Citrus Sinensis ID: 014748

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKAKRVKEREDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEPGSNPTAAANNNASTSISMPNNGEPSSSINNENVEGDPDSSFEETSATEDVNGRDVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDSVAGIAIEKARN
ccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHcHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHcccccccHHHcccHHHcccccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MMMGLMLHANAKSLIKRHMYKDALEVLTMGeeafslcdpkvlefvdngpllqiDMVWCYFMLRDISWLSEAGIRLRKAREGierahgkdssrvrllqagrhpELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFqlqvpdesLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKAKRVKEREDNEQRRKEIMEQkrygltplkkaVDIEKIKELVSIGFEKELVAEALRRNENDSQkalddltnpesnsAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLlgepgsnptaaannnastsismpnngepsssinnenvegdpdssfeetsatedvngrdvemEDELandltgdvfadydIEVTKEGEAISEYLSLLDSVAGIAIEKARN
MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAregierahgkdssrvrllqAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIdflveekakrvkeredneqrrkeimeqkrygltplkkavdieKIKELVSIGFEKELVAEALRRNENDSqkalddltnpesnsAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEPGSNPTAAANNNASTSISMPNNGEPSSSINNENVEGDPDSSFEETsatedvngrdVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLslldsvagiaiekarn
MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLveekakrvkereDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEPGsnptaaannnastsisMPNNGEPSSSINNENVEGDPDSSFEETSATEDVNGRDVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDSVAGIAIEKARN
******LHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKA****************LLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLV*************************YGLTPLKKAVDIEKIKELVSIGFEKELVA***************************LYI*******CRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLL*****************************************************************NDLTGDVFADYDIEVTKEGEAISEYLSLLDSVAGIAI*****
MMMGLM*HANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKAR*AL****AKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEK**********************************EKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESN*************************LVAMGFERPRVIEACRAGGDDIHQIMLQL***************************************************************ELANDLTGDVFADYDIEVTKEGEAISEYLSL**************
MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAREGI*********RVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKAK***********RKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESNSAIQLYIES*********ADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEPGSNPTAAANNNASTSISMPNNGEPSSSINNE*******************NGRDVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDSVAGIAIEKARN
MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKAKRVKEREDNEQRRKEIM*****GLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESNSA**LYIES***KRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEP*****************************************************DVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDSVAGIA******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKxxxxxxxxxxxxxxxxxxxxxRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEPGSNPTAAANNNASTSISMPNNGEPSSSINNENVEGDPDSSFEETSATEDVNGRDVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDSVAGIAIEKARN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query419 2.2.26 [Sep-21-2011]
P54729614 NEDD8 ultimate buster 1 O yes no 0.883 0.602 0.267 5e-26
Q9Y5A7615 NEDD8 ultimate buster 1 O yes no 0.880 0.6 0.260 1e-22
>sp|P54729|NUB1_MOUSE NEDD8 ultimate buster 1 OS=Mus musculus GN=Nub1 PE=1 SV=2 Back     alignment and function desciption
 Score =  119 bits (297), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 113/422 (26%), Positives = 197/422 (46%), Gaps = 52/422 (12%)

Query: 1   MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYF 60
           +M+ +  H   ++ +KR  Y  AL  L   +  F  C  ++L+ VDN  +LQ+D+VWCYF
Sbjct: 233 LMLAMGYHEKGRAFLKRKEYGIALPCLLDADRYFCECK-ELLDTVDNYAVLQLDIVWCYF 291

Query: 61  MLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYH 120
            L  +  L +A  +L  A++  +  +G++  R+  ++     E  L LR+ LL+G+  YH
Sbjct: 292 RLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIQNYH 351

Query: 121 SGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLV 180
           SG  ++AR  L  A+  F +L +    +  ++ +GF  Q+A+  LR C  +V  A   + 
Sbjct: 352 SGNGEEAREYLNKARQLFKELYIDPSKVHNLLQLGFTAQEARLGLRACDGNVDHAATHI- 410

Query: 181 EEKAKRVKEREDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEAL--- 237
                          RR+E+ + ++      K+   +E +  L  +G+  +   +AL   
Sbjct: 411 -------------SNRREELAQIRK--EEKEKRRRRLENVNTLRGMGYSTQAAKQALHQA 455

Query: 238 RRNENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAK--IEQLVAMGFERPRVIE 295
           R N +D+ K L  L+NP     +    ++      RQA+ ++  I QLV MGF+      
Sbjct: 456 RGNLDDALKVL--LSNPH----MWWLQDADPENNSRQASPSQESINQLVYMGFDTVVAEA 509

Query: 296 ACRAGGDDIHQIMLQLLGEPGSNPTAAANNNASTSISMPNNGEPSSSINNENVEGDPDSS 355
           A R  G ++ Q+  Q L   G               S+P    P    + E+    P +S
Sbjct: 510 ALRVFGGNV-QLAAQTLAHHGG--------------SLP----PDLQFSGEDSSPTPSTS 550

Query: 356 FEETSATEDVNGRDVEMEDELANDLTGDVF---ADY-DIEVTKEGEAISEYLSLLDSVAG 411
             +++ T   +  D +ME E  N++  D+     DY D  +  E   I+EYLS ++S++ 
Sbjct: 551 PSDSAGTSSAST-DEDMETEAVNEILEDIPEHEEDYLDSTLEDEEVIIAEYLSYVESISS 609

Query: 412 IA 413
            A
Sbjct: 610 AA 611
Specific down-regulator of the NEDD8 conjugation system. Recruits NEDD8, UBD, and their conjugates to the proteasome for degradation.
Mus musculus (taxid: 10090)
>sp|Q9Y5A7|NUB1_HUMAN NEDD8 ultimate buster 1 OS=Homo sapiens GN=NUB1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
255583086 559 NEDD8 ultimate buster, putative [Ricinus 0.959 0.719 0.675 1e-147
224120288 566 predicted protein [Populus trichocarpa] 0.971 0.719 0.638 1e-141
224142489 578 predicted protein [Populus trichocarpa] 0.980 0.711 0.637 1e-140
225463067 552 PREDICTED: NEDD8 ultimate buster 1 [Viti 0.952 0.722 0.672 1e-139
388521561 557 unknown [Lotus japonicus] 0.942 0.709 0.618 1e-139
356556537 555 PREDICTED: uncharacterized protein LOC10 0.959 0.724 0.643 1e-138
356530579 556 PREDICTED: NEDD8 ultimate buster 1-like 0.954 0.719 0.646 1e-137
20198241 538 hypothetical protein [Arabidopsis thalia 0.966 0.752 0.551 1e-128
42569006 562 ubiquitin-associated (UBA)/TS-N domain-c 0.966 0.720 0.551 1e-128
133778854 562 At2g12550 [Arabidopsis thaliana] 0.966 0.720 0.551 1e-128
>gi|255583086|ref|XP_002532310.1| NEDD8 ultimate buster, putative [Ricinus communis] gi|223527979|gb|EEF30062.1| NEDD8 ultimate buster, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 277/410 (67%), Positives = 335/410 (81%), Gaps = 8/410 (1%)

Query: 1   MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYF 60
           +MMGLMLHAN K LI+R M+KDALEVLTMGEEAFSLC+PK +E VDN  +LQIDMVWCYF
Sbjct: 147 IMMGLMLHANGKGLIRRQMFKDALEVLTMGEEAFSLCNPKSIELVDNISILQIDMVWCYF 206

Query: 61  MLRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYH 120
           MLRDI+WLS AG+RL KAREG+ERAHGKDSSR RLLQAGR  EL+L+LR+ELLEGV AYH
Sbjct: 207 MLRDIAWLSVAGVRLEKAREGLERAHGKDSSRFRLLQAGRSSELSLYLRLELLEGVVAYH 266

Query: 121 SGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLV 180
           SGQFDK R  LTSAQ +FFQL+VPDE+LS+VM MGFKE DAKRALR+ +QD+ SAI+FLV
Sbjct: 267 SGQFDKCRKYLTSAQERFFQLRVPDEALSIVMGMGFKENDAKRALRMSNQDIESAINFLV 326

Query: 181 EEKAKRVKEREDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRN 240
           EEK ++ K+ ED+ +RR EI EQ+RYG T LKKAVD++++KELVS+GFEKEL AEALRRN
Sbjct: 327 EEKERKAKKMEDDIRRRAEIREQRRYGETALKKAVDLQRLKELVSLGFEKELAAEALRRN 386

Query: 241 ENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAG 300
           ENDS+KALDDLTNP++N+AIQ  IESRKRKR ++    KIEQLV+MGFER RV+EA RAG
Sbjct: 387 ENDSEKALDDLTNPQTNTAIQHDIESRKRKRNQRKVGTKIEQLVSMGFERSRVVEAVRAG 446

Query: 301 GDDIHQIMLQLLGEPGSNPTAAANNNASTSISMPNNGEPSSSINNENVEGDPDSSFEETS 360
           G  + Q M QLL    +NPTA+A N  S SIS P + +   S+N +N+  D D+  E  S
Sbjct: 447 G-SVEQAMQQLLTGSMTNPTASATN--SDSISRPTS-DAVDSLNQDNLSDDNDT--EGPS 500

Query: 361 ATEDVNGRDVEMEDELANDLT-GDVFADYDIEVTKEGEAISEYLSLLDSV 409
           A+E V  RD+EMED +A ++  GD  +DYDIEVTKEGEAI+EY++LL+SV
Sbjct: 501 ASE-VEQRDLEMEDTIAEEIAKGDALSDYDIEVTKEGEAINEYMALLNSV 549

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224120288|ref|XP_002331011.1| predicted protein [Populus trichocarpa] gi|222872941|gb|EEF10072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142489|ref|XP_002324589.1| predicted protein [Populus trichocarpa] gi|222866023|gb|EEF03154.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225463067|ref|XP_002268993.1| PREDICTED: NEDD8 ultimate buster 1 [Vitis vinifera] gi|296084548|emb|CBI25569.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388521561|gb|AFK48842.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356556537|ref|XP_003546581.1| PREDICTED: uncharacterized protein LOC100804062 [Glycine max] Back     alignment and taxonomy information
>gi|356530579|ref|XP_003533858.1| PREDICTED: NEDD8 ultimate buster 1-like [Glycine max] Back     alignment and taxonomy information
>gi|20198241|gb|AAM15479.1| hypothetical protein [Arabidopsis thaliana] gi|110735108|gb|ABG89124.1| NUB1 [synthetic construct] Back     alignment and taxonomy information
>gi|42569006|ref|NP_178939.2| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] gi|63147404|gb|AAY34175.1| At2g12550 [Arabidopsis thaliana] gi|330251110|gb|AEC06204.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|133778854|gb|ABO38767.1| At2g12550 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
TAIR|locus:2060754562 NUB1 "homolog of human NUB1" [ 0.959 0.715 0.535 5.5e-109
FB|FBgn0031161646 CG15445 [Drosophila melanogast 0.947 0.614 0.245 1.9e-26
ZFIN|ZDB-GENE-060929-724593 zgc:153057 "zgc:153057" [Danio 0.551 0.389 0.287 6.4e-25
UNIPROTKB|Q9Y5A7615 NUB1 "NEDD8 ultimate buster 1" 0.570 0.388 0.281 1e-22
UNIPROTKB|F1SSM7563 NUB1 "Uncharacterized protein" 0.570 0.424 0.289 2e-22
UNIPROTKB|E1BZ00616 NUB1 "Uncharacterized protein" 0.570 0.387 0.273 9.5e-22
ZFIN|ZDB-GENE-080212-11583 nub1 "negative regulator of ub 0.551 0.396 0.271 1.6e-21
UNIPROTKB|Q05B69614 NUB1 "Negative regulator of ub 0.570 0.389 0.281 3.4e-21
MGI|MGI:1889001614 Nub1 "negative regulator of ub 0.560 0.382 0.291 4.5e-21
RGD|1359489613 Nub1 "negative regulator of ub 0.560 0.383 0.280 3.4e-20
TAIR|locus:2060754 NUB1 "homolog of human NUB1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1077 (384.2 bits), Expect = 5.5e-109, P = 5.5e-109
 Identities = 225/420 (53%), Positives = 291/420 (69%)

Query:     2 MMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFM 61
             MMGLMLH  AKSLI+  MY DA+EVL M EE+F LCDPK+LE VDN P+++ID+VWCYF+
Sbjct:   143 MMGLMLHTKAKSLIEIEMYSDAVEVLAMAEESFLLCDPKILELVDNLPMMEIDIVWCYFL 202

Query:    62 LRDISWLSEAGIRLRKAREGIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHS 121
             LRDI  LS+AG+RL +AR+G+ERAHGKD SRVRLLQAG+ PE+A++LR+ELLEGV AYH+
Sbjct:   203 LRDIKCLSDAGVRLVRARKGLERAHGKDLSRVRLLQAGQSPEMAIYLRLELLEGVVAYHT 262

Query:   122 GQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLXX 181
             GQ DKA NAL SA AKF QLQ+PDE+LSLVM MGF+E+DAKRALR+ +QD+ S++DFL  
Sbjct:   263 GQNDKALNALKSAHAKFLQLQIPDETLSLVMGMGFQEKDAKRALRLNNQDIASSVDFLIE 322

Query:   182 XXXXXXXXXXDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNE 241
                        + QR+ EI+EQK+YG+TP+KKAVD++ ++ LVSIG+ +EL AE+LRRNE
Sbjct:   323 ERAKKAQKREQDLQRQSEILEQKKYGVTPMKKAVDMQMLERLVSIGYARELAAESLRRNE 382

Query:   242 NDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGG 301
             ND QKALD LT+P+ NS IQ YIESRKRKR  Q     + +LV+MGFER +   A  AGG
Sbjct:   383 NDIQKALDILTDPKVNSTIQAYIESRKRKRQEQLVGISVAELVSMGFERGKATSALEAGG 442

Query:   302 ---DDIHQIMLQLLGEPGXXXXXXXXXXXXXXXXMPNNGEPSSSINNENVEGDPDSSFEE 358
                D I +++   +  PG                  N G  SS       E D +   E 
Sbjct:   443 SREDTIQRLLSASVANPGTTTTSVINATSSTN----NVGAESSGFGG-GAEQDSEMKDET 497

Query:   359 TS-----ATEDVNG----RDVEMEDELANDLTG-DVFADYDIEVTKEGEAISEYLSLLDS 408
             T      A+   +G    RD E+EDE+A+++   D  + YDI + KE EAI+EYL++LD+
Sbjct:   498 TDDIANRASTSSDGMEEERDSEIEDEIADEIARVDALSAYDINLDKEIEAINEYLAMLDA 557
GO:0005634 "nucleus" evidence=ISM
FB|FBgn0031161 CG15445 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-724 zgc:153057 "zgc:153057" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5A7 NUB1 "NEDD8 ultimate buster 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSM7 NUB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZ00 NUB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080212-11 nub1 "negative regulator of ubiquitin-like proteins 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B69 NUB1 "Negative regulator of ubiquitin-like proteins 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1889001 Nub1 "negative regulator of ubiquitin-like proteins 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359489 Nub1 "negative regulator of ubiquitin-like proteins 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_1520134
hypothetical protein (566 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
cd0019438 cd00194, UBA, Ubiquitin Associated domain 8e-06
pfam0062737 pfam00627, UBA, UBA/TS-N domain 5e-05
smart0016537 smart00165, UBA, Ubiquitin associated domain 2e-04
pfam0062737 pfam00627, UBA, UBA/TS-N domain 0.003
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information 
 Score = 42.1 bits (100), Expect = 8e-06
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 145 DESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVE 181
           +E L  ++ MGF  ++A++ALR  + +V  A+++L+E
Sbjct: 2   EEKLEQLLEMGFSREEARKALRATNNNVERAVEWLLE 38

The UBA domain is a commonly occurring sequence motif in some members of the ubiquitination pathway, UV excision repair proteins, and certain protein kinases. Although its specific role is so far unknown, it has been suggested that UBA domains are involved in conferring protein target specificity. The domain, a compact three helix bundle, has a conserved GFP-loop and the proline is thought to be critical for binding. The UBA domain is distinct from the conserved three helical domain seen in the N-terminus of EF-TS and eukaryotic NAC proteins. Length = 38
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 419
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 100.0
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.81
KOG0011340 consensus Nucleotide excision repair factor NEF2, 99.79
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 99.72
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 99.7
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 99.57
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 99.45
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 99.17
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 99.11
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 98.92
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.91
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.9
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.78
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.77
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 97.64
KOG0011340 consensus Nucleotide excision repair factor NEF2, 97.28
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.22
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 95.09
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 94.95
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 94.75
smart0054643 CUE Domain that may be involved in binding ubiquit 94.54
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.42
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 93.87
cd00189100 TPR Tetratricopeptide repeat domain; typically con 93.78
smart0054643 CUE Domain that may be involved in binding ubiquit 93.77
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 92.66
PRK09377290 tsf elongation factor Ts; Provisional 92.38
TIGR00116290 tsf translation elongation factor Ts. This protein 92.38
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 92.09
PRK02603172 photosystem I assembly protein Ycf3; Provisional 92.02
PRK12332198 tsf elongation factor Ts; Reviewed 92.02
PRK12332198 tsf elongation factor Ts; Reviewed 92.01
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 92.0
PRK09377290 tsf elongation factor Ts; Provisional 91.96
KOG2689 290 consensus Predicted ubiquitin regulatory protein [ 91.88
TIGR00116290 tsf translation elongation factor Ts. This protein 91.72
PRK06369115 nac nascent polypeptide-associated complex protein 91.27
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 90.68
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.66
CHL00098200 tsf elongation factor Ts 90.28
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 90.27
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 90.1
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 90.09
CHL00098200 tsf elongation factor Ts 89.93
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.34
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 88.82
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 87.48
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 87.21
PRK02603172 photosystem I assembly protein Ycf3; Provisional 87.14
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 85.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 85.32
PRK06369115 nac nascent polypeptide-associated complex protein 84.67
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 84.26
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 84.06
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 83.92
CHL00033168 ycf3 photosystem I assembly protein Ycf3 83.57
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 82.65
COG0264296 Tsf Translation elongation factor Ts [Translation, 82.47
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 82.22
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 81.79
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 81.41
PRK04841903 transcriptional regulator MalT; Provisional 81.4
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 81.35
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 80.89
CHL00033168 ycf3 photosystem I assembly protein Ycf3 80.58
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 80.26
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-100  Score=765.76  Aligned_cols=398  Identities=43%  Similarity=0.675  Sum_probs=336.0

Q ss_pred             CchhhhhhHhHHHHHHhhchHHHHHHHHhhhhhhccCChhhhhhccchhhhhhhHHHHHHHhCCCCCHHHHHHHHHHHHH
Q 014748            1 MMMGLMLHANAKSLIKRHMYKDALEVLTMGEEAFSLCDPKVLEFVDNGPLLQIDMVWCYFMLRDISWLSEAGIRLRKARE   80 (419)
Q Consensus         1 l~~~~~lhek~r~~~~~~~y~~aL~~ll~ade~F~~C~~~~l~~vDN~a~L~lDivWcy~~l~~~~~l~dA~~rL~~ae~   80 (419)
                      ||||||||||||++|+|++|++||++||+|||+||+|+||||++|||||||||||||||||||||+|||||+.||.+|++
T Consensus       160 lmmglg~hekaRa~m~re~y~eAl~~LleADe~F~~Cd~klLe~VDNyallnLDIVWCYfrLknitcL~DAe~RL~ra~k  239 (568)
T KOG2561|consen  160 LMMGLGLHEKARAAMEREMYSEALLVLLEADESFSLCDSKLLELVDNYALLNLDIVWCYFRLKNITCLPDAEVRLVRARK  239 (568)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhHHHHhhhHHHHHhhcchhhhhcchhheehhhcccccCChHHHHHHHHHH
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCChHHHHHHHcCCcchhhHHHHHHHHhHhhhhccCChhHHHHHhHhHHhhhccCCCCHHHHHHHHhCCCCHHH
Q 014748           81 GIERAHGKDSSRVRLLQAGRHPELALHLRMELLEGVAAYHSGQFDKARNALTSAQAKFFQLQVPDESLSLVMSMGFKEQD  160 (419)
Q Consensus        81 ~f~r~yG~~~~Rl~~lkg~~~~E~aL~lRL~LLqgvv~~~~g~~~eA~~~L~~a~~~~~~l~vdee~l~~LmeMGF~~~~  160 (419)
                      ||.+|||+|++||++|||++|||++||||||||||||+||+|++++|++.|+.|..++.+++++++.++.||+|||.+++
T Consensus       240 gf~~syGenl~Rl~~lKg~~spEraL~lRL~LLQGV~~yHqg~~deAye~le~a~~~l~elki~d~~lsllv~mGfeesd  319 (568)
T KOG2561|consen  240 GFERSYGENLSRLRSLKGGQSPERALILRLELLQGVVAYHQGQRDEAYEALESAHAKLLELKINDETLSLLVGMGFEESD  319 (568)
T ss_pred             hhhhhhhhhhHhhhhccCCCChhHHHHHHHHHHHHHHHHHcCCcHHHHHHHHHHHHHHHHeeccchHHHHHHHcCCCchH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCHHHHHHHHHhchhhhhhhhhhhHHHHHHHHHHhhcCCCCCCCcCCHHHHHHHHhCCCCHHHHHHHHHhc
Q 014748          161 AKRALRICSQDVGSAIDFLVEEKAKRVKEREDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRN  240 (419)
Q Consensus       161 ArrALrat~gdve~Av~~L~e~~~d~~~~~~~~~~~~~~~~~~~~~g~t~~~~~v~~~~l~~L~~MGF~~~~A~~ALr~t  240 (419)
                      ||+|||.|+|+|++|++||+++++...+.|.++..+.++.-.+++|+.++++.||+|..|..|++|||.+..|..||+.|
T Consensus       320 aRlaLRsc~g~Vd~AvqfI~erre~laq~R~k~~a~Ere~~~r~k~~n~~~~~wvn~rs~~rL~~mGyer~la~eaL~r~  399 (568)
T KOG2561|consen  320 ARLALRSCNGDVDSAVQFIIERREKLAQKREKDLAREREILERKKYGNTPMKKWVNPRSLERLVSMGYERELAAEALRRN  399 (568)
T ss_pred             HHHHHHhccccHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhcCCCcccccCHHHHHHHHhcchHhHHHHHHHHhc
Confidence            99999999999999999999999999888866665666666788999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHhhcCCcchhHHhhhhhHHhhhhhccchHHHHHHHHhCCCCHHHHHHHHHHcCCCHHHHHHHhhcCCCCCCc
Q 014748          241 ENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDIHQIMLQLLGEPGSNPT  320 (419)
Q Consensus       241 ~nnve~Al~~L~npd~~~~L~~~~~~~~~~~~~~~d~~~I~~L~~MGF~~~~A~~AL~~~~nN~e~A~d~Ll~~~~~~~~  320 (419)
                      +||+..|+++|++|.  ++|..+    +..++.+++...|.+|++|||++-.|+.||++++||++.|+++|..+...+++
T Consensus       400 ~Ndi~~aldllq~es--del~~n----~~~~p~~vd~~~la~Lv~mGF~e~~A~~ALe~~gnn~~~a~~~L~~s~~n~~~  473 (568)
T KOG2561|consen  400 ENDIQKALDLLQDES--DELESN----KPKRPEQVDGISLAELVSMGFEEGKARSALEAGGNNEDTAQRLLSASVANEGE  473 (568)
T ss_pred             cCcHHHHHHhcCCcc--hhhhcc----CCCCCcccchhhHHHHHHhccccchHHHHHHhcCCcHHHHHHHHHHhCCCCcc
Confidence            999999999998775  234333    22344567899999999999999999999999999999999999876554332


Q ss_pred             c---ccCCCCCCCCCCCC-----CCCC-CCCCCCCCCCCCCCCCccccccccccCCCChhHHHHHHhhhc-CCccccccc
Q 014748          321 A---AANNNASTSISMPN-----NGEP-SSSINNENVEGDPDSSFEETSATEDVNGRDVEMEDELANDLT-GDVFADYDI  390 (419)
Q Consensus       321 ~---~~~~s~s~~~~~~~-----~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~rd~~~e~el~~ei~-~d~~~dyD~  390 (419)
                      .   -...++|+...+|+     +++. ++.|-+++.+.  -.-.++.+ ......+|+..++|..+|+. -++.++||+
T Consensus       474 ~l~~~~~~t~s~en~gp~ssg~~tsastd~~m~~e~~~~--i~iletv~-~hae~eidS~~a~erfned~~~~~leyldl  550 (568)
T KOG2561|consen  474 LLTSVINATSSTENVGPESSGFGTSASTDSEMVDETTDD--IAILETVS-DHAEEEIDSYIADERFNEDLRVDALEYLDL  550 (568)
T ss_pred             ccccccccccCCCCCCCCcCCCCcccCCCchhhhcCCch--HHHHHhhh-hHHHHHHHhhhHHhhhchhhhhhhHhhhcC
Confidence            1   11112222211222     2211 11122221110  00111111 23345567777777778777 566677799


Q ss_pred             chhhHHHHHHHHHHHhh
Q 014748          391 EVTKEGEAISEYLSLLD  407 (419)
Q Consensus       391 ~l~~E~~~i~eYlsll~  407 (419)
                      .+++|.++|+||+.+|+
T Consensus       551 ~ldqee~~l~ey~~ml~  567 (568)
T KOG2561|consen  551 PLDQEEEILNEYLAMLD  567 (568)
T ss_pred             ccchHHHHHHHHHHHhc
Confidence            99999999999999986

>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>TIGR00116 tsf translation elongation factor Ts Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00116 tsf translation elongation factor Ts Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>CHL00098 tsf elongation factor Ts Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>CHL00098 tsf elongation factor Ts Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 3e-14
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 2e-04
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 9e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 2e-06
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 3e-05
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 2e-04
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 3e-04
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
 Score = 67.7 bits (165), Expect = 3e-14
 Identities = 23/114 (20%), Positives = 46/114 (40%), Gaps = 4/114 (3%)

Query: 145 DESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKAKRVKEREDNEQRRKEIMEQK 204
            + +  V++MG+  +   RA++    ++   +D+L        K  +         M Q 
Sbjct: 9   RQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQC 68

Query: 205 RYGLTPLKKAVDIEKIKELVSIGFEKELVAEALRRNENDSQKALDDLTNPESNS 258
               +  K    ++ + +   +GFE + + E L  + ND   AL+DL      S
Sbjct: 69  ----SEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGAS 118
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 99.83
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.83
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.83
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.79
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.34
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.34
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.29
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.27
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.27
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.25
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.25
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.25
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.24
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.23
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.22
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.21
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.2
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.19
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.19
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.18
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.16
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.16
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.15
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.15
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.13
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 99.12
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.1
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.08
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.05
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.04
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.04
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.04
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.04
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 99.01
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 98.99
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 98.99
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 98.99
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 98.98
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 98.98
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 98.97
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 98.96
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 98.95
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 98.95
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 98.92
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 98.9
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 98.88
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 98.88
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 98.86
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 98.86
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.8
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.8
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.79
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.78
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.78
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.77
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.77
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.76
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.74
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.65
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.63
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.56
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.52
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.47
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.45
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.44
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.35
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 98.28
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 98.27
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 98.26
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 98.22
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.22
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.98
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 97.87
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 97.83
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 97.78
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 97.69
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.67
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.64
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 97.37
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 97.31
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 97.07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.03
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.02
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.84
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.75
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.69
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 96.65
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.54
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.48
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.45
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.4
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 96.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.37
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.34
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.29
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.2
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.12
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.09
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.01
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 95.99
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 95.96
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 95.92
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.87
3q15_A378 PSP28, response regulator aspartate phosphatase H; 95.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 95.84
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.74
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.62
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.56
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.43
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.27
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.05
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 94.99
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 94.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 94.78
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 94.75
4fp9_B335 Mterf domain-containing protein 2; modification en 94.74
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 94.68
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.66
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.61
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 94.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.52
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 94.39
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 94.37
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 94.12
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 94.11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.01
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 93.97
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 93.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 93.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 93.87
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 93.86
2gw1_A 514 Mitochondrial precursor proteins import receptor; 93.72
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 93.7
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 93.59
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 93.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.46
3u3w_A293 Transcriptional activator PLCR protein; ternary co 93.27
3u4t_A272 TPR repeat-containing protein; structural genomics 93.25
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 93.19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 93.16
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.08
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 93.07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 92.94
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.91
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 92.91
2dhy_A67 CUE domain-containing protein 1; structural genomi 92.85
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 92.79
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 92.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 92.52
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 92.37
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.29
4g1t_A472 Interferon-induced protein with tetratricopeptide 92.12
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 92.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 91.97
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 91.86
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 91.75
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 91.71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 91.56
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 91.48
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 91.34
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 91.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 91.27
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 91.24
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 91.03
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 90.91
1aip_C196 EF-TS, elongation factor TS; nucleotide exchange, 90.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 90.74
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 90.74
1xb2_B291 EF-TS, elongation factor TS, mitochondrial, EF-TSM 90.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 90.51
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 90.32
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 90.27
1xb2_B291 EF-TS, elongation factor TS, mitochondrial, EF-TSM 90.16
3u3w_A293 Transcriptional activator PLCR protein; ternary co 90.14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 90.11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 89.87
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 89.81
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 89.81
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 89.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 89.54
1aip_C196 EF-TS, elongation factor TS; nucleotide exchange, 89.37
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 89.36
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 89.25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 89.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 88.84
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 88.64
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 88.55
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 88.32
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 88.3
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 88.05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 88.04
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 87.98
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 87.72
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 87.18
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 87.13
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 86.98
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 86.9
3u4t_A272 TPR repeat-containing protein; structural genomics 86.89
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 86.74
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 86.43
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 86.32
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 86.29
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 85.89
3qww_A433 SET and MYND domain-containing protein 2; methyltr 85.81
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 85.45
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 85.38
2gw1_A514 Mitochondrial precursor proteins import receptor; 85.32
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 85.1
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 84.54
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 84.44
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 84.39
2dhy_A67 CUE domain-containing protein 1; structural genomi 83.96
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 83.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 82.99
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 82.96
1ixs_A62 Holliday junction DNA helicase RUVA; heterodimeric 82.41
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 82.4
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 82.14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 81.54
4fp9_B335 Mterf domain-containing protein 2; modification en 80.42
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 80.42
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 80.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 80.33
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
Probab=99.83  E-value=6.2e-20  Score=158.51  Aligned_cols=106  Identities=22%  Similarity=0.358  Sum_probs=74.7

Q ss_pred             HHHHHHHHhCCCCHHHHHHHHHHhCCCHHHHHHHHHhchhhhhhhhhhhHHHHHHHHHHhhcCCCCCCCcCCHHHHHHHH
Q 014748          145 DESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVEEKAKRVKEREDNEQRRKEIMEQKRYGLTPLKKAVDIEKIKELV  224 (419)
Q Consensus       145 ee~l~~LmeMGF~~~~ArrALrat~gdve~Av~~L~e~~~d~~~~~~~~~~~~~~~~~~~~~g~t~~~~~v~~~~l~~L~  224 (419)
                      .+.|++|++|||++.+|++||+.|+||++.||+||++|+.                                      |.
T Consensus         9 ~~~v~~l~~MGFp~~~~~kAl~~~g~~~e~amewL~~h~~--------------------------------------L~   50 (118)
T 4ae4_A            9 RQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQ--------------------------------------LC   50 (118)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHHHHCSCHHHHHHHHHHHHH--------------------------------------HH
T ss_pred             HHHHHHHHHcCCCHHHHHHHHHHHCcCHHHHHHHHHHhch--------------------------------------hc
Confidence            4679999999999999999999999999999999998842                                      23


Q ss_pred             hCCCCHHHHHHHHHhcCCCHHHHHHhhcCCcchhHHhhhhhHHhhhhhccchHHHHHHHHhCCCCHHHHHHHHHHcCCCH
Q 014748          225 SIGFEKELVAEALRRNENDSQKALDDLTNPESNSAIQLYIESRKRKRCRQAADAKIEQLVAMGFERPRVIEACRAGGDDI  304 (419)
Q Consensus       225 ~MGF~~~~A~~ALr~t~nnve~Al~~L~npd~~~~L~~~~~~~~~~~~~~~d~~~I~~L~~MGF~~~~A~~AL~~~~nN~  304 (419)
                      +.||+...+-.++..+.++-..+                          .++...|.+|++|||++++|++||+.|+||+
T Consensus        51 d~~~d~~~~e~~l~~~~~~~~~~--------------------------~~~~~~v~~L~eMGF~~~~a~~AL~~~~nd~  104 (118)
T 4ae4_A           51 EKGFDPLLVEEALEMHQCSEEKM--------------------------MEFLQLMSKFKEMGFELKDIKEVLLLHNNDQ  104 (118)
T ss_dssp             HTTCCHHHHHHHHHHCSSCHHHH--------------------------HHHHHHHHHHHHTTCCHHHHHHHHHHTTTCH
T ss_pred             ccCCChhhhHHHHHhccCCcccc--------------------------ccCHHHHHHHHHcCCCHHHHHHHHHHcCCCH
Confidence            44555544444444333221110                          1234567777777777777777777777777


Q ss_pred             HHHHHHhhcC
Q 014748          305 HQIMLQLLGE  314 (419)
Q Consensus       305 e~A~d~Ll~~  314 (419)
                      ++|++|||+.
T Consensus       105 erAlewL~~~  114 (118)
T 4ae4_A          105 DNALEDLMAR  114 (118)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHh
Confidence            7777777754
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 419
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 3e-05
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 8e-05
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 0.001
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 6e-05
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 3e-04
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 1e-04
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 1e-04
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 0.002
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 2e-04
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 0.002
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 0.002
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 3e-04
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 8e-04
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 0.004
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Tudor domain containing protein 3, TDRD3
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.4 bits (92), Expect = 3e-05
 Identities = 9/40 (22%), Positives = 24/40 (60%)

Query: 142 QVPDESLSLVMSMGFKEQDAKRALRICSQDVGSAIDFLVE 181
            V +++L  +  MGF ++ +++AL     ++ +A++ L+ 
Sbjct: 7   GVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLT 46
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.31
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.31
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.3
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.3
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.3
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.29
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.29
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.19
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.18
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.18
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.16
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.16
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.16
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.14
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.12
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 99.11
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.09
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.05
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.02
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 98.8
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 98.75
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 98.68
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 98.23
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 98.14
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.11
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.07
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 97.98
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.98
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.93
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 97.72
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 97.7
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 97.14
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 97.06
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 96.82
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.62
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 96.58
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 96.52
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 96.47
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.38
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 96.35
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 96.33
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 96.26
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 96.26
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 96.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.14
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.01
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.27
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 95.03
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 94.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.55
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.32
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 94.01
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 93.91
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 93.22
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 92.88
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 92.39
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 92.21
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 91.41
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 91.24
d1hz4a_366 Transcription factor MalT domain III {Escherichia 91.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 90.7
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 90.63
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 90.29
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 89.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 89.6
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 89.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 89.37
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 88.63
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 88.06
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 87.77
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 86.13
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 84.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 83.22
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 82.73
d2k0bx152 Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax 82.52
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 80.6
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Suppressor of T-cell receptor signaling 2 (STS-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.31  E-value=4e-13  Score=97.76  Aligned_cols=46  Identities=20%  Similarity=0.296  Sum_probs=41.6

Q ss_pred             CHHHHHHHHhCCCCHHHHHHHHHHhCC-CHHHHHHHHHhchhhhhhh
Q 014748          144 PDESLSLVMSMGFKEQDAKRALRICSQ-DVGSAIDFLVEEKAKRVKE  189 (419)
Q Consensus       144 dee~l~~LmeMGF~~~~ArrALrat~g-dve~Av~~L~e~~~d~~~~  189 (419)
                      +++.|++|++|||+++.|++||+.++| ++++|++||++|+++++..
T Consensus         2 ~p~~v~~L~~MGF~~~~a~~Al~~t~n~~ve~A~~Wl~~h~~d~d~d   48 (51)
T d2crna1           2 SPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLD   48 (51)
T ss_dssp             SCSSHHHHHHTSCCHHHHHHHHHHHTSCCHHHHHHHHHHHSSSTTSC
T ss_pred             CHHHHHHHHHcCCCHHHHHHHHHHHCCCCHHHHHHHHHHcCCCcCcC
Confidence            567899999999999999999999965 8999999999999887543
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure