Citrus Sinensis ID: 014835


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MNFPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQDSTDKVKRKRKRKRKRNHTPKD
ccccccccccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccHHHcccccccccccccccccccccEEccccccccccccccccccccccEEEccccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHccccccccccccHHHHHHHHHHHHccccccccccEEEEccccccccccccccccEEEEccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccEEEEEEEEccccEEEEEEEcccccccccEEEEEccEEEEEccccccccccccccccccccccc
cccccccHHHHHEEEcccccccEccccHcccccccEEEccccccHccccccHccHHcccEEEcccccHHccccccccHHHcccccHccHHHHHHHHccccccccccccHHccccccEEEccccccHHcccHHcccHHHHHEEEcccccccccccHHHHHHcccEEEccccccccccccHHHHHHHcccHccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccHHHcccccccEEEEEcccccccccccccEEEEEEEEEccccccccccEEEEEEEEcccEEccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEEEEccccEEEEEEEEEccccccEEEEEcEEEEEEEccccccccccccccccccccccc
mnfpsvtschVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLkslqsieisncpiferfteipscnidggigiERLASCRLVLEdcsslqslpsslcmfksltsleiidcqyfmilpdelgnLEALETLIVDrtamrevpeslgqlSSLKILVLSNIKRLPEYLQLHLqlpenglegipeylrrsprkltldpnelseivkdgwmkqsfdgnigitksmyfpgkeipkwfryqsmgssvnlkkrpadflnnKILVGFAFCIVVafpasrycdfehqirrksrpsvfgnydvfcdwkhksqgnldrrslgrisyvesDHVFLGSyllgsedlskrddevsfdevsfytkrddevsFYNCSlnkriygeycevkqcgihfvyaqdstdkVKRKRKrkrkrnhtpkd
mnfpsvtscHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREvpeslgqlsslKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRrsprkltldpnelseivkdgwmkqsfDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEhqirrksrpsvFGNYDVFCDWkhksqgnldrrslGRISYVESDHVFLGSYLlgsedlskrddeVSFDEvsfytkrddevsfYNCSLNKRIYGEYCEVKQCGIhfvyaqdstdkvkrkrkrkrkrnhtpkd
MNFPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLEsisssifklkslqsiEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCsslqslpsslCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQDSTDKVkrkrkrkrkrNHTPKD
*****VTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLR*****LTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDL****DEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQ**********************
MNFPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYA***********************
MNFPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQDS********************
MNFPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQD*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMKQSFDGNIGITKSMYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIRRKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQDSTDKVKRKRKRKRKRNHTPKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query417 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.589 0.215 0.297 8e-10
Q9LVT1623 Putative disease resistan no no 0.362 0.242 0.287 1e-09
P49606 2493 Adenylate cyclase OS=Usti N/A no 0.450 0.075 0.293 6e-09
Q7KRY7 1851 Protein lap4 OS=Drosophil yes no 0.431 0.097 0.287 2e-08
Q80TE7 1490 Leucine-rich repeat-conta yes no 0.338 0.094 0.318 3e-08
P70587 1490 Leucine-rich repeat-conta yes no 0.338 0.094 0.318 3e-08
Q96NW7 1537 Leucine-rich repeat-conta yes no 0.400 0.108 0.278 2e-07
Q01631 2300 Adenylate cyclase OS=Neur N/A no 0.376 0.068 0.274 3e-07
Q9FW44787 Disease resistance protei no no 0.347 0.184 0.276 3e-07
A6H6A4596 Leucine-rich repeat and I no no 0.371 0.260 0.294 3e-07
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score = 65.5 bits (158), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 141/299 (47%), Gaps = 53/299 (17%)

Query: 20   GIKELPSSI-ECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSC 78
            GI+ELPSSI +  +++ KL + +   L ++ SSI +LKSL S+ +S C   E   E    
Sbjct: 723  GIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEI-- 780

Query: 79   NIDGGIGIERL--ASCRLVLEDCSSLQSLPS-SLCMFKS---------------LTSLEI 120
               G +   R+  AS  L+L   SS+  L    + MF+                L SLE 
Sbjct: 781  ---GDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEY 837

Query: 121  IDCQYFMI----LPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRL--- 173
            ++  Y  +    LP+E+G+L +L+ L + R     +P S+ QL +L+ L L + +RL   
Sbjct: 838  LNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQL 897

Query: 174  ----PEYLQLHLQLPENGLEGIPEYL---RRSPRKLTLDP--NELSEIVKDGWMKQ---S 221
                PE  +LH+      L+ I  YL   R+   ++ LD   N+    +    M Q   S
Sbjct: 898  PELPPELNELHVDC-HMALKFI-HYLVTKRKKLHRVKLDDAHNDTMYNLFAYTMFQNISS 955

Query: 222  FDGNIGITKSM---YFPGK----EIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFC 273
               +I  + S+    F G+    +IP WF +Q   SSV++      ++ +K L GFA C
Sbjct: 956  MRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFL-GFAVC 1013




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=3 SV=2 Back     alignment and function description
>sp|Q9FW44|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2 Back     alignment and function description
>sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
224127754 1125 tir-nbs-lrr resistance protein [Populus 0.839 0.311 0.305 3e-24
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.872 0.233 0.271 1e-22
255563202 1158 leucine-rich repeat containing protein, 0.652 0.234 0.298 1e-20
296081002 599 unnamed protein product [Vitis vinifera] 0.829 0.577 0.284 8e-19
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.841 0.244 0.254 2e-18
255537139 1137 leucine-rich repeat-containing protein, 0.767 0.281 0.276 3e-18
451798990 1335 TMV resistance protein N-like protein 7 0.402 0.125 0.381 5e-18
255544956 1403 leucine-rich repeat containing protein, 0.865 0.257 0.289 7e-18
451798988 1219 TMV resistance protein N-like protein 6 0.402 0.137 0.376 1e-17
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.836 0.237 0.254 1e-17
>gi|224127754|ref|XP_002329169.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870950|gb|EEF08081.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 126/412 (30%), Positives = 189/412 (45%), Gaps = 62/412 (15%)

Query: 3    FPSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIE 62
            FP + S ++  L L    I+E+PSSIE L+ L +LY+ +C  L SI SSI KLKSL+ + 
Sbjct: 747  FPEI-SGNIKYLYLQGTAIEEVPSSIEFLTALVRLYMTNCKQLSSIPSSICKLKSLEVLG 805

Query: 63   ISNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSLCMFKSLTSLEIID 122
            +S C   E F EI          +E + S R +  D ++++ LPSS+   K LT L+ + 
Sbjct: 806  LSGCSKLENFPEI----------MEPMESLRRLELDATAIKELPSSIKYLKFLTQLK-LG 854

Query: 123  CQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLS--NIKRLPEYLQLH 180
                  L   +  L++L  L +  TA++E+P S+  L  LK L LS   IK LPE     
Sbjct: 855  VTAIEELSSSIAQLKSLTHLDLGGTAIKELPSSIEHLKCLKHLDLSGTGIKELPELPSSL 914

Query: 181  LQLPEN---GLEGIPEYLRRSPRKLT------LDPNELSEIVKDGWMKQSFDGNIGITKS 231
              L  N    L+ +  +  R+ ++L       LD  +L   V+         G I     
Sbjct: 915  TALDVNDCKSLQTLSRFNLRNFQELNFANCFKLDQKKLMADVQCKIQSGEIKGEIF---Q 971

Query: 232  MYFPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFPASRYCDFEHQIR 291
            +  P  EIP WFR Q+MGSSV  KK P   LN   + G AFCIV A P     D      
Sbjct: 972  IVLPKSEIPPWFRGQNMGSSVT-KKLP---LNCHQIKGIAFCIVFASPTPLLSD------ 1021

Query: 292  RKSRPSVFGNYDVFCDWKHKSQGNLDRRSLGRISYVESDHVFLGSYLLGSEDLSK--RDD 349
                     N+   CD K  +               E DHV L  Y L  +  +   + D
Sbjct: 1022 -------CANFSCKCDAKSDNG--------------EHDHVNLLWYDLDPQPKAAVFKLD 1060

Query: 350  EVSFDEVSFYTKRDDEVSFYNCS-LNKRIYG--EYCEVKQCGIHFVYAQDST 398
            +     + + + R    S Y+ S +    Y   E+ ++K+CG++F++ ++ +
Sbjct: 1061 DSDHMLLWYESTRTGLTSEYSGSEVTFEFYDKIEHSKIKRCGVYFLFDKNRS 1112




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296081002|emb|CBI18506.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.366 0.126 0.306 2.3e-12
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.359 0.121 0.291 7.9e-12
TAIR|locus:2122925417 AT4G19470 [Arabidopsis thalian 0.362 0.362 0.296 7.6e-11
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.340 0.116 0.281 1.8e-10
TAIR|locus:21229851167 AT4G19530 [Arabidopsis thalian 0.606 0.216 0.262 4.3e-09
TAIR|locus:21222091179 AT4G36150 [Arabidopsis thalian 0.328 0.116 0.302 1.3e-08
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.330 0.109 0.254 4.3e-08
TAIR|locus:21553221170 LAZ5 "LAZARUS 5" [Arabidopsis 0.208 0.074 0.289 3.1e-07
TAIR|locus:28276391195 AT2G17060 [Arabidopsis thalian 0.347 0.121 0.263 3.5e-07
TAIR|locus:21584751217 RPS4 "RESISTANT TO P. SYRINGAE 0.601 0.206 0.260 8.4e-07
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 154 (59.3 bits), Expect = 2.3e-12, Sum P(2) = 2.3e-12
 Identities = 54/176 (30%), Positives = 83/176 (47%)

Query:   234 FPGKEIPKWFRYQSMGSSVNLKKRPADFLNNKILVGFAFCIVVAFP------ASRYCDFE 287
             FPG +IP WF +Q MGS +     P  + N+K  +G + C+VV F       A+R     
Sbjct:   993 FPGHDIPSWFSHQKMGSLIETDLLP-HWCNSKF-IGASLCVVVTFKDHEGHHANRL-SVR 1049

Query:   288 HQIRRKSRPSVFGNYDVFC--DWKHKSQGNL-DRRSLGRISYVESDHVFLGSYLLGSEDL 344
              + + KS+   F ++  FC   W      +  + R LG      SDHVF+ SY   +  +
Sbjct:  1050 CKSKFKSQNGQFISFS-FCLGGWNESCGSSCHEPRKLG------SDHVFI-SYNNCNVPV 1101

Query:   345 SKRDDEVSFDEVSFYTKRDDEVSFYNCSLNKRIYGEYCEVKQCGIHFVYAQDSTDK 400
              K  +E +       T    E  FY     +R   E CE+ +CG++F+YA+D  D+
Sbjct:  1102 FKWSEETNEGNRCHPTSASFE--FYLTDETERKL-ECCEILRCGMNFLYARDENDR 1154


GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122925 AT4G19470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122985 AT4G19530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-05
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 58.7 bits (142), Expect = 3e-09
 Identities = 77/313 (24%), Positives = 116/313 (37%), Gaps = 89/313 (28%)

Query: 23  ELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNID- 81
           ELPSSI+ L+ L+ L +  C  LE + + I  LKSL  + +S C   + F +I + NI  
Sbjct: 672 ELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDIST-NISW 729

Query: 82  ---GGIGIERLAS--------------------------------------CRLVLEDCS 100
                  IE   S                                       RL L D  
Sbjct: 730 LDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIP 789

Query: 101 SLQSLPSSLCMFKSLTSLEIIDCQYFMILPDELGNLEALET------------------- 141
           SL  LPSS+     L  LEI +C     LP  + NLE+LE+                   
Sbjct: 790 SLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDISTNI 848

Query: 142 --LIVDRTAMREVP---ESLGQLSSLKILVLSNIKR--LPEYLQLHLQ---------LPE 185
             L + RT + EVP   E    LS L +   +N++R  L      HL+         L E
Sbjct: 849 SDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTE 908

Query: 186 NGLEGIPEYLRRSPRKLTLDPNELSEIVKDGWMK------QSFDGNIGITKSMYFPGKEI 239
               G P  +           ++L   V   ++       ++      I K +   G+E+
Sbjct: 909 ASWNGSPSEV---AMATDNIHSKLPSTVCINFINCFNLDQEALLQQQSIFKQLILSGEEV 965

Query: 240 PKWFRYQSMGSSV 252
           P +F +++ G+S+
Sbjct: 966 PSYFTHRTTGASL 978


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 417
PLN032101153 Resistant to P. syringae 6; Provisional 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.71
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.69
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.66
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.56
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.49
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.38
KOG4237498 consensus Extracellular matrix protein slit, conta 99.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.34
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.31
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.3
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.1
KOG4237498 consensus Extracellular matrix protein slit, conta 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
PLN03150623 hypothetical protein; Provisional 98.86
PLN03150623 hypothetical protein; Provisional 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.66
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.56
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.51
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.47
PRK15386426 type III secretion protein GogB; Provisional 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.15
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.07
PRK15386426 type III secretion protein GogB; Provisional 98.03
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.68
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.25
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.16
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.94
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.42
KOG2982418 consensus Uncharacterized conserved protein [Funct 94.94
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.81
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.17
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.09
KOG4341483 consensus F-box protein containing LRR [General fu 92.22
KOG2123388 consensus Uncharacterized conserved protein [Funct 91.98
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 91.14
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.43
smart0037026 LRR Leucine-rich repeats, outliers. 88.43
KOG4341483 consensus F-box protein containing LRR [General fu 87.1
KOG1947482 consensus Leucine rich repeat proteins, some prote 86.76
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.38
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.97  E-value=4.9e-30  Score=285.41  Aligned_cols=268  Identities=28%  Similarity=0.395  Sum_probs=190.1

Q ss_pred             CCCCcccC-cccEEEeecC-CCcccCccccCCcCcceeeccccccCccccccCCCCCCCcEEeeecCCCCCcCCCC----
Q 014835            2 NFPSVTSC-HVYTLELVKV-GIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEI----   75 (417)
Q Consensus         2 ~lP~~~~~-~L~~L~Ls~n-~l~~lp~~i~~L~~L~~L~Ls~n~~~~~lp~~l~~L~~L~~L~Ls~c~~l~~lp~l----   75 (417)
                      .+|++... +|+.|+|+++ .+.++|.+++++++|+.|++++|+.++.+|..+ ++++|+.|++++|..++.+|.+    
T Consensus       649 ~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~~~nL  727 (1153)
T PLN03210        649 EIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNI  727 (1153)
T ss_pred             cCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccccCCc
Confidence            45666656 8888888874 466888888888888888888888888888765 7888888888888777666643    


Q ss_pred             CccccCCCc--cc----------------------------------ccccc-ceEEcCCCCCCCCCcccccCCCCCcEE
Q 014835           76 PSCNIDGGI--GI----------------------------------ERLAS-CRLVLEDCSSLQSLPSSLCMFKSLTSL  118 (417)
Q Consensus        76 ~~l~l~g~~--~l----------------------------------~~l~~-~~L~L~~n~~l~~lp~~l~~l~~L~~L  118 (417)
                      ..+.++++.  .+                                  ...++ +.|+|++|..+..+|.+++++++|+.|
T Consensus       728 ~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L  807 (1153)
T PLN03210        728 SWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHL  807 (1153)
T ss_pred             CeeecCCCccccccccccccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEE
Confidence            223333330  00                                  01134 667777777777788888888888888


Q ss_pred             ecccccCCccCCcccCCC---------------------CCCCEEEeeccCCCCcchhccCCCCCcEEEccCCCCChhhh
Q 014835          119 EIIDCQYFMILPDELGNL---------------------EALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYL  177 (417)
Q Consensus       119 ~L~~n~~~~~lp~~l~~l---------------------~~L~~L~L~~n~l~~lp~~l~~L~~L~~L~L~~n~~l~~~l  177 (417)
                      ++++|..++.+|..+ ++                     ++|+.|+|++|.+..+|.++..+++|+.|+|++|+.+. . 
T Consensus       808 ~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~-~-  884 (1153)
T PLN03210        808 EIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQ-R-  884 (1153)
T ss_pred             ECCCCCCcCeeCCCC-CccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcC-c-
Confidence            888877666666533 22                     35667777777788888888899999999999988776 4 


Q ss_pred             hcccCCCCccccC-CcceeecCCCc-cc-cCcCc----cc--------ccccc--ccccccCCcccC-------CceeEe
Q 014835          178 QLHLQLPENGLEG-IPEYLRRSPRK-LT-LDPNE----LS--------EIVKD--GWMKQSFDGNIG-------ITKSMY  233 (417)
Q Consensus       178 ~~~l~lp~~l~~l-~L~~L~l~~n~-L~-lp~~~----L~--------~l~~~--~~~~n~~~~~~~-------~~~~~~  233 (417)
                           +|..+..+ .|+.|++++|. |+ ++-..    ..        .+...  .-..||+.....       ....+.
T Consensus       885 -----l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~l~~~~~~~~~~  959 (1153)
T PLN03210        885 -----VSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEALLQQQSIFKQLI  959 (1153)
T ss_pred             -----cCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhhhcccccceEEE
Confidence                 77777778 89999999987 55 22110    00        01000  011455554321       224578


Q ss_pred             cCCCCCCCCcccCCCCceEE-EEeCCCCCCCCCcccceEEEEEEecCC
Q 014835          234 FPGKEIPKWFRYQSMGSSVN-LKKRPADFLNNKILVGFAFCIVVAFPA  280 (417)
Q Consensus       234 ~~g~~iP~w~~~~~~g~~~~-i~l~~~~~~~~~~~~gf~~c~v~~~~~  280 (417)
                      +||.++|+||.|++.|++++ |.+| +.|.... +.||++|+|+++..
T Consensus       960 l~g~evp~~f~hr~~g~sl~~i~l~-~~~~~~~-~~~f~~c~v~~~~~ 1005 (1153)
T PLN03210        960 LSGEEVPSYFTHRTTGASLTNIPLL-HISPCQP-FFRFRACAVVDSES 1005 (1153)
T ss_pred             CCCccCchhccCCcccceeeeeccC-CcccCCC-ccceEEEEEEecCc
Confidence            99999999999999999998 9998 8888776 89999999997654



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  108 bits (272), Expect = 9e-27
 Identities = 41/194 (21%), Positives = 79/194 (40%), Gaps = 31/194 (15%)

Query: 21  IKELPSSIECLSNLKKLYIVDCSMLESISSSI---------FKLKSLQSIEISNCPIFER 71
           ++ LP+SI  L+ L++L I  C  L  +   +           L +LQS+ +    I   
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGI--- 195

Query: 72  FTEIPSCNIDGGIGIERLAS-CRLVLEDCSSLQSLPSSLCMFKSLTSLEIIDCQYFMILP 130
              +P+        I  L +   L + +   L +L  ++     L  L++  C      P
Sbjct: 196 -RSLPA-------SIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYP 246

Query: 131 DELGNLEALETLIV-DRTAMREVPESLGQLSSLKILVLSN---IKRLPEYL-QL----HL 181
              G    L+ LI+ D + +  +P  + +L+ L+ L L     + RLP  + QL     +
Sbjct: 247 PIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCII 306

Query: 182 QLPENGLEGIPEYL 195
            +P +    + ++ 
Sbjct: 307 LVPPHLQAQLDQHR 320


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.8
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.78
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.77
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.76
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.75
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.74
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.73
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.72
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.72
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.72
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.71
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.71
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.71
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.71
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.71
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.7
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.69
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.69
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.66
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.61
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.4
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.37
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.27
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.01
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.96
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.94
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.46
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.41
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.81
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.68
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.56
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.16
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.34
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.01
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.89  E-value=1.2e-22  Score=196.07  Aligned_cols=215  Identities=17%  Similarity=0.231  Sum_probs=171.9

Q ss_pred             cccEEEeecCCCcccCccccCCcCcceeeccccccCccccccCCCCCCCcEEeeecCCCCCcCCCCCccccCCCcccccc
Q 014835           10 HVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEISNCPIFERFTEIPSCNIDGGIGIERL   89 (417)
Q Consensus        10 ~L~~L~Ls~n~l~~lp~~i~~L~~L~~L~Ls~n~~~~~lp~~l~~L~~L~~L~Ls~c~~l~~lp~l~~l~l~g~~~l~~l   89 (417)
                      +++.|+|++|.++.+|..++.+++|++|+|++|.+. .+|..++++++|++|+|++|. +..+|          ..+..+
T Consensus        82 ~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~-~lp~~~~~l~~L~~L~Ls~n~-l~~lp----------~~l~~l  149 (328)
T 4fcg_A           82 GRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLM-ELPDTMQQFAGLETLTLARNP-LRALP----------ASIASL  149 (328)
T ss_dssp             TCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSCCC-CCCSCGGGGTTCSEEEEESCC-CCCCC----------GGGGGC
T ss_pred             ceeEEEccCCCchhcChhhhhCCCCCEEECCCCCcc-chhHHHhccCCCCEEECCCCc-cccCc----------HHHhcC
Confidence            789999999999999999999999999999998766 889889999999999999964 44777          578889


Q ss_pred             cc-ceEEcCCCCCCCCCcccccC---------CCCCcEEecccccCCccCCcccCCCCCCCEEEeeccCCCCcchhccCC
Q 014835           90 AS-CRLVLEDCSSLQSLPSSLCM---------FKSLTSLEIIDCQYFMILPDELGNLEALETLIVDRTAMREVPESLGQL  159 (417)
Q Consensus        90 ~~-~~L~L~~n~~l~~lp~~l~~---------l~~L~~L~L~~n~~~~~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~L  159 (417)
                      ++ +.|++++|...+.+|..+..         +++|++|++++|.+. .+|..++.+++|++|++++|.+..+|..++.+
T Consensus       150 ~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l  228 (328)
T 4fcg_A          150 NRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIR-SLPASIANLQNLKSLKIRNSPLSALGPAIHHL  228 (328)
T ss_dssp             TTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCC-CCCGGGGGCTTCCEEEEESSCCCCCCGGGGGC
T ss_pred             cCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcC-cchHhhcCCCCCCEEEccCCCCCcCchhhccC
Confidence            99 99999999999999987654         999999999999876 88888999999999999999999999889999


Q ss_pred             CCCcEEEccCCCCChhhhhcccCCCCccccC-CcceeecCCCccc--cCcCccccccccccccccCCcccCCceeEecCC
Q 014835          160 SSLKILVLSNIKRLPEYLQLHLQLPENGLEG-IPEYLRRSPRKLT--LDPNELSEIVKDGWMKQSFDGNIGITKSMYFPG  236 (417)
Q Consensus       160 ~~L~~L~L~~n~~l~~~l~~~l~lp~~l~~l-~L~~L~l~~n~L~--lp~~~L~~l~~~~~~~n~~~~~~~~~~~~~~~g  236 (417)
                      ++|+.|+|++|.... .      +|..+..+ .|+.|++++|.+.  +|.. +..+..+..+.  +        ..+---
T Consensus       229 ~~L~~L~Ls~n~~~~-~------~p~~~~~l~~L~~L~L~~n~~~~~~p~~-~~~l~~L~~L~--L--------~~n~~~  290 (328)
T 4fcg_A          229 PKLEELDLRGCTALR-N------YPPIFGGRAPLKRLILKDCSNLLTLPLD-IHRLTQLEKLD--L--------RGCVNL  290 (328)
T ss_dssp             TTCCEEECTTCTTCC-B------CCCCTTCCCCCCEEECTTCTTCCBCCTT-GGGCTTCCEEE--C--------TTCTTC
T ss_pred             CCCCEEECcCCcchh-h------hHHHhcCCCCCCEEECCCCCchhhcchh-hhcCCCCCEEe--C--------CCCCch
Confidence            999999999998444 5      88888888 9999999999855  6654 33333221110  0        001112


Q ss_pred             CCCCCCcccCCCCceEEEEeC
Q 014835          237 KEIPKWFRYQSMGSSVNLKKR  257 (417)
Q Consensus       237 ~~iP~w~~~~~~g~~~~i~l~  257 (417)
                      ..+|+|+.....-  ..+.+|
T Consensus       291 ~~iP~~l~~L~~L--~~l~l~  309 (328)
T 4fcg_A          291 SRLPSLIAQLPAN--CIILVP  309 (328)
T ss_dssp             CCCCGGGGGSCTT--CEEECC
T ss_pred             hhccHHHhhccCc--eEEeCC
Confidence            4688888776443  334454



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 417
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 46.6 bits (109), Expect = 3e-06
 Identities = 38/268 (14%), Positives = 88/268 (32%), Gaps = 32/268 (11%)

Query: 4   PSVTSCHVYTLELVKVGIKELPSSIECLSNLKKLYIVDCSMLESISSSIFKLKSLQSIEI 63
           P    CH+  ++   +G++++P  +    +   L + +  + E        LK+L ++ +
Sbjct: 5   PFRCQCHLRVVQCSDLGLEKVPKDL--PPDTALLDLQNNKITEIKDGDFKNLKNLHTLIL 62

Query: 64  SNCPIFERFTEIPSCNIDGGIGIERLASCRLVLEDCSSLQSLPSSL-CMFKSLTSLEIID 122
            N  I       P            L     +    + L+ LP  +    + L   E   
Sbjct: 63  INNKI---SKISPGA-------FAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEI 112

Query: 123 CQYFMILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQ 182
            +    + + L  +  +E       +      +   +  L  + +++             
Sbjct: 113 TKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIAD------------- 159

Query: 183 LPENGLEGIPEYLRRSPRKLTLDPNELSEIVKD---GWMKQSFDGNIGITKSMYFPGKEI 239
                +  IP+ L  S  +L LD N+++++      G    +  G    + S    G   
Sbjct: 160 ---TNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLA 216

Query: 240 PKWFRYQSMGSSVNLKKRPADFLNNKIL 267
                 +   ++  L K P    ++K +
Sbjct: 217 NTPHLRELHLNNNKLVKVPGGLADHKYI 244


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.32
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.21
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.69
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.99
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.51
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.06
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.3
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.82  E-value=3.2e-20  Score=175.35  Aligned_cols=197  Identities=19%  Similarity=0.221  Sum_probs=153.8

Q ss_pred             cccEEEeecCCCc---ccCccccCCcCcceeeccc-cccCccccccCCCCCCCcEEeeecCCCCCcCC-------CCCcc
Q 014835           10 HVYTLELVKVGIK---ELPSSIECLSNLKKLYIVD-CSMLESISSSIFKLKSLQSIEISNCPIFERFT-------EIPSC   78 (417)
Q Consensus        10 ~L~~L~Ls~n~l~---~lp~~i~~L~~L~~L~Ls~-n~~~~~lp~~l~~L~~L~~L~Ls~c~~l~~lp-------~l~~l   78 (417)
                      +++.|+|++++++   .+|+++++|++|++|+|++ |++.+.+|..|++|++|++|+|++|...+..+       .+..+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            6899999998887   6899999999999999987 56778999999999999999999976433222       23334


Q ss_pred             ccCCC-------cccccccc-ceEEcCCCCCCCCCcccccCCCCC-cEEecccccCCc----------------------
Q 014835           79 NIDGG-------IGIERLAS-CRLVLEDCSSLQSLPSSLCMFKSL-TSLEIIDCQYFM----------------------  127 (417)
Q Consensus        79 ~l~g~-------~~l~~l~~-~~L~L~~n~~l~~lp~~l~~l~~L-~~L~L~~n~~~~----------------------  127 (417)
                      .++.+       ..+..++. +.+++++|.+.+.+|..+..+..+ +.+++++|++.+                      
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~  210 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE  210 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            44443       46778888 888998888887888877777665 666666665443                      


Q ss_pred             -cCCcccCCCCCCCEEEeeccCCCCcchhccCCCCCcEEEccCCCCChhhhhcccCCCCccccC-CcceeecCCCccc--
Q 014835          128 -ILPDELGNLEALETLIVDRTAMREVPESLGQLSSLKILVLSNIKRLPEYLQLHLQLPENGLEG-IPEYLRRSPRKLT--  203 (417)
Q Consensus       128 -~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~L~~L~~L~L~~n~~l~~~l~~~l~lp~~l~~l-~L~~L~l~~n~L~--  203 (417)
                       .+|..++.+++|+.|++++|.+...+..++.+++|+.|+|++|+ +++.      +|..+..+ .|+.|++++|+|+  
T Consensus       211 ~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~-l~g~------iP~~l~~L~~L~~L~Ls~N~l~g~  283 (313)
T d1ogqa_         211 GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNR-IYGT------LPQGLTQLKFLHSLNVSFNNLCGE  283 (313)
T ss_dssp             ECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSC-CEEC------CCGGGGGCTTCCEEECCSSEEEEE
T ss_pred             ccccccccccccccccccccccccccccccccccccccccCccCe-eccc------CChHHhCCCCCCEEECcCCccccc
Confidence             34555667788999999999886656678889999999999998 6666      99999999 9999999999988  


Q ss_pred             cCcC-cccccc
Q 014835          204 LDPN-ELSEIV  213 (417)
Q Consensus       204 lp~~-~L~~l~  213 (417)
                      +|.. .++.+.
T Consensus       284 iP~~~~L~~L~  294 (313)
T d1ogqa_         284 IPQGGNLQRFD  294 (313)
T ss_dssp             CCCSTTGGGSC
T ss_pred             CCCcccCCCCC
Confidence            7753 344444



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure