Citrus Sinensis ID: 014539

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MVRTAACNYLIPALTLLPKPMESSLFTRNANLIGVLGITTTSSRRRFSSASKISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKDAEKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
ccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccEEccccccHHHHHHHHHHccccccccccccccccccEEEccccHHHHHHHHHcccccEEcEEEEEEEEccccccccccccccHHHHHcccccccEEEEEEEEccccEEEEccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHHHHHHccccEEEEEHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccEEEEccccccccccccccccccccccEEEEEEccHHHHHHHccHHHHHHHcccccccccEEEccccEEEEEccc
cccHHHHHHHHHHHcccccccHHHcccccHHHcccccccccccccccccHHHEEEEEEEcEEccccccHHHHHHHHHHHHHHHHccccccEEcccccEEEcccHHHHHHHHHHccccEEEEEEEEEEHHHHcccccccccccHHHHHHHHHHcEEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccHccccEEEEEEccccccccccccHHHHHHHHHHHHcccEEEEEEHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHccHHEEcccccEEEEEEEccccccccccEEEEccccccEEEEEEEEHHHHHHcccHHHHHHcccEEEcccEEEEEcccEEEEEEcc
MVRTAACNYlipaltllpkpmesslftrNANLIGVLGitttssrrrfssASKISMSLRAGivglpnvgksTLFNAVVEngkaqaanfpfctiepnvgivavpdprlhvlsglsksqkavpasvefVDIAGlvkgasqgeglgnKFLSHIREVDSILQVVRcfedndivhvngkvdpksdvdvinLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKDAEKAALEKIQQALmdgkparsvtlndfeRDSIKQLCLLTMKPIIYVAnvaesdladpgsnphvNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLgvsesglgNLIRSTYSLLGLRTYFTSGEKETKAWTiragmtapqaagvihsdfeKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
mvrtaacnYLIPALTLLPKPMESSLFTRNANLIGVlgitttssrrrFSSASKISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVhvngkvdpksdvdvINLELVFSDLDQIEKRMEKlkkgkakdsqsklKDAEKAALEKIQqalmdgkparsvtlndfERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAeltelpseERVEYLASlgvsesglgnLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAArekgllrsegkdyivqegdVMLFRFNV
MVRTAACNYLIPALTLLPKPMESSLFTRNANLIGVLGItttssrrrfssasKISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSklkdaekaalekIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
****AACNYLIPALTLLPKPMESSLFTRNANLIGVLGITTT***********ISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLD*********************************************TLNDFERDSIKQLCLLTMKPIIYVANVAE*********************************************VEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRF**
**********IPALTLLPKPMESSLFTRNANLIGVLGIT**************SMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEK********************EKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
MVRTAACNYLIPALTLLPKPMESSLFTRNANLIGVLGITTTSSRRRFSSASKISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRM*******************KAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
*VRTAACNYLIPALTLLPKPMESSLFTRNANLIGVLGITTTSSRRRFSSASKISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKDAEKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRTAACNYLIPALTLLPKPMESSLFTRNANLIGVLGITTTSSRRRFSSASKISMSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKDAEKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query423 2.2.26 [Sep-21-2011]
P37518366 GTP-dependent nucleic aci yes no 0.858 0.991 0.559 1e-119
P44681363 GTP-dependent nucleic aci yes no 0.855 0.997 0.529 1e-109
Q7VMI2363 GTP-dependent nucleic aci yes no 0.855 0.997 0.532 1e-109
Q9CP90363 GTP-dependent nucleic aci yes no 0.855 0.997 0.521 1e-108
P0ABU4363 GTP-dependent nucleic aci yes no 0.855 0.997 0.524 1e-107
P0ABU2363 GTP-dependent nucleic aci N/A no 0.855 0.997 0.524 1e-107
P0ABU3363 GTP-dependent nucleic aci N/A no 0.855 0.997 0.524 1e-107
P47270367 Probable GTP-binding prot yes no 0.855 0.986 0.481 1e-88
Q8K9V2362 GTP-dependent nucleic aci yes no 0.848 0.991 0.443 1e-85
P57288362 GTP-dependent nucleic aci yes no 0.848 0.991 0.443 2e-84
>sp|P37518|ENGD_BACSU GTP-dependent nucleic acid-binding protein EngD OS=Bacillus subtilis (strain 168) GN=engD PE=3 SV=1 Back     alignment and function desciption
 Score =  429 bits (1102), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/372 (55%), Positives = 279/372 (75%), Gaps = 9/372 (2%)

Query: 55  MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSK 114
           M+L AGIVGLPNVGKSTLFNA+ + G A++AN+PFCTI+PNVGIV VPD RL  L+ L  
Sbjct: 1   MALTAGIVGLPNVGKSTLFNAITQAG-AESANYPFCTIDPNVGIVEVPDDRLQKLTELVN 59

Query: 115 SQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKV 174
            +K VP + EF DIAG+VKGAS+GEGLGNKFLSHIR+VD+I  VVR F D++I HV+GKV
Sbjct: 60  PKKTVPTAFEFTDIAGIVKGASKGEGLGNKFLSHIRQVDAICHVVRAFSDDNITHVSGKV 119

Query: 175 DPKSDVDVINLELVFSDLDQIEKRMEKLKK-GKAKDSQSKLKDA--EKAALEKIQQALMD 231
           DP  D++ INLEL+ +D++ +EKR+ ++ K  K KD     KDA  E   L K+++A   
Sbjct: 120 DPIDDIETINLELILADMETVEKRITRVSKLAKQKD-----KDAVFEFEILSKLKEAFES 174

Query: 232 GKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQS 291
            KPARSV   + ++  +KQL LLT KPI+YVANV+E ++ADP  N +V ++   A+   +
Sbjct: 175 EKPARSVEFTEEQQKLVKQLHLLTSKPILYVANVSEDEVADPSGNENVAKIREYAAGENA 234

Query: 292 GRVTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETK 351
             + + A++E+E+ EL  EE+  +L  LG+ ESGL  LI+++YSLLGL TYFT+GE+E +
Sbjct: 235 EVIVVCAKIESEIAELEGEEKQMFLEELGIQESGLDQLIKASYSLLGLATYFTAGEQEVR 294

Query: 352 AWTIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIV 411
           AWT + GM AP+ AG+IHSDFE+GFIRAETVAY+D +A G +A A+E G +R EGK+Y+V
Sbjct: 295 AWTFKKGMKAPECAGIIHSDFERGFIRAETVAYEDLLAGGGMAGAKEAGKVRLEGKEYVV 354

Query: 412 QEGDVMLFRFNV 423
           Q+GDV+ FRFNV
Sbjct: 355 QDGDVIHFRFNV 366
GTP-dependent nucleic acid-binding protein which may act as a translation factor.
Bacillus subtilis (strain 168) (taxid: 224308)
>sp|P44681|ENGD_HAEIN GTP-dependent nucleic acid-binding protein EngD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=engD PE=1 SV=2 Back     alignment and function description
>sp|Q7VMI2|ENGD_HAEDU GTP-dependent nucleic acid-binding protein EngD OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=engD PE=3 SV=3 Back     alignment and function description
>sp|Q9CP90|ENGD_PASMU GTP-dependent nucleic acid-binding protein EngD OS=Pasteurella multocida (strain Pm70) GN=engD PE=3 SV=3 Back     alignment and function description
>sp|P0ABU4|ENGD_SHIFL GTP-dependent nucleic acid-binding protein EngD OS=Shigella flexneri GN=engD PE=3 SV=2 Back     alignment and function description
>sp|P0ABU2|ENGD_ECOLI GTP-dependent nucleic acid-binding protein EngD OS=Escherichia coli (strain K12) GN=engD PE=1 SV=2 Back     alignment and function description
>sp|P0ABU3|ENGD_ECO57 GTP-dependent nucleic acid-binding protein EngD OS=Escherichia coli O157:H7 GN=engD PE=3 SV=2 Back     alignment and function description
>sp|P47270|Y024_MYCGE Probable GTP-binding protein MG024 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG024 PE=3 SV=1 Back     alignment and function description
>sp|Q8K9V2|ENGD_BUCAP GTP-dependent nucleic acid-binding protein EngD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=engD PE=3 SV=3 Back     alignment and function description
>sp|P57288|ENGD_BUCAI GTP-dependent nucleic acid-binding protein EngD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=engD PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
255544712417 GTP-binding protein, putative [Ricinus c 0.983 0.997 0.839 0.0
225462191422 PREDICTED: GTP-dependent nucleic acid-bi 0.990 0.992 0.842 0.0
296082781370 unnamed protein product [Vitis vinifera] 0.872 0.997 0.924 0.0
449453790421 PREDICTED: GTP-dependent nucleic acid-bi 0.978 0.983 0.825 0.0
356526427420 PREDICTED: GTP-dependent nucleic acid-bi 0.966 0.973 0.805 0.0
224056743370 predicted protein [Populus trichocarpa] 0.872 0.997 0.886 0.0
42562778421 putative GTP-binding protein [Arabidopsi 0.976 0.980 0.785 0.0
297847982421 hypothetical protein ARALYDRAFT_474672 [ 0.976 0.980 0.790 0.0
6056379419 Similar to GTP-binding protein [Arabidop 0.973 0.983 0.784 0.0
388499262424 unknown [Lotus japonicus] 0.990 0.988 0.792 0.0
>gi|255544712|ref|XP_002513417.1| GTP-binding protein, putative [Ricinus communis] gi|223547325|gb|EEF48820.1| GTP-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/424 (83%), Positives = 381/424 (89%), Gaps = 8/424 (1%)

Query: 1   MVRTAACNYLIPALTLLPKPMESSLFTRNANLIGVLGITTTSSRRRFSSASKISMSLRAG 60
           M R  A + LIP L+       SS   RN  L         +S RRFSS+ KISMSL+AG
Sbjct: 1   MARVVARSTLIPTLS-------SSFICRNPYLFTKTSQFINNSNRRFSSSFKISMSLKAG 53

Query: 61  IVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVP 120
           IVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVG VAVPDPRLHVLSGLSKSQ+AVP
Sbjct: 54  IVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGTVAVPDPRLHVLSGLSKSQRAVP 113

Query: 121 ASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDV 180
           AS+EFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHV+GKVDPKSD+
Sbjct: 114 ASIEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVSGKVDPKSDI 173

Query: 181 DVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKD-AEKAALEKIQQALMDGKPARSVT 239
           DVINLELVFSDLDQIEKR+EKLKKGKAKDSQSKLK+ AEK+ALE+IQ ALMDGKPARSV 
Sbjct: 174 DVINLELVFSDLDQIEKRLEKLKKGKAKDSQSKLKEEAEKSALERIQGALMDGKPARSVA 233

Query: 240 LNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVTISAQ 299
           L+DFE+D+IK LCLLTMKP+IYVANVAESDLA P +NPHV EVMNLASDLQSG V +SAQ
Sbjct: 234 LSDFEKDAIKHLCLLTMKPVIYVANVAESDLAVPDNNPHVKEVMNLASDLQSGLVAVSAQ 293

Query: 300 VEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGM 359
           VE+ELTELP +ER EYL SLGVSESGLGNLIR+TY+LLGLRTYFTSGEKETKAWTI AGM
Sbjct: 294 VESELTELPVDERTEYLKSLGVSESGLGNLIRATYNLLGLRTYFTSGEKETKAWTILAGM 353

Query: 360 TAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLF 419
           TAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKG+LRSEGKDY+VQEGDVMLF
Sbjct: 354 TAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGVLRSEGKDYVVQEGDVMLF 413

Query: 420 RFNV 423
           RFNV
Sbjct: 414 RFNV 417

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225462191|ref|XP_002269074.1| PREDICTED: GTP-dependent nucleic acid-binding protein engD-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082781|emb|CBI21786.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453790|ref|XP_004144639.1| PREDICTED: GTP-dependent nucleic acid-binding protein EngD-like [Cucumis sativus] gi|449523505|ref|XP_004168764.1| PREDICTED: GTP-dependent nucleic acid-binding protein EngD-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356526427|ref|XP_003531819.1| PREDICTED: GTP-dependent nucleic acid-binding protein engD [Glycine max] Back     alignment and taxonomy information
>gi|224056743|ref|XP_002299001.1| predicted protein [Populus trichocarpa] gi|222846259|gb|EEE83806.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42562778|ref|NP_176001.2| putative GTP-binding protein [Arabidopsis thaliana] gi|332195215|gb|AEE33336.1| putative GTP-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847982|ref|XP_002891872.1| hypothetical protein ARALYDRAFT_474672 [Arabidopsis lyrata subsp. lyrata] gi|297337714|gb|EFH68131.1| hypothetical protein ARALYDRAFT_474672 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6056379|gb|AAF02843.1|AC009894_14 Similar to GTP-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388499262|gb|AFK37697.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
TAIR|locus:2205255421 AT1G56050 [Arabidopsis thalian 0.983 0.988 0.754 2.7e-162
UNIPROTKB|Q81JI1366 ychF "GTP-binding protein YchF 0.862 0.997 0.551 2.5e-106
TIGR_CMR|BA_5724366 BA_5724 "GTP-binding protein Y 0.862 0.997 0.551 2.5e-106
UNIPROTKB|Q71VY1366 ychF "GTP-binding protein YchF 0.858 0.991 0.540 9.8e-103
UNIPROTKB|Q74FE5364 ychF "GTP-dependent translatio 0.860 1.0 0.552 9.8e-103
TIGR_CMR|GSU_0664364 GSU_0664 "GTP binding protein 0.860 1.0 0.552 9.8e-103
UNIPROTKB|Q5LV85365 ychF "GTP-binding protein YchF 0.853 0.989 0.536 4.4e-100
TIGR_CMR|SPO_0817365 SPO_0817 "GTP-binding protein 0.853 0.989 0.536 4.4e-100
UNIPROTKB|Q3AG31362 ychF "GTP-binding protein YchF 0.855 1.0 0.520 1.7e-98
TIGR_CMR|CHY_0031362 CHY_0031 "GTP-binding protein 0.855 1.0 0.520 1.7e-98
TAIR|locus:2205255 AT1G56050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1580 (561.2 bits), Expect = 2.7e-162, P = 2.7e-162
 Identities = 323/428 (75%), Positives = 360/428 (84%)

Query:     1 MVRTAACNYLIPALTLLP-KPM---ESSLFTRNANLIGVLGIXXXXXXXXXXXXXKISMS 56
             M R AAC+ ++ A+ LLP K +      LF+ N+  +GVL +             K+SMS
Sbjct:     1 MAR-AACSSVVTAMALLPSKSLLCRNQLLFSGNSKFVGVLTLQKRCFSS------KVSMS 53

Query:    57 LRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQ 116
             L+AGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPD RL VLS LS SQ
Sbjct:    54 LKAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDSRLQVLSKLSGSQ 113

Query:   117 KAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDP 176
             K VPAS+EFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDI+HVNGKVDP
Sbjct:   114 KTVPASIEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIIHVNGKVDP 173

Query:   177 KSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSXXXXXXXXXXXX-IQQALMDGKPA 235
             KSD+DVINLEL+F DLDQI KR+E+LKKGKAKDSQS             IQ+AL++GKPA
Sbjct:   174 KSDIDVINLELIFCDLDQIGKRIERLKKGKAKDSQSKVKEEAEKSALERIQEALLEGKPA 233

Query:   236 RSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRVT 295
             RSV L+D E + +K LCLLTMKP+IYVANVAE+DLA+P  N +V EV  L+SDLQSG V 
Sbjct:   234 RSVALSDLEMEVVKHLCLLTMKPMIYVANVAETDLAEPEKNAYVEEVKGLSSDLQSGHVV 293

Query:   296 ISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTI 355
             +SAQVE+ELTELP EER EYL SLGVSESGLGNLIR+TYSLLGL+TYFTSGEKET+AWTI
Sbjct:   294 VSAQVESELTELPLEERTEYLNSLGVSESGLGNLIRATYSLLGLQTYFTSGEKETRAWTI 353

Query:   356 RAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGD 415
              AGMTAPQAAGVIHSDFEKGFIRAETVAY+DFV AGS+AAAREKGLLRSEGK+YIV+EGD
Sbjct:   354 HAGMTAPQAAGVIHSDFEKGFIRAETVAYEDFVTAGSIAAAREKGLLRSEGKEYIVKEGD 413

Query:   416 VMLFRFNV 423
             VMLFRFNV
Sbjct:   414 VMLFRFNV 421
GO:0005525 "GTP binding" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006783 "heme biosynthetic process" evidence=RCA
UNIPROTKB|Q81JI1 ychF "GTP-binding protein YchF" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5724 BA_5724 "GTP-binding protein YchF" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q71VY1 ychF "GTP-binding protein YchF" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|Q74FE5 ychF "GTP-dependent translational factor YchF, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0664 GSU_0664 "GTP binding protein YchF" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LV85 ychF "GTP-binding protein YchF" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0817 SPO_0817 "GTP-binding protein YchF" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AG31 ychF "GTP-binding protein YchF" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0031 CHY_0031 "GTP-binding protein YchF" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NTK5OLA1_HUMAN3, ., 6, ., 3, ., -0.43460.86760.9267yesno
Q5ZM25OLA1_CHICK3, ., 6, ., 3, ., -0.4320.86760.9267yesno
A0JPJ7OLA1_RAT3, ., 6, ., 3, ., -0.43880.86990.9292yesno
Q7ZU42OLA1_DANRE3, ., 6, ., 3, ., -0.41750.86990.9292yesno
P37518ENGD_BACSUNo assigned EC number0.55910.85810.9918yesno
Q89AR6ENGD_BUCBPNo assigned EC number0.39940.83680.9752yesno
Q8SWU7Y1354_DROMENo assigned EC number0.42810.86280.9193yesno
Q5R821OLA1_PONAB3, ., 6, ., 3, ., -0.43460.86760.9267yesno
Q8K9V2ENGD_BUCAPNo assigned EC number0.44350.84860.9917yesno
P38219OLA1_YEASTNo assigned EC number0.40970.85810.9213yesno
Q9CZ30OLA1_MOUSE3, ., 6, ., 3, ., -0.43460.86760.9267yesno
P47270Y024_MYCGENo assigned EC number0.48100.85570.9863yesno
P44681ENGD_HAEINNo assigned EC number0.52970.85570.9972yesno
P57288ENGD_BUCAINo assigned EC number0.44350.84860.9917yesno
P91917TG210_CAEELNo assigned EC number0.42090.86760.9291yesno
Q2HJ33OLA1_BOVIN3, ., 6, ., 3, ., -0.4320.86760.9267yesno
P75088Y026_MYCPNNo assigned EC number0.45190.81790.9558yesno
O13998YEI3_SCHPONo assigned EC number0.40970.85810.9260yesno
P0ABU4ENGD_SHIFLNo assigned EC number0.52430.85570.9972yesno
Q9CP90ENGD_PASMUNo assigned EC number0.52160.85570.9972yesno
Q7VMI2ENGD_HAEDUNo assigned EC number0.53240.85570.9972yesno
P0ABU2ENGD_ECOLINo assigned EC number0.52430.85570.9972N/Ano
P0ABU3ENGD_ECO57No assigned EC number0.52430.85570.9972N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 0.0
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 0.0
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 1e-167
cd01900274 cd01900, YchF, YchF GTPase 1e-151
TIGR00092368 TIGR00092, TIGR00092, GTP-binding protein YchF 1e-133
pfam0607184 pfam06071, YchF-GTPase_C, Protein of unknown funct 3e-55
cd0486783 cd04867, TGS_YchF_C, TGS_YchF_C: This subfamily re 3e-51
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; 2e-35
cd01899318 cd01899, Ygr210, Ygr210 GTPase 5e-33
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 2e-28
cd01898170 cd01898, Obg, Obg GTPase 1e-24
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 2e-22
COG0536369 COG0536, Obg, Predicted GTPase [General function p 8e-22
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 1e-21
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 2e-21
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 4e-21
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 2e-16
PRK12296500 PRK12296, obgE, GTPase CgtA; Reviewed 2e-14
COG1163365 COG1163, DRG, Predicted GTPase [General function p 2e-13
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 3e-13
cd0493876 cd04938, TGS_Obg-like, TGS_Obg-like: The C-termina 2e-08
cd00880161 cd00880, Era_like, E 2e-07
cd0161660 cd01616, TGS, The TGS domain, named after the ThrR 8e-07
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-06
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 5e-06
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 1e-05
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 4e-05
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 6e-05
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 9e-05
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 2e-04
cd04163168 cd04163, Era, E 3e-04
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 3e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 4e-04
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 4e-04
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 5e-04
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 5e-04
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 7e-04
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 8e-04
COG1159298 COG1159, Era, GTPase [General function prediction 0.001
COG2262411 COG2262, HflX, GTPases [General function predictio 0.001
PRK00089292 PRK00089, era, GTPase Era; Reviewed 0.001
TIGR00436270 TIGR00436, era, GTP-binding protein Era 0.002
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 0.003
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 0.004
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information 
 Score =  652 bits (1685), Expect = 0.0
 Identities = 226/369 (61%), Positives = 285/369 (77%), Gaps = 5/369 (1%)

Query: 55  MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSK 114
           M L+ GIVGLPNVGKSTLFNA+ + G A+AAN+PFCTIEPNVG+V VPDPRL  L+ + K
Sbjct: 1   MGLKCGIVGLPNVGKSTLFNALTKAG-AEAANYPFCTIEPNVGVVPVPDPRLDKLAEIVK 59

Query: 115 SQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKV 174
            +K VPA++EFVDIAGLVKGAS+GEGLGN+FL++IREVD+I+ VVRCFED++I HV GKV
Sbjct: 60  PKKIVPATIEFVDIAGLVKGASKGEGLGNQFLANIREVDAIVHVVRCFEDDNITHVEGKV 119

Query: 175 DPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKDAEKAALEKIQQALMDGKP 234
           DP  D++ IN EL+ +DL+ +EKR+E+L+K KAK    + K AE   LEK+ + L +GKP
Sbjct: 120 DPIRDIETINTELILADLETVEKRLERLEK-KAKGGDKEAK-AELELLEKLLEHLEEGKP 177

Query: 235 ARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRV 294
           AR++ L D E   +K L LLT KP++YVANV E DLAD   NP+V +V  +A+   +  V
Sbjct: 178 ARTLELTDEEEKLLKSLQLLTAKPVLYVANVDEDDLAD--GNPYVKKVREIAAKEGAEVV 235

Query: 295 TISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWT 354
            I A++EAE+ EL  EE+ E+L  LG+ ESGL  LIR+ Y LLGL TYFT+G KE +AWT
Sbjct: 236 VICAKIEAEIAELDDEEKAEFLEELGLEESGLDRLIRAGYELLGLITYFTAGPKEVRAWT 295

Query: 355 IRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEG 414
           I+ G TAPQAAGVIH+DFEKGFIRAE ++YDD +  GS A A+E G +R EGKDYIVQ+G
Sbjct: 296 IKKGTTAPQAAGVIHTDFEKGFIRAEVISYDDLIEYGSEAGAKEAGKVRLEGKDYIVQDG 355

Query: 415 DVMLFRFNV 423
           DVM FRFNV
Sbjct: 356 DVMHFRFNV 364

Length = 364
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF Back     alignment and domain information
>gnl|CDD|203386 pfam06071, YchF-GTPase_C, Protein of unknown function (DUF933) Back     alignment and domain information
>gnl|CDD|133440 cd04867, TGS_YchF_C, TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown Back     alignment and domain information
>gnl|CDD|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|206686 cd01899, Ygr210, Ygr210 GTPase Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237045 PRK12296, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|133441 cd04938, TGS_Obg-like, TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|133435 cd01616, TGS, The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 423
PRK09601364 GTP-binding protein YchF; Reviewed 100.0
PTZ00258390 GTP-binding protein; Provisional 100.0
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 100.0
COG0012372 Predicted GTPase, probable translation factor [Tra 100.0
KOG1491391 consensus Predicted GTP-binding protein (ODN super 100.0
PRK09602396 translation-associated GTPase; Reviewed 100.0
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 100.0
COG1163365 DRG Predicted GTPase [General function prediction 100.0
PF0607184 YchF-GTPase_C: Protein of unknown function (DUF933 100.0
cd0486783 TGS_YchF_C TGS_YchF_C: This subfamily represents T 100.0
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 100.0
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 100.0
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 99.97
COG1159298 Era GTPase [General function prediction only] 99.96
COG2262411 HflX GTPases [General function prediction only] 99.93
PRK12296500 obgE GTPase CgtA; Reviewed 99.92
COG0536369 Obg Predicted GTPase [General function prediction 99.92
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.92
PRK12297424 obgE GTPase CgtA; Reviewed 99.91
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.9
cd01896233 DRG The developmentally regulated GTP-binding prot 99.89
PRK12299335 obgE GTPase CgtA; Reviewed 99.89
PRK12298390 obgE GTPase CgtA; Reviewed 99.88
PRK11058426 GTPase HflX; Provisional 99.88
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.87
PRK15494339 era GTPase Era; Provisional 99.87
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.87
COG1160444 Predicted GTPases [General function prediction onl 99.86
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.85
COG0486454 ThdF Predicted GTPase [General function prediction 99.85
cd0493876 TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma 99.84
PRK00089292 era GTPase Era; Reviewed 99.83
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.82
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.79
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.75
COG1160444 Predicted GTPases [General function prediction onl 99.73
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.71
COG1084346 Predicted GTPase [General function prediction only 99.68
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.68
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.67
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.66
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.66
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.65
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.65
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate 99.65
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.63
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.63
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.63
KOG0410410 consensus Predicted GTP binding protein [General f 99.63
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.62
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.62
PRK03003472 GTP-binding protein Der; Reviewed 99.62
PRK03003472 GTP-binding protein Der; Reviewed 99.61
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.6
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.59
PRK00093435 GTP-binding protein Der; Reviewed 99.59
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.59
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.59
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.59
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.59
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.58
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.58
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.58
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma 99.58
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.58
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.58
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.57
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.57
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.56
PRK00093435 GTP-binding protein Der; Reviewed 99.56
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.56
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.56
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.56
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.56
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.56
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.55
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.55
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.54
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.54
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.53
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.53
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.53
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.53
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.52
PLN03118211 Rab family protein; Provisional 99.52
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.52
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.52
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.51
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.5
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.5
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.5
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.5
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.5
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.49
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.49
PLN03108210 Rab family protein; Provisional 99.49
PRK04213201 GTP-binding protein; Provisional 99.49
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.48
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.48
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.48
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.48
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.48
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.47
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.47
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.47
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.47
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.47
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.47
PLN03110216 Rab GTPase; Provisional 99.46
PTZ00369189 Ras-like protein; Provisional 99.46
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.46
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.46
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.46
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.46
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.45
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.45
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.44
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.44
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.44
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.44
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.43
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.43
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.43
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.43
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.43
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.42
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.42
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.42
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.41
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.41
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.41
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.41
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.41
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.41
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.41
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.4
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.4
cd00881189 GTP_translation_factor GTP translation factor fami 99.4
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.4
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.4
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.4
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.4
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.4
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.4
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.39
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.39
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.39
COG0218200 Predicted GTPase [General function prediction only 99.39
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.38
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.38
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.38
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.37
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.37
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.37
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.36
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.36
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.35
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.35
PLN00223181 ADP-ribosylation factor; Provisional 99.35
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.35
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.35
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.34
PRK09866 741 hypothetical protein; Provisional 99.34
PTZ00133182 ADP-ribosylation factor; Provisional 99.34
PRK12317425 elongation factor 1-alpha; Reviewed 99.34
KOG0394210 consensus Ras-related GTPase [General function pre 99.33
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.33
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.32
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.32
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.32
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.32
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.3
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.3
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.3
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.3
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.3
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.3
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.29
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.28
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.28
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.26
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.26
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.25
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.25
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.25
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.24
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.23
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.23
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.22
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.21
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.21
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.21
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.18
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.18
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.18
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.18
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.17
CHL00189 742 infB translation initiation factor 2; Provisional 99.16
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.15
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 99.15
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.15
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.15
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.14
COG1161322 Predicted GTPases [General function prediction onl 99.13
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.13
PRK05306 787 infB translation initiation factor IF-2; Validated 99.12
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.12
CHL00071409 tufA elongation factor Tu 99.12
COG3596296 Predicted GTPase [General function prediction only 99.12
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.11
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.11
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.1
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.1
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.09
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.09
PRK09563287 rbgA GTPase YlqF; Reviewed 99.08
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.08
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.06
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.06
PRK12739 691 elongation factor G; Reviewed 99.05
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.05
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.02
PRK12735396 elongation factor Tu; Reviewed 99.02
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.02
PRK00007 693 elongation factor G; Reviewed 99.01
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.01
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 99.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 98.99
PRK10218 607 GTP-binding protein; Provisional 98.99
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.98
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.98
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.98
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.98
PRK12736394 elongation factor Tu; Reviewed 98.98
PLN03127447 Elongation factor Tu; Provisional 98.98
cd04105203 SR_beta Signal recognition particle receptor, beta 98.97
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.97
PLN00023334 GTP-binding protein; Provisional 98.97
KOG0095213 consensus GTPase Rab30, small G protein superfamil 98.96
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.96
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.95
KOG0091213 consensus GTPase Rab39, small G protein superfamil 98.95
PLN03126478 Elongation factor Tu; Provisional 98.94
KOG0079198 consensus GTP-binding protein H-ray, small G prote 98.94
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.94
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.93
KOG0093193 consensus GTPase Rab3, small G protein superfamily 98.92
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.92
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 98.91
KOG0086214 consensus GTPase Rab4, small G protein superfamily 98.9
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.9
PRK00049396 elongation factor Tu; Reviewed 98.9
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.89
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.89
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 98.87
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.83
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.8
PRK04000411 translation initiation factor IF-2 subunit gamma; 98.8
PRK05433 600 GTP-binding protein LepA; Provisional 98.79
KOG2423572 consensus Nucleolar GTPase [General function predi 98.79
PRK13796365 GTPase YqeH; Provisional 98.79
KOG0097215 consensus GTPase Rab14, small G protein superfamil 98.76
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.76
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.74
KOG2484435 consensus GTPase [General function prediction only 98.73
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 98.72
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.71
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.71
KOG0395196 consensus Ras-related GTPase [General function pre 98.71
KOG0088218 consensus GTPase Rab21, small G protein superfamil 98.69
PTZ00141446 elongation factor 1- alpha; Provisional 98.68
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 98.68
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.66
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.65
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.6
PRK12289352 GTPase RsgA; Reviewed 98.58
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.57
PRK12288347 GTPase RsgA; Reviewed 98.56
COG2229187 Predicted GTPase [General function prediction only 98.54
COG1100219 GTPase SAR1 and related small G proteins [General 98.53
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.5
PLN00043447 elongation factor 1-alpha; Provisional 98.49
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 98.48
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.47
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.43
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.42
PRK04004 586 translation initiation factor IF-2; Validated 98.4
KOG0090238 consensus Signal recognition particle receptor, be 98.38
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 98.37
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.36
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 98.36
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.35
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 98.34
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.32
PRK00098298 GTPase RsgA; Reviewed 98.3
PRK13351 687 elongation factor G; Reviewed 98.3
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.27
KOG0081219 consensus GTPase Rab27, small G protein superfamil 98.26
PTZ00099176 rab6; Provisional 98.25
PRK13768253 GTPase; Provisional 98.24
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 98.24
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.22
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.16
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.12
KOG3883198 consensus Ras family small GTPase [Signal transduc 98.11
COG5019373 CDC3 Septin family protein [Cell division and chro 98.1
TIGR00691 683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 98.09
KOG0462 650 consensus Elongation factor-type GTP-binding prote 98.08
PTZ00416 836 elongation factor 2; Provisional 98.06
PRK12740 668 elongation factor G; Reviewed 98.06
PF08438109 MMR_HSR1_C: GTPase of unknown function C-terminal; 98.06
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 98.03
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 98.03
KOG4252246 consensus GTP-binding protein [Signal transduction 98.02
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.01
KOG1145 683 consensus Mitochondrial translation initiation fac 97.98
COG1162301 Predicted GTPases [General function prediction onl 97.98
PRK09435332 membrane ATPase/protein kinase; Provisional 97.92
PLN00116 843 translation elongation factor EF-2 subunit; Provis 97.92
PRK10872 743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 97.92
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.91
PRK07560 731 elongation factor EF-2; Reviewed 97.87
KOG0458603 consensus Elongation factor 1 alpha [Translation, 97.73
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 97.62
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 97.62
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 97.61
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 97.59
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 97.57
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 97.57
COG5257415 GCD11 Translation initiation factor 2, gamma subun 97.55
COG4917148 EutP Ethanolamine utilization protein [Amino acid 97.52
KOG1673205 consensus Ras GTPases [General function prediction 97.52
PRK01889356 GTPase RsgA; Reviewed 97.5
cd03112158 CobW_like The function of this protein family is u 97.44
PRK14845 1049 translation initiation factor IF-2; Provisional 97.43
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 97.42
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 97.27
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 97.27
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 97.26
KOG3886295 consensus GTP-binding protein [Signal transduction 97.23
KOG0461 522 consensus Selenocysteine-specific elongation facto 97.22
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.18
PRK11092 702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 97.17
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 97.16
COG0317 701 SpoT Guanosine polyphosphate pyrophosphohydrolases 97.1
KOG2486320 consensus Predicted GTPase [General function predi 97.04
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 96.98
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.97
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.74
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 96.74
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 96.64
COG3276 447 SelB Selenocysteine-specific translation elongatio 96.64
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 96.61
cd03114148 ArgK-like The function of this protein family is u 96.6
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 96.58
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 96.54
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, 96.52
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.51
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.47
COG1217 603 TypA Predicted membrane GTPase involved in stress 96.45
PRK10416318 signal recognition particle-docking protein FtsY; 96.43
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 96.39
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.36
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.34
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.25
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.2
PRK14974336 cell division protein FtsY; Provisional 96.12
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.12
TIGR00064272 ftsY signal recognition particle-docking protein F 96.05
COG0050394 TufB GTPases - translation elongation factors [Tra 96.04
PRK14737186 gmk guanylate kinase; Provisional 96.01
PRK00300205 gmk guanylate kinase; Provisional 95.99
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.93
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 95.91
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 95.85
KOG3905473 consensus Dynein light intermediate chain [Cell mo 95.77
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.72
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.68
PRK14738206 gmk guanylate kinase; Provisional 95.64
cd03115173 SRP The signal recognition particle (SRP) mediates 95.61
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.56
KOG1533290 consensus Predicted GTPase [General function predi 95.53
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 95.5
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.45
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.44
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.39
PRK07261171 topology modulation protein; Provisional 95.3
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 95.28
cd03116159 MobB Molybdenum is an essential trace element in t 95.27
PRK00771437 signal recognition particle protein Srp54; Provisi 95.25
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.23
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 95.21
COG1341398 Predicted GTPase or GTP-binding protein [General f 95.19
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 95.17
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.15
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.09
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 95.09
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.06
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.01
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.01
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.96
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.96
COG0411250 LivG ABC-type branched-chain amino acid transport 94.89
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.87
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.77
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.76
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.75
PRK14530215 adenylate kinase; Provisional 94.73
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.72
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 94.71
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.69
PF02263260 GBP: Guanylate-binding protein, N-terminal domain; 94.68
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.66
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.66
PF1355562 AAA_29: P-loop containing region of AAA domain 94.66
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 94.65
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.65
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.64
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.64
PRK10867433 signal recognition particle protein; Provisional 94.63
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 94.61
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.54
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.54
TIGR00101199 ureG urease accessory protein UreG. This model rep 94.52
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.51
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.48
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.46
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 94.46
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 94.46
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.44
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.44
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.42
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.42
cd03269210 ABC_putative_ATPase This subfamily is involved in 94.42
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote 94.41
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.41
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.41
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.41
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 94.41
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 94.39
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.38
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.38
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 94.38
PRK14242253 phosphate transporter ATP-binding protein; Provisi 94.38
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.35
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 94.33
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.33
PRK03839180 putative kinase; Provisional 94.3
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.3
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.29
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.29
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.29
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.28
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.26
PRK08118167 topology modulation protein; Reviewed 94.26
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.26
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.24
PRK05480209 uridine/cytidine kinase; Provisional 94.23
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.23
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.23
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.23
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 94.21
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.19
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 94.19
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 94.19
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.19
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 94.19
PRK10908222 cell division protein FtsE; Provisional 94.18
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 94.18
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 94.18
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.16
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 94.16
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.14
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 94.14
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.13
KOG00541381 consensus Multidrug resistance-associated protein/ 94.12
PRK14239252 phosphate transporter ATP-binding protein; Provisi 94.11
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 94.11
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 94.1
PRK14241258 phosphate transporter ATP-binding protein; Provisi 94.1
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 94.1
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.08
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 94.07
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.07
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 94.07
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.06
COG0488 530 Uup ATPase components of ABC transporters with dup 94.05
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 94.05
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.04
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 94.03
cd03110179 Fer4_NifH_child This protein family's function is 94.03
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.03
PRK13695174 putative NTPase; Provisional 94.03
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.02
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 94.02
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 94.02
KOG4181491 consensus Uncharacterized conserved protein [Funct 94.01
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 94.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.99
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 93.99
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information 
Probab=100.00  E-value=8.7e-96  Score=727.71  Aligned_cols=364  Identities=61%  Similarity=0.982  Sum_probs=344.2

Q ss_pred             CCcEEEEEecCCCCccHHHHHHhhcCcceecCCCCccccceEEEEecCCccchhhccccccccccCceEEEEecCCCcCC
Q 014539           55 MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKG  134 (423)
Q Consensus        55 ~~~~I~ivG~pnvGKSTL~N~Ltg~~~~~vs~~p~tT~~~~~~~~~~~~~r~~~l~~~~~~~~~~~~~i~lvDtpGl~~~  134 (423)
                      |+++|||||+||||||||||+||+. .+.++++||||++|+.|++.++++|++.|+++++|++.+|+++.|+||||++++
T Consensus         1 m~~~vgIVG~PNvGKSTLfnaLt~~-~~~v~nypftTi~p~~G~~~v~d~r~~~l~~~~~p~~~~~a~i~lvD~pGL~~~   79 (364)
T PRK09601          1 MGLKCGIVGLPNVGKSTLFNALTKA-GAEAANYPFCTIEPNVGVVPVPDPRLDKLAEIVKPKKIVPATIEFVDIAGLVKG   79 (364)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCC-CCeecccccccccceEEEEEeccccchhhHHhcCCccccCceEEEEECCCCCCC
Confidence            4589999999999999999999954 489999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccchhhHHhhhhhhcceEEEEEeccCCcceeeecccccCCcchHHHhhhhccCcHHHHHHHHHHhhhccccchhhhh
Q 014539          135 ASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKL  214 (423)
Q Consensus       135 ~~~~~~l~~~~l~~ir~aD~il~Vvd~~~~~~~~~~~~~~dp~~d~~~i~~El~l~d~~~~e~~~~~~~~~~~~~~sa~~  214 (423)
                      ++.+++++++|++++++||+++||||+|.++++.|+.+.+||++|+++++.||.++|++.++++++++.+..+...  +.
T Consensus        80 a~~g~glg~~fL~~i~~aD~li~VVd~f~d~~~~~~~~~~dP~~d~~~i~~EL~~~d~~~~ek~~~k~~k~~~~~~--~~  157 (364)
T PRK09601         80 ASKGEGLGNQFLANIREVDAIVHVVRCFEDDNITHVEGKVDPIRDIETINTELILADLETVEKRLERLEKKAKGGD--KE  157 (364)
T ss_pred             CChHHHHHHHHHHHHHhCCEEEEEEeCCccCCCCCCCCCCCHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhhccc--hh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999987654432  23


Q ss_pred             hHHHHHHHHHHHHHHhcCCCCCCCCCChHHHHHHHHHhhhhCcceEEeeeccccccCCCCCCcchHHHHHHHhhcCCcEE
Q 014539          215 KDAEKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRV  294 (423)
Q Consensus       215 ~~~~~~ll~~i~~~L~~~~~~~~~~~t~~e~e~ir~~~~~t~kpi~~v~N~~~~d~~~~~~~~~~~~i~~~~~~~~~~~v  294 (423)
                      ...+..+++++.++|+++.+++..+||++|.+.|++++++|.||++|++|+++.|+..  .+.+.+++.+|+.+.+.+++
T Consensus       158 ~~~e~~~l~~v~~~Le~~~~~~~~~~~~~e~~~l~~~~llt~KP~i~v~N~~e~~~~~--~~~~~~~i~~~~~~~~~~~i  235 (364)
T PRK09601        158 AKAELELLEKLLEHLEEGKPARTLELTDEEEKLLKSLQLLTAKPVLYVANVDEDDLAD--GNPYVKKVREIAAKEGAEVV  235 (364)
T ss_pred             HHHHHHHHHHHHHHHHcCCCcccCCCCHHHHHHHHHhcccccCCeEEEEECCcccccc--ccHHHHHHHHHHHHcCCeEE
Confidence            3567788999999999999999889999999999999999999999999999887753  36789999999988888899


Q ss_pred             EechhhhHhhcCCChHHHHHHHHHcCCCCChhhHHHHHHHhhhCCEEEecCCCCCcceEEecCCCChhhhhhhcchhhhh
Q 014539          295 TISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEK  374 (423)
Q Consensus       295 ~~Sa~~e~~i~~l~~ee~~~~l~~~g~~~~~~~~li~~~~~~L~li~~fT~g~~e~raw~i~~gsta~~~A~~IHsD~~~  374 (423)
                      ++||+.|.+|.+|++|++++||++||+.+||++++|+.+|++||||+|||+|++|+|||+|++||||+||||+|||||+|
T Consensus       236 ~~sa~~E~el~~l~~ee~~~fl~~~g~~~s~~~~ii~~~~~~L~li~fftvg~~evrawti~~GstA~~aAg~IHsD~~k  315 (364)
T PRK09601        236 VICAKIEAEIAELDDEEKAEFLEELGLEESGLDRLIRAGYELLGLITYFTAGPKEVRAWTIKKGTTAPQAAGVIHTDFEK  315 (364)
T ss_pred             EEEHHHHHHHHcCCHHHHHHHHHHcCCcchhHHHHHHHHHHHhCCEEEecCCCCeEEEEEeCCCCchHHHhhcchhhHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccEEEEEecchhhhhhCCHHHHHHcCCccccCCCceecCCCEEEEEecC
Q 014539          375 GFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV  423 (423)
Q Consensus       375 ~Fi~Aev~~~~d~~~~~~~~~~k~~g~~r~~Gkdy~v~dgDii~~~f~~  423 (423)
                      ||||||||+|+||++|||+++||++||+|++||||+|||||||+||||+
T Consensus       316 gFI~AeVi~~~d~~~~g~~~~ak~~gk~rleGkdY~v~DGDIi~f~fn~  364 (364)
T PRK09601        316 GFIRAEVISYDDLIEYGSEAGAKEAGKVRLEGKDYIVQDGDVMHFRFNV  364 (364)
T ss_pred             ccEEEEEecHHHHHHcCCHHHHHHccceeccCCceEecCCCEEEEEcCC
Confidence            9999999999999999999999999999999999999999999999997

>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF06071 YchF-GTPase_C: Protein of unknown function (DUF933); InterPro: IPR013029 This domain is found at the C terminus of family of conserved hypothetical proteins found in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04867 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PF08438 MMR_HSR1_C: GTPase of unknown function C-terminal; InterPro: IPR013646 This domain is found at the C terminus of IPR002917 from INTERPRO in archaeal and eukaryotic GTP-binding proteins Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
1jal_A363 Ychf Protein (Hi0393) Length = 363 1e-107
2dwq_A368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 2e-98
2dby_A368 Crystal Structure Of The Gtp-Binding Protein Ychf I 2e-98
2ohf_A396 Crystal Structure Of Human Ola1 In Complex With Amp 6e-79
1ni3_A392 Structure Of The Schizosaccharomyces Pombe Ychf Gtp 2e-69
1wxq_A397 Crystal Structure Of Gtp Binding Protein From Pyroc 4e-14
1lnz_A342 Structure Of The Obg Gtp-Binding Protein Length = 3 8e-13
1udx_A416 Crystal Structure Of The Conserved Protein Tt1381 F 8e-11
1mky_A439 Structural Analysis Of The Domain Interactions In D 3e-05
>pdb|1JAL|A Chain A, Ychf Protein (Hi0393) Length = 363 Back     alignment and structure 
Iteration: 1

 Score =  384 bits (985), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/370 (51%), Positives = 256/370 (69%), Gaps = 8/370 (2%)
Query: 55  MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSK 114
           M  + GIVGLPNVGKSTLFNA+ + G  +AAN+PFCTIEPN G+V +PDPRL  L+ + K
Sbjct: 1   MGFKCGIVGLPNVGKSTLFNALTKAG-IEAANYPFCTIEPNTGVVPMPDPRLDALAEIVK 59
Query: 115 SQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKV 174
            ++ +P ++EFVDIAGLV GAS+GEGLGNKFL++IRE D+I  VVRCFE++DIVHV GK+
Sbjct: 60  PERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKI 119
Query: 175 DPKSDVDVINLELVFSDLDQIEKRMEKL-KKGKAKDSQSXXXXXXXXXXXXIQQALMDGK 233
           DP  D+D IN EL  +DLD  E+ +++L K+ K  D ++            I   L +  
Sbjct: 120 DPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEK---ILPVLENAG 176
Query: 234 PARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGR 293
             RSV L+  E  +IK    LT+KP +Y+ANV E    +   NP+++ V  +A+   +  
Sbjct: 177 MIRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFEN---NPYLDRVREIAAKEGAVV 233
Query: 294 VTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAW 353
           V + A +E+E+ EL  EE+VE+L  LG+ E GL  +IR+ Y+LL L+TYFT+G KE +AW
Sbjct: 234 VPVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYALLNLQTYFTAGVKEVRAW 293
Query: 354 TIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQE 413
           T+  G TAP+AA VIH+DFEKGFIRAE +AY+DF+       A+E G  R EGKDYIVQ+
Sbjct: 294 TVSVGATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFNGENGAKEAGKWRLEGKDYIVQD 353
Query: 414 GDVMLFRFNV 423
           GDVM FRFNV
Sbjct: 354 GDVMHFRFNV 363
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure
>pdb|2OHF|A Chain A, Crystal Structure Of Human Ola1 In Complex With Amppcp Length = 396 Back     alignment and structure
>pdb|1NI3|A Chain A, Structure Of The Schizosaccharomyces Pombe Ychf Gtpase Length = 392 Back     alignment and structure
>pdb|1WXQ|A Chain A, Crystal Structure Of Gtp Binding Protein From Pyrococcus Horikoshii Ot3 Length = 397 Back     alignment and structure
>pdb|1LNZ|A Chain A, Structure Of The Obg Gtp-Binding Protein Length = 342 Back     alignment and structure
>pdb|1UDX|A Chain A, Crystal Structure Of The Conserved Protein Tt1381 From Thermus Thermophilus Hb8 Length = 416 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
1jal_A363 YCHF protein; nucleotide-binding fold, structural 0.0
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 0.0
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 0.0
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 0.0
1wxq_A397 GTP-binding protein; structural genomics, riken st 1e-157
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 2e-23
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 3e-21
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 1e-07
3cnl_A262 YLQF, putative uncharacterized protein; circular p 2e-06
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 9e-06
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 7e-05
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 2e-04
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 4e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-04
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 5e-04
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 5e-04
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 5e-04
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 6e-04
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 6e-04
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 7e-04
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 7e-04
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 8e-04
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
 Score =  673 bits (1739), Expect = 0.0
 Identities = 196/370 (52%), Positives = 262/370 (70%), Gaps = 8/370 (2%)

Query: 55  MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSK 114
           M  + GIVGLPNVGKSTLFNA+ + G  +AAN+PFCTIEPN G+V +PDPRL  L+ + K
Sbjct: 1   MGFKCGIVGLPNVGKSTLFNALTKAG-IEAANYPFCTIEPNTGVVPMPDPRLDALAEIVK 59

Query: 115 SQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKV 174
            ++ +P ++EFVDIAGLV GAS+GEGLGNKFL++IRE D+I  VVRCFE++DIVHV GK+
Sbjct: 60  PERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKI 119

Query: 175 DPKSDVDVINLELVFSDLDQIEKRMEKL-KKGKAKDSQSKLKDAEKAALEKIQQALMDGK 233
           DP  D+D IN EL  +DLD  E+ +++L K+ K  D ++K    E + +EKI   L +  
Sbjct: 120 DPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAK---FELSVMEKILPVLENAG 176

Query: 234 PARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGR 293
             RSV L+  E  +IK    LT+KP +Y+ANV E    +   NP+++ V  +A+   +  
Sbjct: 177 MIRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFEN---NPYLDRVREIAAKEGAVV 233

Query: 294 VTISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAW 353
           V + A +E+E+ EL  EE+VE+L  LG+ E GL  +IR+ Y+LL L+TYFT+G KE +AW
Sbjct: 234 VPVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYALLNLQTYFTAGVKEVRAW 293

Query: 354 TIRAGMTAPQAAGVIHSDFEKGFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQE 413
           T+  G TAP+AA VIH+DFEKGFIRAE +AY+DF+       A+E G  R EGKDYIVQ+
Sbjct: 294 TVSVGATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFNGENGAKEAGKWRLEGKDYIVQD 353

Query: 414 GDVMLFRFNV 423
           GDVM FRFNV
Sbjct: 354 GDVMHFRFNV 363
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
1jal_A363 YCHF protein; nucleotide-binding fold, structural 100.0
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 100.0
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 100.0
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 100.0
1wxq_A397 GTP-binding protein; structural genomics, riken st 100.0
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 100.0
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.81
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.79
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.78
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.76
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.76
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 99.75
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.75
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.71
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.71
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.71
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.7
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.69
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.69
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.67
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.66
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.66
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.66
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.66
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.65
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.65
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.65
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.65
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.65
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.65
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.65
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.64
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.64
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.64
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.64
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.63
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.63
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.63
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.63
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.63
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.63
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.63
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.63
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.63
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.63
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.63
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.63
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.63
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.63
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.62
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.62
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.62
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.62
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.62
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.62
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.62
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.62
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.62
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.62
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.62
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.62
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.62
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.61
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.61
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.61
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.61
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.61
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.6
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.6
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.6
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.6
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.6
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.6
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.6
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.59
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.59
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.59
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.59
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.59
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.58
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.58
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.58
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.58
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.58
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.58
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.58
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.57
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.57
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.57
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.57
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.57
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.57
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.57
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.57
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.56
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.56
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.56
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.56
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.56
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.56
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.55
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.55
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.55
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.55
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.55
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.55
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.54
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.54
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.53
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.53
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.53
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.52
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.52
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.52
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.52
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.51
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.51
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.51
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.51
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.51
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.51
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.5
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.5
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.5
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.5
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.49
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.49
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.49
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.49
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.49
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.49
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.48
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.48
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.48
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.47
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.47
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.47
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.47
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.47
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.46
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.43
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.14
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.42
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.41
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.4
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.4
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.39
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.39
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.39
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.38
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.37
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.37
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.37
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.36
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.35
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.34
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.3
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.3
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.28
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.28
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.27
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.25
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.25
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.24
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.24
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.22
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.22
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.22
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.22
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.2
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.19
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.18
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.17
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.17
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.15
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.13
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.12
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.11
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.1
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.09
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.08
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.05
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.04
2ged_A193 SR-beta, signal recognition particle receptor beta 99.03
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.01
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.0
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.98
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.96
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.95
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.93
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.92
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.9
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.89
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.81
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.79
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.77
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.75
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.72
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.7
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.68
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 98.65
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.64
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.58
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.56
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.51
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.33
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.29
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.2
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.11
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.03
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.95
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.87
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 97.81
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.66
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 97.63
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 97.61
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.49
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.4
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.31
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.3
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.29
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 97.04
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.92
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.89
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.89
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.82
2xxa_A433 Signal recognition particle protein; protein trans 96.4
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.34
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.27
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.24
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.17
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.14
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.1
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 96.07
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.06
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.0
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.93
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 95.93
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.86
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.79
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.75
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.74
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.72
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.69
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.67
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.61
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 95.56
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.54
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 95.35
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 95.35
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.28
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.28
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.28
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.2
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.16
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 95.13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.13
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.12
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 95.04
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 95.04
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 94.93
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.9
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.89
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.88
1g6h_A257 High-affinity branched-chain amino acid transport 94.83
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.81
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.81
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.8
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.79
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.79
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 94.79
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.79
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.78
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.75
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.75
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.73
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.72
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.7
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.66
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.66
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.66
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.65
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.65
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.62
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.61
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.6
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.59
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.57
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.54
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.53
2ghi_A260 Transport protein; multidrug resistance protein, M 94.52
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.47
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.45
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.43
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.43
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.39
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.38
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.38
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.38
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.37
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.33
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.33
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.31
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.25
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.23
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.19
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.16
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.09
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.08
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.04
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.03
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 93.99
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.91
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.9
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.88
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 93.86
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.83
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.82
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 93.78
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 93.76
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.75
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.74
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.7
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 93.69
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.69
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.65
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.62
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.59
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.55
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.53
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.45
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.43
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.41
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.38
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.35
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 93.35
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.33
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.3
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.29
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 93.27
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 93.25
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.23
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.22
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.21
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 93.19
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.17
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.16
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.16
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.16
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.11
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.09
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.04
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 93.03
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 93.02
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 92.97
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.9
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 92.88
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.87
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.81
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 92.8
2ewv_A372 Twitching motility protein PILT; pilus retraction 92.75
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.75
1via_A175 Shikimate kinase; structural genomics, transferase 92.74
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 92.74
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 92.71
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.7
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.67
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 92.61
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.6
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 92.6
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.57
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 92.53
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.53
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.51
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.41
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 92.41
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 92.38
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 92.36
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 92.34
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 92.32
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.27
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.2
1p9r_A418 General secretion pathway protein E; bacterial typ 92.16
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 92.15
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 92.08
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 92.07
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.05
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 92.05
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.03
3cnl_A262 YLQF, putative uncharacterized protein; circular p 92.02
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 91.8
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 91.79
1xjc_A169 MOBB protein homolog; structural genomics, midwest 91.72
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 91.62
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 91.61
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 91.45
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 91.44
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 91.43
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 91.4
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.27
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.21
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 91.2
2cvh_A220 DNA repair and recombination protein RADB; filamen 91.18
3r20_A233 Cytidylate kinase; structural genomics, seattle st 91.15
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 91.09
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 91.08
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 91.07
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 91.07
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 91.05
3kta_A182 Chromosome segregation protein SMC; structural mai 91.02
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.96
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 90.94
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 90.84
2og2_A359 Putative signal recognition particle receptor; nuc 90.8
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 90.64
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 90.62
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.59
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 90.5
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 90.49
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 90.39
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 90.26
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 90.23
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 90.21
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 90.16
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 90.08
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 89.91
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 89.85
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.8
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 89.52
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 89.47
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 89.37
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 89.29
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 89.22
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 89.18
3cwq_A209 Para family chromosome partitioning protein; alpha 88.97
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.74
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 88.6
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 88.39
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 88.11
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 88.1
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 87.98
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 87.93
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 87.67
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 87.62
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 87.43
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 87.4
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 87.07
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 86.94
1vma_A306 Cell division protein FTSY; TM0570, structural gen 86.93
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 86.92
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.52
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 86.51
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 86.38
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 86.37
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 86.37
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 86.23
4aby_A415 DNA repair protein RECN; hydrolase, double strand 86.08
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 86.06
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 86.04
3bos_A242 Putative DNA replication factor; P-loop containing 85.96
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 85.71
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 85.62
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 85.58
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 85.18
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 85.14
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 85.11
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 85.0
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 84.86
1tue_A212 Replication protein E1; helicase, replication, E1E 84.83
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 84.82
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 84.82
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 84.77
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 84.75
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 84.63
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 84.62
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 84.59
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 84.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 84.17
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 84.09
1e69_A322 Chromosome segregation SMC protein; structural mai 83.96
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 83.95
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 83.88
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 83.8
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 83.7
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 83.69
3co5_A143 Putative two-component system transcriptional RES 83.33
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 83.23
2chg_A226 Replication factor C small subunit; DNA-binding pr 83.15
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 82.9
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 82.88
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 82.66
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 82.61
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 82.58
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 82.49
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 82.4
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 82.16
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 82.15
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 82.03
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
Probab=100.00  E-value=6.7e-91  Score=698.33  Aligned_cols=363  Identities=53%  Similarity=0.888  Sum_probs=328.8

Q ss_pred             CCcEEEEEecCCCCccHHHHHHhhcCcceecCCCCccccceEEEEecCCccchhhccccccccccCceEEEEecCCCcCC
Q 014539           55 MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKG  134 (423)
Q Consensus        55 ~~~~I~ivG~pnvGKSTL~N~Ltg~~~~~vs~~p~tT~~~~~~~~~~~~~r~~~l~~~~~~~~~~~~~i~lvDtpGl~~~  134 (423)
                      |+++|+|||.||||||||||+|++. .+.++++||||++|+.|.+.+++.++++|+++++|.+..+.++.||||||+.++
T Consensus         1 m~~kI~IVG~pnvGKSTL~n~Lt~~-~~~v~~~p~tTi~p~~g~v~~~~~r~~~l~~~~~~~~~~~~~i~lvDtpGl~~~   79 (363)
T 1jal_A            1 MGFKCGIVGLPNVGKSTLFNALTKA-GIEAANYPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVAG   79 (363)
T ss_dssp             CCCEEEEECCTTSSHHHHHHHHHHT-C------CCCCCCCCSSEEECCCHHHHHHHHHHCCSEEECCEEEEEECCSCCTT
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC-CCcccCCCCceECceEEEEecCCcccceeeeeecccceeeeEEEEEECCCCccc
Confidence            5689999999999999999999954 488999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccchhhHHhhhhhhcceEEEEEeccCCcceeeecccccCCcchHHHhhhhccCcHHHHHHHHHHhhhccccchhhhh
Q 014539          135 ASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKL  214 (423)
Q Consensus       135 ~~~~~~l~~~~l~~ir~aD~il~Vvd~~~~~~~~~~~~~~dp~~d~~~i~~El~l~d~~~~e~~~~~~~~~~~~~~sa~~  214 (423)
                      ++.+++++++|++++++||+++||+|++++.++.|+.|++||++|++.++.||.++|++.+++++.++.+..+.+.  +.
T Consensus        80 a~~~~gl~~~fl~~ir~ad~il~VvD~~~~~~v~~v~~~~dp~~d~~~i~~EL~~~d~~~~~k~~~~~~k~~k~g~--~~  157 (363)
T 1jal_A           80 ASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGD--KE  157 (363)
T ss_dssp             HHHHGGGTCCHHHHHHTCSEEEEEEECSCC---------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTC--HH
T ss_pred             ccccchHHHHHHHHHHhcCeEEEEEecCCCCceeeecCCcChHHHHHHHHHHHHhhhHHHHhhHHHHHHHHhhccc--hh
Confidence            8888899999999999999999999999999999999999999999999999999999999999999887655444  44


Q ss_pred             hHHHHHHHHHHHHHHhcCCCCCCCCCChHHHHHHHHHhhhhCcceEEeeeccccccCCCCCCcchHHHHHHHhhcCCcEE
Q 014539          215 KDAEKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRV  294 (423)
Q Consensus       215 ~~~~~~ll~~i~~~L~~~~~~~~~~~t~~e~e~ir~~~~~t~kpi~~v~N~~~~d~~~~~~~~~~~~i~~~~~~~~~~~v  294 (423)
                      ...+.+++++++++|+++.+++..+|+++|.++++.+++++.||++|++|++++++ .  .+.+.+++++++.+++.+++
T Consensus       158 ~~~~~~~l~~~~~~L~~~~~~~~~~~~~~e~~~l~~~~llt~KPvi~v~N~~e~~~-~--~n~~~~~v~~~~~~~~~~~i  234 (363)
T 1jal_A          158 AKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGF-E--NNPYLDRVREIAAKEGAVVV  234 (363)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCGGGSCCCHHHHHHHGGGCCSTTSCEEEEEECCTTCS-S--SCHHHHHHHHHHHHTTCEEE
T ss_pred             HHHHHHHHHHHHHHHhcCCCccccCCCHHHHHHHHHhhcccCCcEEEEEecccccc-c--ccHHHHHHHHHHHHcCCCEE
Confidence            56778899999999999999998889999999999999999999999999998776 2  36789999999988888999


Q ss_pred             EechhhhHhhcCCChHHHHHHHHHcCCCCChhhHHHHHHHhhhCCEEEecCCCCCcceEEecCCCChhhhhhhcchhhhh
Q 014539          295 TISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLGLRTYFTSGEKETKAWTIRAGMTAPQAAGVIHSDFEK  374 (423)
Q Consensus       295 ~~Sa~~e~~i~~l~~ee~~~~l~~~g~~~~~~~~li~~~~~~L~li~~fT~g~~e~raw~i~~gsta~~~A~~IHsD~~~  374 (423)
                      ++||+.|.+|.+|+++++.+||+++|+.++|++++++++|++||||+|||+||+|+|||||++|+||+||||+|||||+|
T Consensus       235 ~~sA~~E~el~~l~~~e~~~~l~~~g~~~~gl~~li~~~~~~L~li~~ft~g~~e~raw~i~~G~ta~~aAg~IH~D~~~  314 (363)
T 1jal_A          235 PVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYALLNLQTYFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEK  314 (363)
T ss_dssp             EECHHHHHHGGGSCSSTTHHHHTTSSCCSCTTHHHHHHHHHHTTEEEEEEECSSEEEEEEEETTCBHHHHHHTTCTTHHH
T ss_pred             EechHHHHHHHhcCHHHHHHHHHHhCcccccHHHHHHHHHHHhCCEEEECCCCCCcceeEecCCCcHHHHHHhhHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccEEEEEecchhhhhhCCHHHHHHcCCccccCCCceecCCCEEEEEecC
Q 014539          375 GFIRAETVAYDDFVAAGSLAAAREKGLLRSEGKDYIVQEGDVMLFRFNV  423 (423)
Q Consensus       375 ~Fi~Aev~~~~d~~~~~~~~~~k~~g~~r~~Gkdy~v~dgDii~~~f~~  423 (423)
                      ||||||||+|+||++|||+++||++|++|++||||+|||||||+|||||
T Consensus       315 gFi~Aev~~~~d~~~~~~~~~~k~~g~~r~egk~y~v~dgDii~f~fn~  363 (363)
T 1jal_A          315 GFIRAEVIAYEDFIQFNGENGAKEAGKWRLEGKDYIVQDGDVMHFRFNV  363 (363)
T ss_dssp             HCCEEEEECHHHHHHTTSHHHHHHTTCCEEECTTCBCCTTCEEEEESCC
T ss_pred             ccEEEEEcCHHHHHHhCCHHHHHhcCCeeccCCccEecCCCEEEEEecC
Confidence            9999999999999999999999999999999999999999999999997
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 423
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 1e-116
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-85
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 7e-67
d1jala285 d.15.10.2 (A:279-363) YchF GTP-binding protein, C- 4e-49
d1ni3a282 d.15.10.2 (A:307-388) YchF GTP-binding protein, C- 2e-44
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 8e-21
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 6e-18
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 5e-10
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 7e-08
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 7e-07
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 2e-06
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 2e-06
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 3e-06
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 4e-06
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 2e-04
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 6e-04
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 0.001
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 0.001
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 0.002
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 0.002
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.003
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Haemophilus influenzae [TaxId: 727]

 Score =  338 bits (869), Expect = e-116
 Identities = 138/283 (48%), Positives = 190/283 (67%), Gaps = 6/283 (2%)

Query: 55  MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSK 114
           M  + GIVGLPNVGKSTLFNA+      +AAN+PFCTIEPN G+V +PDPRL  L+ + K
Sbjct: 1   MGFKCGIVGLPNVGKSTLFNALT-KAGIEAANYPFCTIEPNTGVVPMPDPRLDALAEIVK 59

Query: 115 SQKAVPASVEFVDIAGLVKGASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKV 174
            ++ +P ++EFVDIAGLV GAS+GEGLGNKFL++IRE D+I  VVRCFE++DIVHV GK+
Sbjct: 60  PERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKI 119

Query: 175 DPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKLKDAEKAALEKIQQALMDGKP 234
           DP  D+D IN EL  +DLD  E+ +++L+K        K    E + +EKI   L +   
Sbjct: 120 DPLDDIDTINTELALADLDSCERAIQRLQKRAKGG--DKEAKFELSVMEKILPVLENAGM 177

Query: 235 ARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRV 294
            RSV L+  E  +IK    LT+KP +Y+ANV E    +   NP+++ V  +A+   +  V
Sbjct: 178 IRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFEN---NPYLDRVREIAAKEGAVVV 234

Query: 295 TISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLL 337
            + A +E+E+ EL  EE+VE+L  LG+ E GL  +IR+ Y+LL
Sbjct: 235 PVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYALL 277
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 85 Back     information, alignment and structure
>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 82 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 100.0
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 100.0
d1jala285 YchF GTP-binding protein, C-terminal domain {Haemo 100.0
d1ni3a282 YchF GTP-binding protein, C-terminal domain {Fissi 100.0
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 100.0
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.82
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.82
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.8
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.78
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.72
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.7
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.7
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.68
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.63
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.61
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.59
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.58
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.56
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.56
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.55
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.54
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.54
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.54
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.51
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.51
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.5
d1wxqa276 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.5
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.48
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.48
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.47
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.47
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.45
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.45
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.44
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.44
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.44
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.43
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.42
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.42
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.4
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.4
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.39
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.32
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.31
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.31
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.3
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.3
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.29
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.27
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.24
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.23
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.15
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.14
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.14
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.05
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.71
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.69
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.63
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.59
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.58
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.58
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.57
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.56
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.51
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.41
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.36
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.34
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.19
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.07
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.05
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.99
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.7
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.04
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.02
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.71
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.67
d1vmaa2213 GTPase domain of the signal recognition particle r 96.51
d1okkd2207 GTPase domain of the signal recognition particle r 96.48
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.46
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.43
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.36
d2qy9a2211 GTPase domain of the signal recognition particle r 96.27
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 96.12
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.11
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.04
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.77
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.74
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.69
d1nyra259 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 95.51
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.4
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.31
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.3
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.28
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.27
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.22
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.14
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.13
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.08
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.06
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.05
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.05
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.04
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.03
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.02
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.95
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.95
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.93
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.89
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.88
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.85
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.8
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.8
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.73
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.73
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.7
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.6
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.58
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.56
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.56
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.49
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.49
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.47
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.46
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.45
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.33
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.33
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.28
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.26
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.22
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.21
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.18
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.15
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.04
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.67
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.67
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.61
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.5
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.33
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.15
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 92.93
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.79
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.57
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.31
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.12
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.89
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.62
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.56
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.4
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.21
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.14
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.07
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.98
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.57
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.19
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.07
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.59
d2hj1a177 Hypothetical protein HI0395 {Haemophilus influenza 89.2
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 88.96
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 88.95
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.24
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.66
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.35
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.95
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.6
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.17
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 85.97
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 85.31
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 85.28
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 85.22
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 84.72
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 84.59
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.55
d1tuea_205 Replication protein E1 helicase domain {Human papi 84.52
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.4
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 83.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 83.76
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 83.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 83.55
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.38
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.89
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 82.88
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 82.36
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 81.9
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 81.84
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.48
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 81.37
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 81.13
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 80.17
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 80.15
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Haemophilus influenzae [TaxId: 727]

Probab=100.00  E-value=2e-60  Score=460.71  Aligned_cols=278  Identities=50%  Similarity=0.830  Sum_probs=245.9

Q ss_pred             CCcEEEEEecCCCCccHHHHHHhhcCcceecCCCCccccceEEEEecCCccchhhccccccccccCceEEEEecCCCcCC
Q 014539           55 MSLRAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDPRLHVLSGLSKSQKAVPASVEFVDIAGLVKG  134 (423)
Q Consensus        55 ~~~~I~ivG~pnvGKSTL~N~Ltg~~~~~vs~~p~tT~~~~~~~~~~~~~r~~~l~~~~~~~~~~~~~i~lvDtpGl~~~  134 (423)
                      |+++|||||+||||||||||+|| +..+.+++|||||++||.|++++||+|+++|+.+++|++++|+++.++|+||+++|
T Consensus         1 m~~~~GivG~Pn~GKSTlf~~lt-~~~~~~~~ypf~ti~pn~gvv~v~d~r~~~l~~~~~~~~~~~a~i~~~Di~GLi~g   79 (278)
T d1jala1           1 MGFKCGIVGLPNVGKSTLFNALT-KAGIEAANYPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVAG   79 (278)
T ss_dssp             CCCEEEEECCTTSSHHHHHHHHH-HTC------CCCCCCCCSSEEECCCHHHHHHHHHHCCSEEECCEEEEEECCSCCTT
T ss_pred             CCceEEEECCCCCCHHHHHHHHH-CCCCccccCCCCCCCCceEEEecccHhHHHHHHhcCCCceeeeeEEEEEccccCCC
Confidence            68999999999999999999999 66789999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccchhhHHhhhhhhcceEEEEEeccCCcceeeecccccCCcchHHHhhhhccCcHHHHHHHHHHhhhccccchhhhh
Q 014539          135 ASQGEGLGNKFLSHIREVDSILQVVRCFEDNDIVHVNGKVDPKSDVDVINLELVFSDLDQIEKRMEKLKKGKAKDSQSKL  214 (423)
Q Consensus       135 ~~~~~~l~~~~l~~ir~aD~il~Vvd~~~~~~~~~~~~~~dp~~d~~~i~~El~l~d~~~~e~~~~~~~~~~~~~~sa~~  214 (423)
                      +|+|+|+|++||+++|+||+|+||||||+++++.|+.+.+||++|+++++.||.+||++.+++++.++.+..+.+.  +.
T Consensus        80 a~~g~Glg~~FL~~ir~~d~LihVVr~f~~~di~~~~g~~dP~~Die~I~~EL~l~Dle~lek~~ekl~k~~k~~~--~~  157 (278)
T d1jala1          80 ASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGD--KE  157 (278)
T ss_dssp             HHHHGGGTCCHHHHHHTCSEEEEEEECSCC---------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTC--HH
T ss_pred             cccCCCccHHHHHHHHhccceEEEeeccCCCCCcCCCCCcCHHHHHHHHHHHHHHhhHHHHHHHHHHHhccccccc--ch
Confidence            9999999999999999999999999999999999999999999999999999999999999999999887776554  45


Q ss_pred             hHHHHHHHHHHHHHHhcCCCCCCCCCChHHHHHHHHHhhhhCcceEEeeeccccccCCCCCCcchHHHHHHHhhcCCcEE
Q 014539          215 KDAEKAALEKIQQALMDGKPARSVTLNDFERDSIKQLCLLTMKPIIYVANVAESDLADPGSNPHVNEVMNLASDLQSGRV  294 (423)
Q Consensus       215 ~~~~~~ll~~i~~~L~~~~~~~~~~~t~~e~e~ir~~~~~t~kpi~~v~N~~~~d~~~~~~~~~~~~i~~~~~~~~~~~v  294 (423)
                      ......+++.+...++.+.+++...|++++...++.+.+++.||++|++|+.+++..   .+.+.+++.+++.+++..++
T Consensus       158 ~~~~~~~l~~~~~~l~~~~~i~~~~~~~~e~~~l~~l~lLt~KP~i~v~Nv~E~~~~---~~~~~~~l~~~~~~~~~~vI  234 (278)
T d1jala1         158 AKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFE---NNPYLDRVREIAAKEGAVVV  234 (278)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCGGGSCCCHHHHHHHGGGCCSTTSCEEEEEECCTTCSS---SCHHHHHHHHHHHHTTCEEE
T ss_pred             hhhHHHHHHHHhhhccccceeecccCChhHhHHHHhhhhhhcchhhhhhcccccccc---ccHHHHHHHHHHHhcCCeEE
Confidence            556777889999999999999988899999999999999999999999999876542   25678899999888888999


Q ss_pred             EechhhhHhhcCCChHHHHHHHHHcCCCCChhhHHHHHHHhhhC
Q 014539          295 TISAQVEAELTELPSEERVEYLASLGVSESGLGNLIRSTYSLLG  338 (423)
Q Consensus       295 ~~Sa~~e~~i~~l~~ee~~~~l~~~g~~~~~~~~li~~~~~~L~  338 (423)
                      ++||+.|.+|.+|++||+++||+++|+.++|++++|+++|++||
T Consensus       235 ~isa~iE~el~~L~~eE~~efL~~~gl~e~gl~klIk~gy~lLn  278 (278)
T d1jala1         235 PVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYALLN  278 (278)
T ss_dssp             EECHHHHHHGGGSCSSTTHHHHTTSSCCSCTTHHHHHHHHHHTT
T ss_pred             EeEHHHHHHHHcCCHHHHHHHHHHcCCChhhHHHHHHHHHHhhC
Confidence            99999999999999999999999999999999999999999997
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure