Citrus Sinensis ID: 014879
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 416 | ||||||
| 225427794 | 589 | PREDICTED: uncharacterized protein LOC10 | 0.951 | 0.672 | 0.580 | 1e-123 | |
| 255538856 | 481 | DNA binding protein, putative [Ricinus c | 0.894 | 0.773 | 0.582 | 1e-112 | |
| 449461639 | 571 | PREDICTED: uncharacterized protein LOC10 | 0.947 | 0.690 | 0.552 | 1e-112 | |
| 449526371 | 566 | PREDICTED: uncharacterized protein LOC10 | 0.947 | 0.696 | 0.552 | 1e-112 | |
| 224077964 | 507 | predicted protein [Populus trichocarpa] | 0.891 | 0.731 | 0.590 | 1e-111 | |
| 351722269 | 525 | bZIP transcription factor bZIP28 [Glycin | 0.899 | 0.712 | 0.562 | 1e-109 | |
| 449529770 | 554 | PREDICTED: uncharacterized LOC101215703, | 0.963 | 0.723 | 0.535 | 1e-108 | |
| 356545029 | 538 | PREDICTED: uncharacterized protein LOC78 | 0.843 | 0.652 | 0.604 | 1e-108 | |
| 449461635 | 563 | PREDICTED: uncharacterized protein LOC10 | 0.947 | 0.699 | 0.542 | 1e-108 | |
| 297744714 | 369 | unnamed protein product [Vitis vinifera] | 0.670 | 0.756 | 0.661 | 1e-107 |
| >gi|225427794|ref|XP_002269363.1| PREDICTED: uncharacterized protein LOC100255631 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 449 bits (1154), Expect = e-123, Method: Compositional matrix adjust.
Identities = 270/465 (58%), Positives = 314/465 (67%), Gaps = 69/465 (14%)
Query: 1 MSPDSNKRPGIPPSHPNNNNPNAISLPFSHMVLPS---------------SHYRPL---- 41
S DS+KR G PPSHP+ P IS P+S + +P SH R L
Sbjct: 59 FSGDSSKRHGFPPSHPHQIPP--IS-PYSQIPVPRPANQQLVSQNFSPGPSHSRSLSQPS 115
Query: 42 ---LDSLPPLSPSMSSFSDPNSGNNTTS--VCIDERVVNSLGLSIPSPVNRVTNNNGSRV 96
LDSLPPLSPS S S ++ S + +++R +S + PSP + + N RV
Sbjct: 116 FFSLDSLPPLSPSPYRDSSSTSISDAVSADISMEDRDASSHSVLPPSP-SPFSRGNSMRV 174
Query: 97 SENLPPRRGHRRSSSDIPLGFSAMIQSSTQLIPIGSKGAIE-------------KPIQLV 143
ENLPPR+ HRRSSSDIP GFS+++QSS LIP+ GA+E KP+QLV
Sbjct: 175 GENLPPRKAHRRSSSDIPFGFSSIMQSSPPLIPLRGSGALERSMSGRDNNMAAAKPVQLV 234
Query: 144 KQESEWNNVKKDASRNVEGMGERKSEEDVADDLFNEYMNLENIDTLNSSCTEDK------ 197
K+ES W ++ N EGMGERKSE +V DDL + YMNL+NID LNS TE+K
Sbjct: 235 KRESSW---ERGGDSNAEGMGERKSEGEVVDDLLSAYMNLDNIDALNSPGTEEKNGTENR 291
Query: 198 -DMDSRASGSKTNGCESSDNEVESRV---------YGRSSSGILSEKREGIKRSACGDIA 247
D+DSRASG+KTNG +SSDNE ES V G SSS +EKREG+KRSA GDIA
Sbjct: 292 EDLDSRASGTKTNGGDSSDNEAESSVNESGNSMQKLGTSSS---AEKREGVKRSAGGDIA 348
Query: 248 PTVRHCRSVSMDSYMGNLPFDDESLRLPPG-----GQLSPGNPSDGNLAKMSLEF-NGEF 301
PT RH RSVSMDS+MG + F DES +L P GQLSP N DGN A SLEF NGEF
Sbjct: 349 PTTRHYRSVSMDSFMGKMNFGDESPKLLPSPGTRPGQLSPSNSMDGNSATFSLEFGNGEF 408
Query: 302 NDAELKKIWANEKLAEIALSDPKRAKRILANRQSAARSKERKMRYISELEQKVQTLQTEA 361
+ AELKKI ANEKLAEIAL+DPKRAKRILANRQSAARSKERKMRYISELE KVQTLQTEA
Sbjct: 409 SGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEA 468
Query: 362 TTLSAQVTILQRDSAGLTSENNELKFRLQAMEQQAQLKDGINSFL 406
TTLSAQ+T+LQRDSAGLTS+NNELKFRLQAMEQQAQL+D +N L
Sbjct: 469 TTLSAQLTLLQRDSAGLTSQNNELKFRLQAMEQQAQLRDALNEAL 513
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255538856|ref|XP_002510493.1| DNA binding protein, putative [Ricinus communis] gi|223551194|gb|EEF52680.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449461639|ref|XP_004148549.1| PREDICTED: uncharacterized protein LOC101216189 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449526371|ref|XP_004170187.1| PREDICTED: uncharacterized protein LOC101227308 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224077964|ref|XP_002305468.1| predicted protein [Populus trichocarpa] gi|222848432|gb|EEE85979.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351722269|ref|NP_001237238.1| bZIP transcription factor bZIP28 [Glycine max] gi|113367236|gb|ABI34675.1| bZIP transcription factor bZIP28 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449529770|ref|XP_004171871.1| PREDICTED: uncharacterized LOC101215703, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356545029|ref|XP_003540948.1| PREDICTED: uncharacterized protein LOC780560 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449461635|ref|XP_004148547.1| PREDICTED: uncharacterized protein LOC101215703 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297744714|emb|CBI37976.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 416 | ||||||
| TAIR|locus:2047082 | 525 | AT2G21230 "AT2G21230" [Arabido | 0.800 | 0.634 | 0.527 | 6.8e-79 | |
| TAIR|locus:2141826 | 553 | AT4G38900 "AT4G38900" [Arabido | 0.737 | 0.555 | 0.514 | 3.1e-67 | |
| TAIR|locus:2061340 | 398 | AT2G31370 [Arabidopsis thalian | 0.281 | 0.293 | 0.663 | 1.2e-37 | |
| TAIR|locus:2198856 | 423 | AT1G06070 "AT1G06070" [Arabido | 0.269 | 0.264 | 0.651 | 2.7e-36 | |
| TAIR|locus:2061908 | 367 | AT2G40620 "AT2G40620" [Arabido | 0.346 | 0.392 | 0.558 | 4.6e-34 | |
| TAIR|locus:2031123 | 341 | VIP1 "VIRE2-interacting protei | 0.367 | 0.448 | 0.502 | 3.7e-32 | |
| TAIR|locus:2033123 | 337 | bZIP52 "AT1G06850" [Arabidopsi | 0.305 | 0.376 | 0.596 | 9.8e-32 | |
| TAIR|locus:2057300 | 294 | UNE4 "unfertilized embryo sac | 0.367 | 0.520 | 0.405 | 4.6e-25 | |
| TAIR|locus:2056442 | 262 | AT2G13150 [Arabidopsis thalian | 0.427 | 0.679 | 0.362 | 1.4e-23 | |
| TAIR|locus:2057030 | 264 | AT2G12900 "AT2G12900" [Arabido | 0.415 | 0.655 | 0.308 | 5.8e-18 |
| TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 793 (284.2 bits), Expect = 6.8e-79, P = 6.8e-79
Identities = 190/360 (52%), Positives = 245/360 (68%)
Query: 64 TTSVCIDERVVNSLGLSIPSPVNRVTNNNGSRVS---ENLPPRRGHRRSSSDIPLGFSAM 120
+ SV ++E+ S+P + +++ SR + ENLPPR+ HRRS+SD+ GFS+M
Sbjct: 99 SVSVSVEEKTGAGFSPSLPPSPFTMCHSSSSRNAGDGENLPPRKSHRRSNSDVTFGFSSM 158
Query: 121 IQSSTQLIPIGSKGAIEKPIQLVKQESEWNNVKKDASRNVEGMGE-RKSEEDVA-DDLFN 178
+ + + P+ S +E+ I + S+W+N+ K R EG + RK E + A DD+F
Sbjct: 159 MSQNQKSPPLSS---LERSIS-GEDTSDWSNLVKKEPR--EGFYKGRKPEVEAAMDDVFT 212
Query: 179 EYMNLENIDTLNSSCTED--------KDMDS-RASGSK-TNGCESSDNEVESRVYGRSSS 228
YMNL+NID LNS ED ++M+S R SG+K TNG SSD+E +S G
Sbjct: 213 AYMNLDNIDVLNSFGGEDGKNGNENVEEMESSRGSGTKKTNGGSSSDSEGDSSASGNVKV 272
Query: 229 GILSEKREGIKRSACGDIAPTVRHCRSVSMDS-YMGNLPFDDES-LRLPPGG--QLSPGN 284
LS G+KR A GDIAPT RH RSVSMDS +MG L F DES L+LPP ++SP N
Sbjct: 273 A-LSSSSSGVKRRAGGDIAPTGRHYRSVSMDSCFMGKLNFGDESSLKLPPSSSAKVSPTN 331
Query: 285 PSDGNLAKMSLEF-NGEFNDAELKKIWANEKLAEIALSDPKRAKRILANRQSAARSKERK 343
+GN + S+EF N EF AE+KKI A+EKLAEI ++DPKR KRILANR SAARSKERK
Sbjct: 332 SGEGNSSAYSVEFGNSEFTAAEMKKIAADEKLAEIVMADPKRVKRILANRVSAARSKERK 391
Query: 344 MRYISELEQKVQTLQTEATTLSAQVTILQRDSAGLTSENNELKFRLQAMEQQAQLKDGIN 403
RY++ELE KVQTLQTEATTLSAQ+T LQRDS GLT++N+ELKFRLQAMEQQAQL+DG++
Sbjct: 392 TRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQNSELKFRLQAMEQQAQLRDGMH 451
|
|
| TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057300 UNE4 "unfertilized embryo sac 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056442 AT2G13150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00041262 | hypothetical protein (507 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 416 | |||
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 1e-15 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 3e-07 | |
| pfam07716 | 54 | pfam07716, bZIP_2, Basic region leucine zipper | 2e-05 | |
| cd12193 | 54 | cd12193, B_zip1, basic leucine zipper DNA-binding | 7e-04 | |
| pfam08614 | 194 | pfam08614, ATG16, Autophagy protein 16 (ATG16) | 0.002 |
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
Score = 70.7 bits (174), Expect = 1e-15
Identities = 27/63 (42%), Positives = 38/63 (60%)
Query: 322 DPKRAKRILANRQSAARSKERKMRYISELEQKVQTLQTEATTLSAQVTILQRDSAGLTSE 381
D KR +R NR++A RS+ERK I ELE+KV+ L+ E L ++ L+R+ L SE
Sbjct: 3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62
Query: 382 NNE 384
E
Sbjct: 63 LEE 65
|
Length = 65 |
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper | Back alignment and domain information |
|---|
| >gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 416 | |||
| smart00338 | 65 | BRLZ basic region leucin zipper. | 99.42 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 99.31 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 99.18 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 99.08 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 99.08 | |
| KOG3584 | 348 | consensus cAMP response element binding protein an | 98.93 | |
| KOG0709 | 472 | consensus CREB/ATF family transcription factor [Tr | 98.91 | |
| PF03131 | 92 | bZIP_Maf: bZIP Maf transcription factor; InterPro: | 98.21 | |
| KOG0837 | 279 | consensus Transcriptional activator of the JUN fam | 97.76 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 97.42 | |
| KOG3863 | 604 | consensus bZIP transcription factor NRF1 [Transcri | 97.31 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 97.18 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 96.94 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 96.48 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 96.44 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 96.39 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 96.29 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 95.95 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.93 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.59 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.36 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.2 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 94.75 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 94.53 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.46 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 94.46 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 94.34 | |
| PRK11637 | 428 | AmiB activator; Provisional | 94.29 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.24 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 94.23 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 94.16 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 94.12 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 94.03 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.96 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 93.86 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 93.76 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 93.72 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 93.65 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.6 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.59 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 93.58 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 93.5 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 93.5 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 93.49 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 93.47 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 93.46 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 93.44 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 93.44 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 93.41 | |
| PRK11637 | 428 | AmiB activator; Provisional | 93.27 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 93.25 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 93.21 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 93.12 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 93.05 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 93.03 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 93.01 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 92.96 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 92.88 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.82 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 92.74 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 92.47 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 92.46 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.43 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 92.38 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 92.31 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.3 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 92.26 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 92.15 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 92.1 | |
| PF12711 | 86 | Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 | 92.0 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 91.83 | |
| PF05837 | 106 | CENP-H: Centromere protein H (CENP-H); InterPro: I | 91.8 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 91.77 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 91.67 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 91.54 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 91.29 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 91.18 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 91.01 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 90.84 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 90.83 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 90.82 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 90.74 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 90.57 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 90.54 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 90.47 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 90.24 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 90.24 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 90.19 | |
| PF13094 | 160 | CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub | 90.15 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 89.97 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 89.69 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 89.65 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 89.6 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 89.54 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 89.48 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 89.47 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 89.45 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 89.36 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 89.33 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 89.19 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 89.18 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 89.1 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 89.05 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 88.99 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 88.83 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 88.72 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 88.61 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 88.49 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 88.43 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 88.27 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 88.21 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 88.17 | |
| PF08537 | 323 | NBP1: Fungal Nap binding protein NBP1; InterPro: I | 88.15 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 88.08 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 88.04 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 87.77 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 87.77 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 87.75 | |
| PF06428 | 100 | Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP | 87.66 | |
| COG2900 | 72 | SlyX Uncharacterized protein conserved in bacteria | 87.53 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 87.44 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 86.9 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 86.88 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 86.87 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 86.64 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 86.63 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 86.6 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 86.58 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 86.57 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 86.4 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 86.22 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 86.21 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 86.15 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 85.68 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 85.66 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 85.66 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 85.63 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 85.53 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 85.46 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 85.33 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 85.25 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 84.92 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 84.84 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 84.83 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 84.81 | |
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 84.71 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 84.61 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 84.59 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 84.55 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 84.44 | |
| PF12761 | 195 | End3: Actin cytoskeleton-regulatory complex protei | 84.36 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 84.21 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 84.09 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 83.58 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 83.55 | |
| PF14661 | 247 | HAUS6_N: HAUS augmin-like complex subunit 6 N-term | 83.54 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 83.51 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 83.49 | |
| PF12711 | 86 | Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 | 83.39 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 83.21 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 83.19 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 82.99 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 82.59 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 82.39 | |
| PF15030 | 277 | DUF4527: Protein of unknown function (DUF4527) | 82.32 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 82.26 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 82.24 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 82.15 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 82.08 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 82.05 | |
| PRK09039 | 343 | hypothetical protein; Validated | 81.9 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 81.88 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 81.8 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 81.74 | |
| TIGR03495 | 135 | phage_LysB phage lysis regulatory protein, LysB fa | 81.74 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 81.65 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 81.58 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 81.53 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 81.51 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 81.48 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 81.38 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 81.32 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 81.25 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 81.23 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 81.19 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 81.13 | |
| PF11365 | 96 | DUF3166: Protein of unknown function (DUF3166); In | 81.1 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 81.1 | |
| KOG3650 | 120 | consensus Predicted coiled-coil protein [General f | 81.09 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 81.07 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 80.92 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 80.9 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 80.7 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 80.53 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 80.45 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 80.34 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 80.33 |
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
Probab=99.42 E-value=1e-12 Score=101.91 Aligned_cols=63 Identities=41% Similarity=0.534 Sum_probs=58.6
Q ss_pred cCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 014879 321 SDPKRAKRILANRQSAARSKERKMRYISELEQKVQTLQTEATTLSAQVTILQRDSAGLTSENN 383 (416)
Q Consensus 321 ~DpKR~KRiLkNRESArRSReRKk~YleELE~KVq~LqsENs~Ls~Qlt~Lqre~~~L~sEN~ 383 (416)
.|+|+.+|+++||+||++||+||+.|+.+||.+|+.|+.+|..|..++..|+.++..|..++.
T Consensus 2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~~ 64 (65)
T smart00338 2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSELE 64 (65)
T ss_pred ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 578999999999999999999999999999999999999999999999998888888877653
|
|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG0709 consensus CREB/ATF family transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell | Back alignment and domain information |
|---|
| >KOG0837 consensus Transcriptional activator of the JUN family [Transcription] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >KOG3863 consensus bZIP transcription factor NRF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF08537 NBP1: Fungal Nap binding protein NBP1; InterPro: IPR013743 NBP1 is a nuclear protein which has been shown in Saccharomyces cerevisiae (Bakers yeast) to be essential for the G2/M transition of the cell cycle | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] | Back alignment and domain information |
|---|
| >COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF14661 HAUS6_N: HAUS augmin-like complex subunit 6 N-terminus | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF15030 DUF4527: Protein of unknown function (DUF4527) | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >TIGR03495 phage_LysB phage lysis regulatory protein, LysB family | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >PF11365 DUF3166: Protein of unknown function (DUF3166); InterPro: IPR021507 This eukaryotic family of proteins has no known function | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3650 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 416 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 2e-11 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 2e-11 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 5e-10 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 6e-09 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 1e-08 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 2e-07 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 4e-06 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 4e-06 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 8e-05 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 1e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-04 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 | Back alignment and structure |
|---|
Score = 57.8 bits (140), Expect = 2e-11
Identities = 16/49 (32%), Positives = 29/49 (59%)
Query: 324 KRAKRILANRQSAARSKERKMRYISELEQKVQTLQTEATTLSAQVTILQ 372
KR R++ NR++A S+ +K Y+ LE +V L+ + TL ++ L+
Sbjct: 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALK 49
|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 416 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 99.48 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 99.31 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 99.27 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 99.16 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 99.04 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 98.97 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 98.93 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 98.48 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 98.45 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 98.3 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 98.26 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 97.47 | |
| 1skn_P | 92 | DNA-binding domain of SKN-1; complex (transcriptio | 97.02 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 96.08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.62 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.35 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.06 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 95.01 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.45 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 94.2 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 94.11 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.1 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.72 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.5 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 93.18 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 93.17 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 93.09 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 93.07 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 92.91 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 92.63 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 92.6 | |
| 2kz5_A | 91 | Transcription factor NF-E2 45 kDa subunit; structu | 92.38 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.8 | |
| 3swy_A | 46 | Cyclic nucleotide-gated cation channel alpha-3; co | 91.42 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 91.41 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.39 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 91.02 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 91.0 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 90.94 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 90.88 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 90.58 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 90.42 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.42 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 90.32 | |
| 3swf_A | 74 | CGMP-gated cation channel alpha-1; coiled-coil, as | 90.31 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.86 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 89.57 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 89.43 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 89.39 | |
| 3he5_A | 49 | Synzip1; heterodimeric coiled-coil, de novo protei | 89.11 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 89.08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 89.07 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 89.06 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 88.98 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 88.15 | |
| 2ve7_C | 250 | Kinetochore protein NUF2, kinetochore protein SPC; | 87.99 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 87.74 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 87.57 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 87.42 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 87.32 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 87.28 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 87.21 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 86.85 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 86.77 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 86.53 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 86.52 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 86.45 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 86.44 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 86.2 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 85.96 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 85.73 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 85.7 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 85.18 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 85.13 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 85.13 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 85.04 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 84.83 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 84.73 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 84.67 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 84.43 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 84.43 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 84.32 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 84.29 | |
| 3vmx_A | 48 | Voltage-gated hydrogen channel 1; coiled-coil, ION | 84.28 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 84.09 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 83.97 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 83.87 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 83.58 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 83.04 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 82.59 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 82.56 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 82.53 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 82.47 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 82.41 | |
| 2wq1_A | 33 | General control protein GCN4; TAA, nucleus, coiled | 82.29 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 82.26 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 82.21 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 82.14 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 82.12 | |
| 1a93_B | 34 | MAX protein, coiled coil, LZ; leucine zipper, 2D s | 82.01 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 81.78 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 81.76 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 81.76 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 81.37 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 81.31 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 81.27 | |
| 1t6f_A | 37 | Geminin; coiled-coil, cell cycle; 1.47A {Synthetic | 80.81 | |
| 2c9l_Y | 63 | EB1, zebra, BZLF1 trans-activator protein; viral p | 80.63 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 80.6 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 80.46 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 80.36 | |
| 3a2a_A | 58 | Voltage-gated hydrogen channel 1; voltage-gated pr | 80.24 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Probab=99.48 E-value=3.9e-14 Score=107.60 Aligned_cols=52 Identities=31% Similarity=0.512 Sum_probs=48.9
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 014879 324 KRAKRILANRQSAARSKERKMRYISELEQKVQTLQTEATTLSAQVTILQRDS 375 (416)
Q Consensus 324 KR~KRiLkNRESArRSReRKk~YleELE~KVq~LqsENs~Ls~Qlt~Lqre~ 375 (416)
||.+|+++||+||++||+||++|+++||.+|..|+.||..|..++..|+..+
T Consensus 1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~ 52 (55)
T 1dh3_A 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52 (55)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 5889999999999999999999999999999999999999999999887654
|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 416 | |||
| d1sknp_ | 74 | Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | 94.58 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 84.06 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 82.3 |
| >d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: A DNA-binding domain in eukaryotic transcription factors superfamily: A DNA-binding domain in eukaryotic transcription factors family: A DNA-binding domain in eukaryotic transcription factors domain: Skn-1 species: Caenorhabditis elegans [TaxId: 6239]
Probab=94.58 E-value=0.0046 Score=47.96 Aligned_cols=50 Identities=22% Similarity=0.293 Sum_probs=41.2
Q ss_pred ccChHHHHhhhhhhhHhhhhccCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 014879 300 EFNDAELKKIWANEKLAEIALSDPKRAKRILANRQSAARSKERKMRYISE 349 (416)
Q Consensus 300 ~~s~~e~kKi~~~~~LaElAl~DpKR~KRiLkNRESArRSReRKk~YleE 349 (416)
..+-+|.+..++...|.|.-+.=-+-+||.=+|+.+|+++|+||....++
T Consensus 24 ~lpv~eFne~l~~~~Lte~Ql~lirDIRRRGKNKvAAqnCRKRKld~~d~ 73 (74)
T d1sknp_ 24 EMSLSELQQVLKNESLSEYQRQLIRKIRRRGKNKVAARTCRQRRTDRHDK 73 (74)
T ss_dssp HSCHHHHHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred HCCHHHHHHHHHhCCCCHHHHHHHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence 44567778888887787777666789999999999999999999987654
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|