 DVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPYIKTLDLSVCP-RVNDGTVSFL   86 (423)
Q Consensus         8 ~~LP~eil~~If~~L~~~~d~~~~~~vcr~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~-~~~~~~~~~l   86 (423)
                      -.||+|++..||++|+ ...+.+++++|+.|...+....-+                   +.+|+.... .+....++.+
T Consensus        73 ~~LPpEl~lkvFS~LD-tksl~r~a~~c~~~n~~AlD~~~~-------------------q~idL~t~~rDv~g~VV~~~  132 (483)
T KOG4341|consen   73 RSLPPELLLKVFSMLD-TKSLCRAAQCCTMWNKLALDGSCW-------------------QHIDLFTFQRDVDGGVVENM  132 (483)
T ss_pred             ccCCHHHHHHHHHHHh-HHHHHHHHHHHHHhhhhhhccccc-------------------eeeehhcchhcCCCcceehH
Confidence            4699999999999999 999999999999999876443222                   222322111 1122223333


Q ss_pred             hhhcccccCCCccEEEeccCCCCchhHHHHHHHhCCCccEEEccCcCCCChHHHHHhhc-CCCCcEEecCCCCCCChHHH
Q 014524           87 LSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESVDLSYCCGFGDREAAALSF-ASGLKEVKLDKCLNVTDVGL  165 (423)
Q Consensus        87 ~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~-~~~L~~L~l~~~~~~~~~~~  165 (423)
                          .......|+.|.+.++....+..+..+...||++++|.+.+|..+++.....+++ +++|++|++..|..+++..+
T Consensus       133 ----~~Rcgg~lk~LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~L  208 (483)
T KOG4341|consen  133 ----ISRCGGFLKELSLRGCRAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSL  208 (483)
T ss_pred             ----hhhhccccccccccccccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHH
Confidence                1233467788888888777777777777788888888888888888877777766 78888888888888888888


Q ss_pred             HHHHHhCccccccccccccccchhhHHHHHhcCCCCcEEeccCc-ccChhHHHHhhc-cCCccEEEecCCCCCCchhHHH
Q 014524          166 AKIAVRCVNLERLSLKWCMEISDLGIDLLCKKCLDLKSLDVSYL-KLTNDSFCSIAT-LAKLESLVMVGCPCVDDTGLRF  243 (423)
Q Consensus       166 ~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~-~~~~~~~~~~~~-~~~L~~L~l~~~~~~~~~~~~~  243 (423)
                      ..+.++|++|+++++++|+.+...++..+...+..++.+...+| ....+.+..... ++.+..+++..|..+++..+..
T Consensus       209 k~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~  288 (483)
T KOG4341|consen  209 KYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWL  288 (483)
T ss_pred             HHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHH
Confidence            88888888888888888888888888888878888888877777 555555555554 6777777777888888888877


Q ss_pred             HHhcCCCCceEecCCCcccCcchHHHHHHhCCCCceeccCCCcccchHHHHHHhhc-CCcccEEEccCcc-CChhhHHHH
Q 014524          244 LESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHMRD-LKNLEAITMDGAR-ISDSCFQTI  321 (423)
Q Consensus       244 l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~-~~~L~~L~l~~~~-~~~~~~~~l  321 (423)
                      +..++..|+.|..++|..+++..+.++..++++|+.|.+..|.. +++..+..+++ ++.|+.+++..+. +.+..+..+
T Consensus       289 i~~~c~~lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~-fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sl  367 (483)
T KOG4341|consen  289 IACGCHALQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQ-FSDRGFTMLGRNCPHLERLDLEECGLITDGTLASL  367 (483)
T ss_pred             HhhhhhHhhhhcccCCCCCchHHHHHHhcCCCceEEEeccccch-hhhhhhhhhhcCChhhhhhcccccceehhhhHhhh
Confidence            88878888888888888888888888888888888888888887 78877777764 7788888888875 555568888


Q ss_pred             HhcCCCccEEeeccCCCCChHHHHHHHh---cCCCCcEEecCCCCCCCHHHHHHHHhhCCCccEEEeccCCCCCHHHHHH
Q 014524          322 SFNCKSLVEIGLSKCLGVTNTGITQLVS---GCVNLKTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQ  398 (423)
Q Consensus       322 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~---~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~i~~~~~~~  398 (423)
                      +.+|+.|+.+.++.|..++|+++..+..   ....|+.+.+.+|+.+++..++.+. .|++|+.+++.+|..++..++..
T Consensus       368 s~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l~-~c~~Leri~l~~~q~vtk~~i~~  446 (483)
T KOG4341|consen  368 SRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHLS-ICRNLERIELIDCQDVTKEAISR  446 (483)
T ss_pred             ccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHHHh-hCcccceeeeechhhhhhhhhHH
Confidence            8899999999999999899988766643   4578889999999999988888777 59999999999999999999999


Q ss_pred             HHhcCCCCCEEeccC
Q 014524          399 LGSFCLRLEEIDLTD  413 (423)
Q Consensus       399 l~~~~~~L~~L~l~~  413 (423)
                      +...+|++++..+-.
T Consensus       447 ~~~~lp~i~v~a~~a  461 (483)
T KOG4341|consen  447 FATHLPNIKVHAYFA  461 (483)
T ss_pred             HHhhCccceehhhcc
Confidence            998899888766543

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00256 FBOX A Receptor for Ubiquitination Targets	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional	Back alignment and domain information

>KOG2997 consensus F-box protein FBX9 [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13013 F-box-like_2: F-box-like domain	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		423
1fs2_A		272	Insights Into Scf Ubiquitin Ligases From The Struct		4e-04
1fqv_A		336	Insights Into Scf Ubiquitin Ligases From The Struct		4e-04

>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272

Back alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 3/113 (2%) Query: 303 LEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCC 362 L+ ++++G R+SD T++ N +LV + LS C G + + L+S C L ++L+ C Sbjct: 82 LQNLSLEGLRLSDPIVNTLAKN-SNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWC 140 Query: 363 HSITDDAIS-AIADSCRGLVCLKIESCNMITEKG-LYQLGSFCLRLEEIDLTD 413 T+ + A+A + L + +K L L C L +DL+D Sbjct: 141 FDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSD 193

PyMOL of 1fs2

>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		423
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-49
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-36
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-27
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-46
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-38
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-30
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-12
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-08
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	6e-28
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-26
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	9e-23
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-20
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	8e-13
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	6e-12
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	4e-08
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	6e-08
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-07
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	1e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	6e-12
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	1e-07
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-07
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-06
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	8e-06
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	3e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-04

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

 Score =  175 bits (445), Expect = 2e-49
 Identities = 82/431 (19%), Positives = 158/431 (36%), Gaps = 70/431 (16%)

Query: 10  LTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFI--LLDKYPYI 67
             E++L  V   I  + D  +  LVCK +  ++   R  + +     +    ++ ++P +
Sbjct: 9   FPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKV 68

Query: 68  KTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARACPLLESV 127
           ++++L   P   D                   +L+     G  Y  +E ++ +   LE +
Sbjct: 69  RSVELKGKPHFAD------------------FNLVPDGWGGYVYPWIEAMSSSYTWLEEI 110

Query: 128 DLSYCCGFGDREAAALSFASGLKEVKLDKCLNVTDVGLAKIAVRCVNLERLSLKWCMEIS 187
            L                              VTD  L  IA    N + L L  C   S
Sbjct: 111 RLKRMV--------------------------VTDDCLELIAKSFKNFKVLVLSSCEGFS 144

Query: 188 DLGIDLLCKKCLDLKSLDVSYLKLTNDSFCSIATLAK----LESLVMVGCPC-VDDTGLR 242
             G+  +   C +LK LD+    + + S   ++        L SL +      V  + L 
Sbjct: 145 TDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALE 204

Query: 243 FLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTLLHHM----R 298
            L + CP LK++ ++R   V    L ++++    L +L  G   +E+   +   +     
Sbjct: 205 RLVTRCPNLKSLKLNRA--VPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALS 262

Query: 299 DLKNLEAITMDGARISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTID 358
             K L  ++        +    +   C  L  + LS    V +  + +L+  C  L+ + 
Sbjct: 263 GCKELRCLSGFW-DAVPAYLPAVYSVCSRLTTLNLSYA-TVQSYDLVKLLCQCPKLQRLW 320

Query: 359 LTCCHSITDDAISAIADSCRGLVCLKI--------ESCNMITEKGLYQLGSFCLRLEEID 410
           +     I D  +  +A +C+ L  L++        E    +TE+GL  +   C +LE + 
Sbjct: 321 V--LDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESV- 377

Query: 411 LTDCNGVNDKG 421
           L  C  + +  
Sbjct: 378 LYFCRQMTNAA 388

PyMOL of 2p1m

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		423
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	100.0
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	100.0
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	100.0
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.97
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.97
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.96
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.95
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.89
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.87
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.86
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.86
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.84
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.84
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.83
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.83
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.82
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.81
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.81
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.81
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.81
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.8
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.79
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.79
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.79
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.78
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.78
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.77
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.77
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.77
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.77
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.76
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.76
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.76
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.76
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.75
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.75
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.74
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.73
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.73
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.73
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.73
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.73
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.72
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.72
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.72
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.71
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.7
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.69
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.67
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.66
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.66
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.66
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.63
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.62
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.61
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.61
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.6
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.59
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.59
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.58
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.58
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.57
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.56
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.56
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.56
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.55
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.54
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.54
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.54
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.54
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.53
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.53
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.52
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.5
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.48
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.46
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.45
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.45
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.44
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.44
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.44
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.43
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.42
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.42
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.41
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.4
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.36
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.33
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.29
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.28
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.26
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.25
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.25
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.24
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.23
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.22
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.22
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.2
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.19
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.18
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.17
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.15
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	99.13
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.12
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.09
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.06
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.03
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	99.03
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.99
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.98
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.97
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.93
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.91
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	98.91
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.84
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.84
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.82
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.82
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.77
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.75
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.75
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.72
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.68
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.67
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.64
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.64
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.64
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.63
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.63
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.62
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.59
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.59
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.58
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.55
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.55
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.54
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.51
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.42
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.41
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.23
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.08
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.07
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.05
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.01
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.0
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	97.98
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.97
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.96
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.86
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	97.84
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.82
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.73
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.67
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.56
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	97.44
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.38
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	97.36
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	97.35
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.34
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	97.33
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.28
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.15
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	97.14
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	97.11
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	96.47
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	96.26
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	91.57
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	88.5

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

Probab=100.00  E-value=2.8e-40  Score=315.51  Aligned_cols=396  Identities=20%  Similarity=0.317  Sum_probs=209.5

Q ss_pred             CCCccccchHHHHHHHHHhcCCcchhhHHHHHHHHHHHHHhhhccccccch--H--------------------------
Q 014524            3 GSSALDVLTEDLLVRVREKIGDELDSKTWRLVCKEFSRVDSVTRTTLRVLR--V--------------------------   54 (423)
Q Consensus         3 ~~~~~~~LP~eil~~If~~L~~~~d~~~~~~vcr~w~~~~~~~~~~~~~~~--~--------------------------   54 (423)
                      ..+.|+.||+|++.+||+||+..+|+.++++|||+|+++....+..+....  .                          
T Consensus         2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~   81 (594)
T 2p1m_B            2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFAD   81 (594)
T ss_dssp             --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSCHHHHHHHCTTCCEEEEECSCGGGG
T ss_pred             cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccCHHHHHhhCCCceEEeccCCCchhh
Confidence            357899999999999999999889999999999999998544332221111  0                          


Q ss_pred             -------------HHHHHHhhcCCCcceEeecCCCCCChhHHHHHhhhcccccCCCccEEEeccCCCCchhHHHHHHHhC
Q 014524           55 -------------EFLFILLDKYPYIKTLDLSVCPRVNDGTVSFLLSQLSLSWTRSLKSLILSRSTGLRYRGLEMLARAC  121 (423)
Q Consensus        55 -------------~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~l~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~  121 (423)
                                   ..+..+...+++|++|+++++. +++..+..+     ...+++|++|++.+|..++...+..+...+
T Consensus        82 ~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~-~~~~~~~~l-----~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~  155 (594)
T 2p1m_B           82 FNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMV-VTDDCLELI-----AKSFKNFKVLVLSSCEGFSTDGLAAIAATC  155 (594)
T ss_dssp             GTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCB-CCHHHHHHH-----HHHCTTCCEEEEESCEEEEHHHHHHHHHHC
T ss_pred             cccccccccchhhHHHHHHHHhCCCCCeEEeeCcE-EcHHHHHHH-----HHhCCCCcEEeCCCcCCCCHHHHHHHHHhC
Confidence                         1123333444555555555432 444444444     223556666666665545555555555556


Q ss_pred             CCccEEEccCcCCCChHHHHHhh----cCCCCcEEecCCCC-CCChHHHHHHHHhCccccccccccccccchhhHHHHHh
Q 014524          122 PLLESVDLSYCCGFGDREAAALS----FASGLKEVKLDKCL-NVTDVGLAKIAVRCVNLERLSLKWCMEISDLGIDLLCK  196 (423)
Q Consensus       122 ~~L~~L~l~~~~~~~~~~~~~l~----~~~~L~~L~l~~~~-~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~  196 (423)
                      ++|++|+++++. +++.+...+.    .+++|++|+++++. .++...+..+...+++|++|++.++..+..  +..+..
T Consensus       156 ~~L~~L~L~~~~-i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~--l~~~~~  232 (594)
T 2p1m_B          156 RNLKELDLRESD-VDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEK--LATLLQ  232 (594)
T ss_dssp             TTCCEEECTTCE-EECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCTTSCHHH--HHHHHH
T ss_pred             CCCCEEeCcCCc-cCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCCCCcHHH--HHHHHh
Confidence            666666666543 2222211121    35567777776653 355666777777788888888887632221  222223


Q ss_pred             cC------------------------------------------------------CCCcEEeccCcccChhHHHHh-hc
Q 014524          197 KC------------------------------------------------------LDLKSLDVSYLKLTNDSFCSI-AT  221 (423)
Q Consensus       197 ~~------------------------------------------------------~~L~~L~l~~~~~~~~~~~~~-~~  221 (423)
                      .+                                                      ++|++|++++|.+.+..+..+ ..
T Consensus       233 ~~~~L~~L~l~~~~~~~~~~~~~~l~~~l~~~~~L~~Ls~~~~~~~~~l~~~~~~~~~L~~L~L~~~~l~~~~l~~~~~~  312 (594)
T 2p1m_B          233 RAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQ  312 (594)
T ss_dssp             HCTTCSEEECSBCCCCCCHHHHHHHHHHHHTCTTCCEEECCBTCCGGGGGGGHHHHTTCCEEECTTCCCCHHHHHHHHTT
T ss_pred             cCCcceEcccccccCccchhhHHHHHHHHhcCCCcccccCCcccchhhHHHHHHhhCCCCEEEccCCCCCHHHHHHHHhc
Confidence            33                                                      344444444444433333332 23


Q ss_pred             cCCccEEEecCCCCCCchhHHHHHhcCCCCceEec--------CCCcccCcchHHHHHHhCCCCceeccCCCcccchHHH
Q 014524          222 LAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFV--------SRCKFVSSTGLISVIRGHSGLLQLDAGHCFSELSTTL  293 (423)
Q Consensus       222 ~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l--------~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~  293 (423)
                      +++|++|++.++  +.+..+..+...+++|++|++        ..+..+++.++..+...+++|+.|.+..+.  +++..
T Consensus       313 ~~~L~~L~l~~~--~~~~~l~~l~~~~~~L~~L~L~~~~~~g~~~~~~l~~~~l~~l~~~~~~L~~L~~~~~~--l~~~~  388 (594)
T 2p1m_B          313 CPKLQRLWVLDY--IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQ--MTNAA  388 (594)
T ss_dssp             CTTCCEEEEEGG--GHHHHHHHHHHHCTTCCEEEEECSCTTCSSCSSCCCHHHHHHHHHHCTTCCEEEEEESC--CCHHH
T ss_pred             CCCcCEEeCcCc--cCHHHHHHHHHhCCCCCEEEEecCcccccccCCCCCHHHHHHHHHhchhHHHHHHhcCC--cCHHH
Confidence            444555544443  233334444444455555555        223344444444444445555555332222  44444


Q ss_pred             HHHhh-cCCcccEEEcc--C----ccCC----hhhHHHHHhcCCCccEEeeccCCCCChHHHHHHHhcCCCCcEEecCCC
Q 014524          294 LHHMR-DLKNLEAITMD--G----ARIS----DSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCC  362 (423)
Q Consensus       294 ~~~~~-~~~~L~~L~l~--~----~~~~----~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~  362 (423)
                      ...+. .+++|+.|++.  +    +.++    +.++..+...+++|++|++++  .+++.++..+...+++|+.|++++|
T Consensus       389 ~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~l~~~~~~L~~L~L~~--~l~~~~~~~l~~~~~~L~~L~L~~~  466 (594)
T 2p1m_B          389 LITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSG--LLTDKVFEYIGTYAKKMEMLSVAFA  466 (594)
T ss_dssp             HHHHHHHCTTCCEEEEEESSTTCCCTTTCCCTHHHHHHHHHHCTTCCEEECCS--SCCHHHHHHHHHHCTTCCEEEEESC
T ss_pred             HHHHHhhCCCcceeEeecccCCCcccccCCchhhHHHHHHhhCCCccEEeecC--cccHHHHHHHHHhchhccEeeccCC
Confidence            44433 35555555555  2    2344    344444444555566666544  3555555555545666666666654


Q ss_pred             CCCCHHHHHHHHhhCCCccEEEeccCCCCCHHHHHHHHhcCCCCCEEeccCCC
Q 014524          363 HSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCN  415 (423)
Q Consensus       363 ~~l~~~~~~~~~~~~~~L~~L~l~~c~~i~~~~~~~l~~~~~~L~~L~l~~c~  415 (423)
                       .+++.++..+...+++|+.|++++|. +++.++..+...+++|+.|++++|.
T Consensus       467 -~i~~~~~~~l~~~~~~L~~L~L~~n~-~~~~~~~~~~~~l~~L~~L~l~~~~  517 (594)
T 2p1m_B          467 -GDSDLGMHHVLSGCDSLRKLEIRDCP-FGDKALLANASKLETMRSLWMSSCS  517 (594)
T ss_dssp             -CSSHHHHHHHHHHCTTCCEEEEESCS-CCHHHHHHTGGGGGGSSEEEEESSC
T ss_pred             -CCcHHHHHHHHhcCCCcCEEECcCCC-CcHHHHHHHHHhCCCCCEEeeeCCC
Confidence             35666666655556666666666666 4666665555556666666666653

PyMOL of 2p1m

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		423
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.004
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-04

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 41.9 bits (96), Expect = 1e-04
 Identities = 12/96 (12%), Positives = 37/96 (38%), Gaps = 10/96 (10%)

Query: 327 SLVEIGLSKCLGVTNTGITQLVSGCVNLKTIDLTCCHSITDDAISAIAD---SCRGLVCL 383
            +  + +  C  +++    +L+      + + L  C  +T+     I+        L  L
Sbjct: 3   DIQSLDIQ-CEELSDARWAELLPLLQQCQVVRLDDC-GLTEARCKDISSALRVNPALAEL 60

Query: 384 KIESCNMITEKGLYQLGSF----CLRLEEIDLTDCN 415
            +   N + + G++ +         +++++ L +C 
Sbjct: 61  NL-RSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCC 95

PyMOL of d1z7xw1

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		423
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.93
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.9
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.86
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.82
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.73
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.69
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.54
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.5
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.32
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.25
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	99.22
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.2
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.18
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.17
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.13
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.12
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.07
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.04
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.04
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.0
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.0
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.92
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.91
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.78
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.72
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.7
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	98.69
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.66
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.66
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.62
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.58
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.57
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.52
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.51
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.5
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.44
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.43
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.36
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.35
d1p22a1		118	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	98.33
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.02
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.98
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.3
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.28
d2ifga3		156	High affinity nerve growth factor receptor, N-term	97.01
d2ifga3		156	High affinity nerve growth factor receptor, N-term	96.88

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=3.6e-25  Score=187.39  Aligned_cols=209  Identities=18%  Similarity=0.304  Sum_probs=133.0

Q ss_pred             CCcEEeccCcccChhHHHHh-hccCCccEEEecCCCCCCchhHHHHHhcCCCCceEecCCCcccCcchHHHHHHhCCCCc
Q 014524          200 DLKSLDVSYLKLTNDSFCSI-ATLAKLESLVMVGCPCVDDTGLRFLESGCPLLKTIFVSRCKFVSSTGLISVIRGHSGLL  278 (423)
Q Consensus       200 ~L~~L~l~~~~~~~~~~~~~-~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~  278 (423)
                      +|++|+++++.+.+..+..+ ..+++|++|.+.+| .+++..+..+.. +++|++|++++|..+++.++..+...+++|+
T Consensus        47 ~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~  124 (284)
T d2astb2          47 RVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLD  124 (284)
T ss_dssp             CCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCTTCC
T ss_pred             CCCEEECCCCccCHHHHHHHHHhCCCccccccccc-CCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHHhcc
Confidence            55555555555554444333 23555555555554 344444444443 5556666665555555555555555556666


Q ss_pred             eeccCCCcccchHHHHH-Hhhc-CCcccEEEccCc--cCChhhHHHHHhcCCCccEEeeccCCCCChHHHHHHHhcCCCC
Q 014524          279 QLDAGHCFSELSTTLLH-HMRD-LKNLEAITMDGA--RISDSCFQTISFNCKSLVEIGLSKCLGVTNTGITQLVSGCVNL  354 (423)
Q Consensus       279 ~L~l~~~~~~~~~~~~~-~~~~-~~~L~~L~l~~~--~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L  354 (423)
                      +|++++|.. +++.... .+.. +++|+.|++.++  .+++.++..+...+|+|++|++++|..+++.++..+. .+++|
T Consensus       125 ~L~ls~c~~-~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L  202 (284)
T d2astb2         125 ELNLSWCFD-FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYL  202 (284)
T ss_dssp             EEECCCCTT-CCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTC
T ss_pred             ccccccccc-cccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcC
Confidence            666665554 4443332 2322 456666666654  3677777777778888888888888778877776665 67888


Q ss_pred             cEEecCCCCCCCHHHHHHHHhhCCCccEEEeccCCCCCHHHHHHHHhcCCCCCEEeccCCCCCCC
Q 014524          355 KTIDLTCCHSITDDAISAIADSCRGLVCLKIESCNMITEKGLYQLGSFCLRLEEIDLTDCNGVND  419 (423)
Q Consensus       355 ~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~i~~~~~~~l~~~~~~L~~L~l~~c~~i~~  419 (423)
                      ++|++++|..+++.++..+. .+|+|+.|++.+|  +++.++..+...+|+|+.    +|+.+++
T Consensus       203 ~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~i----~~~~ls~  260 (284)
T d2astb2         203 QHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQI----NCSHFTT  260 (284)
T ss_dssp             CEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSEE----SCCCSCC
T ss_pred             CEEECCCCCCCChHHHHHHh-cCCCCCEEeeeCC--CCHHHHHHHHHhCccccc----cCccCCC
Confidence            88888888888888777765 4788888888887  677777777777888763    3455554

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure