Citrus Sinensis ID: 014829

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKKDGNINIGTEEIVASIEEDIPLPATPIVASIEEDIPLPATPTLEKETLPSTALVGCMDLDSFAEDKETTDKIVRSPCRQEDNGLDSSEVREKSVLCSGEETRINNKSMLCRTGEEKETEILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDTRVTNTFEGRQIGNNVPTSEELVSANGDSVSLRSCSSVNSFFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESGDKDEPKSHEGEDETDCEKQNAMVAWLLS
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHHHHcc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHcHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHccccHHHccccccccccccccHcccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccEEEccccccccccccccccccccHHcccHHHHHHHc
mgrapccekvglkkgrwtaeEDDILTKYIQAngegswrslpknagllrcgksCRLRWINYLRADlkrgnitaEEEEIIIKLHASLGNRWSliasnmpgrtdneIKNYWNshlsrkihtfwrpssektlpvkvdvaaagtgvasdrkaGKKIGSAIMknkshskkdgninigTEEIVASIeediplpatpivasieediplpatptleketlpstalvgcmdldsfaedkettdkivrspcrqedngldssevreksvlcsgeetrinnksmlcrtgeeketeilepfegiddaklcfndlldpneVWTLMEEKdtrvtntfegrqignnvptseelvsangdsvslrscssvnsffddsnfdwdwenviqdydpqrdenENVLSWLWesgdkdepkshegedetdcEKQNAMVAWLLS
mgrapccekvglkkgrwtaeedDILTKYIQangegswrslpknaGLLRCGKSCRLRWINYLRadlkrgnitAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTfwrpssektlpvKVDVAaagtgvasdrkagkkigsaimknkshskkdgninIGTEEIVASIEEDIPLPATPIVASIEEDIPLPATPTLEKETLPSTALVGCMDLDSFAEdkettdkivrspcrqedngldssevreksvlcsgeetrinnksmlcrtGEEKETEILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDtrvtntfegrqignnvptseELVSANGDSVSLRSCSSVNSFFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESGDKDEPKshegedetdcekQNAMVAWLLS
MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKKDGNINIGTEEIVASIEEDIPLPATPIVASIEEDIPLPATPTLEKETLPSTALVGCMDLDSFAEDKETTDKIVRSPCRQEDNGLDSSEVREKSVLCSGEETRINNKSMLCRTGEEKETEILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDTRVTNTFEGRQIGNNVPTSEELVSANGDsvslrscssvnsffddsnfdwdwENVIQDYDPQRDENENVLSWLWESGDKDEPKSHEGEDETDCEKQNAMVAWLLS
*****CCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPS**KTLPVKVDVAA********************************NIGTEEIVASIEEDIPLPATPIVASIEEDI***************TALVGCMDL***********************************************************EILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDTRVTNTF***************************CSSVNSFFDDSNFDWDWENVIQDYDPQ***NENVLSWLW*******************************
*GRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSR***********************************************************************************************************************************************************************EILEPFEGIDDAKLCFNDLLD****************************************************FFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESGDKDE***********CEKQNAMVAWLLS
MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKKDGNINIGTEEIVASIEEDIPLPATPIVASIEEDIPLPATPTLEKETLPSTALVGCMDLDSFAEDKETTDKIVRSPCRQEDNGLDSSEVREKSVLCSGEETRINNKSMLCRTGEEKETEILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDTRVTNTFEGRQIGNNVPTSEELVSANGDSVSLRSCSSVNSFFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESGD****************KQNAMVAWLLS
***APCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPSSEKT************************************************************************************************************************DS****EKSVL**GEETRINNKSMLCRTGEEKETEILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDTRVTNTFEGRQIGN************************NSFFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESG***********DETDCEKQNAMVAWLLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKKDGNINIGTEEIVASIEEDIPLPATPIVASIEEDIPLPATPTLEKETLPSTALVGCMDLDSFAEDKETTDKIVRSPCRQEDNGLDSSEVREKSVLCSGEETRINNKSMLCRTGEEKETEILEPFEGIDDAKLCFNDLLDPNEVWTLMEEKDTRVTNTFEGRQIGNNVPTSEELVSANGDSVSLRSCSSVNSFFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESGDKDEPKSHEGEDETDCEKQNAMVAWLLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query418 2.2.26 [Sep-21-2011]
O22264371 Transcription factor MYB1 yes no 0.382 0.431 0.676 5e-60
P27898399 Myb-related protein P OS= N/A no 0.289 0.303 0.842 1e-58
P20026267 Myb-related protein Hv1 O N/A no 0.277 0.434 0.75 1e-48
P81393232 Myb-related protein 308 O N/A no 0.277 0.5 0.75 2e-48
Q9SZP1282 Transcription repressor M no no 0.277 0.411 0.741 2e-48
P81395274 Myb-related protein 330 O N/A no 0.277 0.423 0.75 6e-48
P20025255 Myb-related protein Zm38 N/A no 0.277 0.454 0.715 3e-47
O49608274 Transcription factor MYB3 no no 0.277 0.423 0.724 6e-47
Q38851236 Transcription repressor M no no 0.277 0.491 0.724 7e-47
Q7XBH4257 Myb-related protein Myb4 no no 0.277 0.451 0.698 9e-47
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function desciption
 Score =  232 bits (591), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 111/164 (67%), Positives = 133/164 (81%), Gaps = 4/164 (2%)

Query: 1   MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60
           MGRAPCCEKVG+K+GRWTAEED IL+ YIQ+NGEGSWRSLPKNAGL RCGKSCRLRWINY
Sbjct: 1   MGRAPCCEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINY 60

Query: 61  LRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFW 120
           LR+DLKRGNIT EEEE+++KLH++LGNRWSLIA ++PGRTDNEIKNYWNSHLSRK+H F 
Sbjct: 61  LRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKLHNFI 120

Query: 121 RP---SSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSH 161
           R    S + +  +  + ++A     + R+ G+   SA MK K H
Sbjct: 121 RKPSISQDVSAVIMTNASSAPPPPQAKRRLGRTSRSA-MKPKIH 163
Transcription factor that activates the expression of CHS, CHI, F3H and FLS1. Flavonol-specific activator of flavonoid biosynthesis.
Arabidopsis thaliana (taxid: 3702)
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query418
2921336453 MYB-like DNA-binding domain protein [Gos 0.906 0.836 0.510 1e-90
224128372417 predicted protein [Populus trichocarpa] 0.933 0.935 0.503 3e-83
225437513367 PREDICTED: transcription factor MYB12 [V 0.849 0.967 0.460 4e-73
254940122367 R2R3 MYB transcription factor [Vitis vin 0.854 0.972 0.450 1e-71
258558776367 MYBF1 [Vitis vinifera] 0.854 0.972 0.448 4e-71
40643880368 MYB1 protein [Gerbera hybrid cultivar] 0.808 0.918 0.386 2e-66
225431879383 PREDICTED: uncharacterized protein LOC10 0.846 0.924 0.416 2e-65
356500104349 PREDICTED: uncharacterized protein LOC10 0.827 0.991 0.406 2e-64
356570989354 PREDICTED: uncharacterized protein LOC10 0.803 0.949 0.403 3e-64
71041100364 MYB22 [Malus x domestica] 0.387 0.445 0.713 8e-64
>gi|2921336|gb|AAC04718.1| MYB-like DNA-binding domain protein [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  340 bits (871), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 219/429 (51%), Positives = 261/429 (60%), Gaps = 50/429 (11%)

Query: 1   MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60
           MGRAPCCEKVGLKKGRWTAEED +LTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINY
Sbjct: 1   MGRAPCCEKVGLKKGRWTAEEDVLLTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60

Query: 61  LRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFW 120
           LRADLKRGN T++EEE+II LHA+LGNRWSLIAS +PGRTDNEIKNYWNSHLSRKIH+F 
Sbjct: 61  LRADLKRGNFTSQEEEVIINLHATLGNRWSLIASYLPGRTDNEIKNYWNSHLSRKIHSFR 120

Query: 121 RPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHS--KKDGNI-NIGTEEIVA 177
           RP ++ ++PV +D+    T V + RK G+    ++ +NKS S  K  G+  N  TE +  
Sbjct: 121 RPLTQ-SMPVIMDLTK--TAVIAKRKGGRTSEGSMKENKSCSTQKDTGSCSNKPTENVC- 176

Query: 178 SIEEDIPLPATPIVASIEEDIPLPATPTLEKETLPSTALVGCMDLDSFAEDKETTDKIVR 237
                           + E  P P+TP LEKETL +TA+   M LD   EDKE T  +V 
Sbjct: 177 ----------------VNEVEPFPSTPLLEKETLSTTAIEDRMVLDQHGEDKERTTHVVP 220

Query: 238 SPCRQE--DNGLDSSEVREKSVLCSGEETRINNKSMLCRTGE-EKETEILEPFEGIDDAK 294
           SPC     +  L SSE RE  V    EE  I N SM C +G  EK T IL P E ID ++
Sbjct: 221 SPCHDTVVEGMLGSSEERESLVT---EEGTIEN-SMQCPSGNAEKGTGILAPHESIDSSE 276

Query: 295 L-CFNDLLD-----PNEVWTLMEEKDTRVTNTFEGRQIGNNVPTSEELVSANGDSVS--- 345
           +  FND+LD     P+   T  E  + R  N        NN    EE+VS N  + S   
Sbjct: 277 IEWFNDILDSELLQPSGHLTFTELGEDRW-NVKTHTTAANN----EEIVSRNCSADSGGV 331

Query: 346 LRSCSSVNSFFDDSNFDWDWENVIQDYDPQRDENENVLSWLWESGDKDEPKSHEGEDETD 405
           L SC+S   +F D     DWENV+   +   DE E + SWLWE  D          D+  
Sbjct: 332 LSSCTSTTFYFVD-----DWENVVPRSE-LWDEKEYMCSWLWEPSDYHGKGERHKVDDNG 385

Query: 406 CEKQNAMVA 414
            E  N M+A
Sbjct: 386 FEGHNPMIA 394

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224128372|ref|XP_002320313.1| predicted protein [Populus trichocarpa] gi|222861086|gb|EEE98628.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225437513|ref|XP_002269995.1| PREDICTED: transcription factor MYB12 [Vitis vinifera] gi|297743957|emb|CBI36927.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|254940122|gb|ACT88298.1| R2R3 MYB transcription factor [Vitis vinifera] Back     alignment and taxonomy information
>gi|258558776|gb|ACV81697.1| MYBF1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|40643880|emb|CAD87007.1| MYB1 protein [Gerbera hybrid cultivar] Back     alignment and taxonomy information
>gi|225431879|ref|XP_002271862.1| PREDICTED: uncharacterized protein LOC100251652 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500104|ref|XP_003518874.1| PREDICTED: uncharacterized protein LOC100814275 [Glycine max] Back     alignment and taxonomy information
>gi|356570989|ref|XP_003553664.1| PREDICTED: uncharacterized protein LOC100817316 [Glycine max] Back     alignment and taxonomy information
>gi|71041100|gb|AAZ20438.1| MYB22 [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query418
TAIR|locus:2062040371 MYB12 "myb domain protein 12" 0.389 0.439 0.676 4.2e-63
TAIR|locus:2081735343 MYB11 "myb domain protein 11" 0.306 0.373 0.782 7.8e-60
TAIR|locus:2155944342 MYB111 "myb domain protein 111 0.358 0.438 0.709 2.8e-57
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.277 0.411 0.741 5.4e-47
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.277 0.465 0.689 1.4e-46
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.277 0.431 0.715 2.3e-46
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.277 0.423 0.724 3e-46
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.277 0.491 0.724 4.8e-46
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.277 0.451 0.706 6.2e-46
TAIR|locus:2141231350 MYB102 "MYB-like 102" [Arabido 0.277 0.331 0.681 9.7e-46
TAIR|locus:2062040 MYB12 "myb domain protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 603 (217.3 bits), Expect = 4.2e-63, Sum P(2) = 4.2e-63
 Identities = 113/167 (67%), Positives = 135/167 (80%)

Query:     1 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60
             MGRAPCCEKVG+K+GRWTAEED IL+ YIQ+NGEGSWRSLPKNAGL RCGKSCRLRWINY
Sbjct:     1 MGRAPCCEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINY 60

Query:    61 LRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFW 120
             LR+DLKRGNIT EEEE+++KLH++LGNRWSLIA ++PGRTDNEIKNYWNSHLSRK+H F 
Sbjct:    61 LRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKLHNFI 120

Query:   121 R-PSSEKTLP--VKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKK 164
             R PS  + +   +  + ++A     + R+ G+   SA MK K H  K
Sbjct:   121 RKPSISQDVSAVIMTNASSAPPPPQAKRRLGRTSRSA-MKPKIHRTK 166
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0009813 "flavonoid biosynthetic process" evidence=RCA;IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0010224 "response to UV-B" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2081735 MYB11 "myb domain protein 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155944 MYB111 "myb domain protein 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-53
PLN03091459 PLN03091, PLN03091, hypothetical protein; Provisio 3e-49
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-14
COG5147512 COG5147, REB1, Myb superfamily proteins, including 2e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 9e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 2e-08
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-05
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  177 bits (450), Expect = 3e-53
 Identities = 77/112 (68%), Positives = 95/112 (84%)

Query: 5   PCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRAD 64
           PCC K+G+K+G WT EED+IL  +I+  GEG WRSLPK AGLLRCGKSCRLRW+NYLR  
Sbjct: 16  PCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPS 75

Query: 65  LKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 116
           +KRG IT++EE++I++LH  LGNRWSLIA  +PGRTDNEIKNYWN+HL +K+
Sbjct: 76  VKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKL 127

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 418
PLN03091459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.97
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.78
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.78
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.76
PLN03212249 Transcription repressor MYB5; Provisional 99.74
PLN03091459 hypothetical protein; Provisional 99.67
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.58
COG5147512 REB1 Myb superfamily proteins, including transcrip 99.54
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.52
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.33
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.32
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.29
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.27
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.11
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.96
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.91
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.89
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.76
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.26
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.97
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.44
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.4
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.39
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.17
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.6
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.46
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.45
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.44
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.43
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.27
KOG1279506 consensus Chromatin remodeling factor subunit and 96.19
KOG1279506 consensus Chromatin remodeling factor subunit and 96.14
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.37
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.24
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.06
PRK13923170 putative spore coat protein regulator protein YlbO 94.75
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 94.46
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.31
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.98
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 93.69
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 92.78
PRK13923170 putative spore coat protein regulator protein YlbO 92.49
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.58
KOG2656445 consensus DNA methyltransferase 1-associated prote 89.72
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 89.25
KOG4282345 consensus Transcription factor GT-2 and related pr 85.21
KOG1194534 consensus Predicted DNA-binding protein, contains 84.2
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 83.5
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8e-35  Score=295.99  Aligned_cols=118  Identities=63%  Similarity=1.162  Sum_probs=114.6

Q ss_pred             CCCCccccCCCCccCCCCHHHHHHHHHHHHHhCCCCccccccccccccccccccchhhhhccCCCcCCCCCHHHHHHHHH
Q 014829            1 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIK   80 (418)
Q Consensus         1 mgR~p~c~kp~lkKg~WT~EED~~L~~lV~kyG~~~W~~IA~~l~~~Rs~~QCr~Rw~~~L~p~ikkg~WT~EED~~Ll~   80 (418)
                      |||++||+|++++||+||+|||++|+++|++||..+|..||+.++.+|+++|||+||.+||+|.+++++||+|||.+|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998755999999999999999999999999999999999


Q ss_pred             HHHhcCCChhHHhhhCCCCChHHHHHHHHHhhhhhhcC
Q 014829           81 LHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHT  118 (418)
Q Consensus        81 lv~~~G~~W~~IA~~lpgRT~~qck~Rw~~~L~~~i~~  118 (418)
                      +|.+||++|..||++|||||+++||+||+.+|+++++.
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~  118 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQ  118 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998754

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-20
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-20
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-20
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 5e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 2e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-10
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 5e-10
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 7e-10
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 4e-06
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 67/105 (63%), Gaps = 1/105 (0%)
Query: 12  LKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNIT 71
           L KG WT EED  + +++Q  G   W  + K+    R GK CR RW N+L  ++K+ + T
Sbjct: 25  LNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 83
Query: 72  AEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 116
            EE+ II + H  LGNRW+ IA  +PGRTDN +KN+WNS + RK+
Sbjct: 84  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-60
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 6e-60
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 9e-59
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 5e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-49
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-31
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-04
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-48
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 6e-23
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-19
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-05
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 4e-17
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 8e-08
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-12
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-05
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 4e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 5e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 7e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 2e-04
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 5e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 5e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  190 bits (486), Expect = 2e-60
 Identities = 50/105 (47%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 12  LKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNIT 71
           L KG WT EED  + K +Q  G   W  + K+    R GK CR RW N+L  ++K+ + T
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  AEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 116
            EE+ II + H  LGNRW+ IA  +PGRTDN IKN+WNS + RK+
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query418
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.97
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.94
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.81
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.77
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.75
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.74
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.73
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.69
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.67
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.66
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.65
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.62
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.62
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.61
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.6
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.6
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.59
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.59
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.54
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.54
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.53
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.52
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.5
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.49
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.49
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.48
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.48
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.47
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.46
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.4
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.1
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.36
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.34
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.31
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.3
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.28
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.27
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.27
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.23
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.82
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.19
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.14
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.12
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.11
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.1
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.05
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.88
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.84
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.82
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.65
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.53
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.51
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.48
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.36
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.33
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.3
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.27
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.17
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.14
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.04
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.9
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.85
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.82
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.77
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.7
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.87
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.64
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.38
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.21
2crg_A70 Metastasis associated protein MTA3; transcription 97.2
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.04
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.03
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.73
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.46
2crg_A70 Metastasis associated protein MTA3; transcription 96.32
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.31
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.15
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.13
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.13
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.04
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 93.46
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.25
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.02
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 88.85
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 83.23
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=2.1e-36  Score=272.64  Aligned_cols=152  Identities=27%  Similarity=0.509  Sum_probs=106.0

Q ss_pred             CCccCCCCHHHHHHHHHHHHHhCCCCccccccccccccccccccchhhhhccCCCcCCCCCHHHHHHHHHHHHhcCC-Ch
Q 014829           11 GLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGN-RW   89 (418)
Q Consensus        11 ~lkKg~WT~EED~~L~~lV~kyG~~~W~~IA~~l~~~Rs~~QCr~Rw~~~L~p~ikkg~WT~EED~~Ll~lv~~~G~-~W   89 (418)
                      ++++++||+|||++|+++|++||.++|..||..|++ |++.||++||.++|+|.+++++||++||.+|+++|.+||. +|
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W   81 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPN-RTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRW   81 (159)
T ss_dssp             -----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcCC-CCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccH
Confidence            478999999999999999999998899999999998 9999999999999999999999999999999999999995 79


Q ss_pred             hHHhhhCCCCChHHHHHHHHHhhhhhh-cCCCCCCCCCCCCcccccccCCCCcCcCCCCCCChhhhhcccCCCCC
Q 014829           90 SLIASNMPGRTDNEIKNYWNSHLSRKI-HTFWRPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSK  163 (418)
Q Consensus        90 ~~IA~~lpgRT~~qck~Rw~~~L~~~i-~~~~~~~ed~~l~~~~~~~g~k~~~iak~~~GRtS~s~knr~k~~~~  163 (418)
                      ..||.+|||||+.||++||+++|++.+ +..|+++++..+...+...|.+|..|++.++||+.+.++||.+...+
T Consensus        82 ~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt~~~~knr~~~~~r  156 (159)
T 1h89_C           82 SVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR  156 (159)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCCHHHHHHHHHTTTC
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHHHh
Confidence            999999999999999999999999988 67899999999999999999999999999999999999999765544
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 418
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-17
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-16
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-09
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 7e-15
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 7e-05
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 7e-14
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 8e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 9e-08
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-13
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 6e-06
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-05
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-06
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-04
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 71.7 bits (176), Expect = 8e-17
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 12 LKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRAD 64
          L KG WT EED  L K +Q  G   W  + K+    R GK CR RW N+L  +
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query418
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.66
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.61
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.56
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.56
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.47
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.45
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.43
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.4
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.37
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.37
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.37
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.36
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.33
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.28
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.23
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.19
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.18
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.16
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.15
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.06
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.05
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.01
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.78
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.76
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.56
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.9
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.89
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.53
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.34
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.05
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.25
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.03
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.63
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.26
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 92.51
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 89.27
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 89.08
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 84.07
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.67  E-value=6.9e-18  Score=124.12  Aligned_cols=52  Identities=44%  Similarity=0.765  Sum_probs=49.9

Q ss_pred             CccCCCCHHHHHHHHHHHHHhCCCCccccccccccccccccccchhhhhccCC
Q 014829           12 LKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRAD   64 (418)
Q Consensus        12 lkKg~WT~EED~~L~~lV~kyG~~~W~~IA~~l~~~Rs~~QCr~Rw~~~L~p~   64 (418)
                      |.||+||+|||++|+++|++||.++|..||+.|++ ||+.||+.||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTSTT-CCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCC-CCHHHHHHHHHhhCCCC
Confidence            68999999999999999999998899999999998 99999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure