Citrus Sinensis ID: 014900


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MATTTATLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGSNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVYSADPQLTDFPGALSDSKISPVKKEDDLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAISNDITIT
cccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEEccccccccccccEEEEcccccccEEEEccccccHHHHHHHcccEEEEEccccccccccccccHHHHHHHccHHHHHHHHHHccccccHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHccccccccccccEEEc
ccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEccccccccccccEEEEEccccccEEEEEEcccccccccccccEEEEcccccccEccccccccHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccEccccccEEEcccEEEEEEccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHcccccccEEEEcEEEEc
MATTTATLyhqlpsdirlATCTLFrsfnhrhllipqcagassrpyfsrsttpfRLLAfstnanepfvekvsdkppicsadelhyvsvANCDWRlalwrynpppqaptrnhpllllsgvgtnaigydlspgssfarymagqgfDTWILEVRGaglsvrgsnlkeaQQSAHGVSEQMEAVANSTTSEAFAKSatngvysadpqltdfpgalsdskispvkkeddlTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEegqlsvspqlFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAqskpkdgkllAIGHSMGGILLYAMLSRcgkipslaisnditit
matttatlyhqlpsdIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGSNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVYSADPQLTDFPgalsdskispvkkeddltrlatvwdesklvtKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEdsqlsegfNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKipslaisnditit
MATTTATLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGSNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVYSADPQLTDFPGALSDSKISPVKKEDDLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAISNDITIT
******TLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPP****TRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSV******************************************************************LTRLATVWDESKLVTKLTETFMSLSERLSGF***********KLFDQI******************************AIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAIS******
***************IRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRST******************KVSDKPPICSADELHYVSVANCDWRLALW**************LLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGSNLKEAQQSAHGVSEQMEAVANSTT**************************************DLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERR**********DLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAISNDITIT
MATTTATLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGS************************SEAFAKSATNGVYSADPQLTDFPGALSDSKISPVKKEDDLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAISNDITIT
****TATLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVR*SNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVY******TDFPGALSDSKISPVKKEDDLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAISNDITIT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTTATLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFSRSTTPFRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGSNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVYSADPQLTDFPGALSDSKISPVKKEDDLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRCGKIPSLAISNDITIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query416
224108405 597 predicted protein [Populus trichocarpa] 0.923 0.643 0.684 1e-149
224101773 599 predicted protein [Populus trichocarpa] 0.855 0.594 0.730 1e-148
359472659 584 PREDICTED: uncharacterized protein LOC10 0.903 0.643 0.683 1e-144
255570661 595 catalytic, putative [Ricinus communis] g 0.807 0.564 0.746 1e-142
356534346 581 PREDICTED: uncharacterized protein LOC10 0.843 0.604 0.657 1e-136
356574234 566 PREDICTED: uncharacterized protein LOC10 0.819 0.602 0.639 1e-131
449458767 588 PREDICTED: uncharacterized protein LOC10 0.814 0.576 0.682 1e-130
449503403 562 PREDICTED: uncharacterized protein LOC10 0.814 0.603 0.682 1e-129
5103806 523 EST gb|F14271 comes from this gene [Arab 0.896 0.713 0.603 1e-129
312283273 558 unnamed protein product [Thellungiella h 0.896 0.668 0.615 1e-129
>gi|224108405|ref|XP_002314836.1| predicted protein [Populus trichocarpa] gi|222863876|gb|EEF01007.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 282/412 (68%), Positives = 319/412 (77%), Gaps = 28/412 (6%)

Query: 1   MATTTATLYHQLPSDIRLATCTLFRSFNHRHLLIPQCAGASSRPYFS---------RSTT 51
           MATT       + SDIR A       F + +L++ +   +S+R  FS         R +T
Sbjct: 1   MATT-------IQSDIRSALHVANLIFINPNLILSRATASSARWSFSPRPLLSSYRRIST 53

Query: 52  P--FRLLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCDWRLALWRYNPPPQAPTRN 109
           P  FR   FS+ + EP V KV +KPPIC+ADELHYVSV+N DWR ALWRY+P PQAP RN
Sbjct: 54  PTSFRARTFSSESTEPVV-KVPEKPPICTADELHYVSVSNSDWRPALWRYHPSPQAPPRN 112

Query: 110 HPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGSNLKEAQQSAH 169
           HPLLLLSG+GTNAIGYDLSPGSSFARYM+GQGF+TWILEVRGAGLSV+GS  K  QQ+AH
Sbjct: 113 HPLLLLSGLGTNAIGYDLSPGSSFARYMSGQGFETWILEVRGAGLSVQGSTPKVVQQAAH 172

Query: 170 GVSEQMEAVANSTTSEAFAKSATNGVYSADPQLTDFPGALSDSKISPVKKEDDLTRLATV 229
            VSEQMEAV          KS  NG  S D Q +  P  +SDS++S V+++  L  + TV
Sbjct: 173 EVSEQMEAVT---------KSMANGSLSTDQQPSKVPSPVSDSRVSFVEEDPHLAGIVTV 223

Query: 230 WDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQISKLLEDSQLSEGFNEIRGK 289
           WDESKLVTKLTE FM LSERLSGFLSE+QSKIM AKL DQI+K+LEDSQLSE  NEIRGK
Sbjct: 224 WDESKLVTKLTEVFMRLSERLSGFLSESQSKIMFAKLVDQIAKILEDSQLSERMNEIRGK 283

Query: 290 LSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLI 349
           L SLLE RQ+SAIA Q RDLSQ LVN+IEEGQ SVSPQLFDLQERL STI+DFQKQLDLI
Sbjct: 284 LLSLLEARQNSAIAGQFRDLSQGLVNVIEEGQKSVSPQLFDLQERLSSTIEDFQKQLDLI 343

Query: 350 VQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSRC 401
           V+YDWDFD+YLEEDVPAAMEYIRAQ+KPKDGKLLAIGHSMGGILLYAMLSRC
Sbjct: 344 VKYDWDFDNYLEEDVPAAMEYIRAQTKPKDGKLLAIGHSMGGILLYAMLSRC 395




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224101773|ref|XP_002312415.1| predicted protein [Populus trichocarpa] gi|222852235|gb|EEE89782.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359472659|ref|XP_002279891.2| PREDICTED: uncharacterized protein LOC100247521 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570661|ref|XP_002526285.1| catalytic, putative [Ricinus communis] gi|223534366|gb|EEF36074.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356534346|ref|XP_003535717.1| PREDICTED: uncharacterized protein LOC100776497 [Glycine max] Back     alignment and taxonomy information
>gi|356574234|ref|XP_003555255.1| PREDICTED: uncharacterized protein LOC100793924 [Glycine max] Back     alignment and taxonomy information
>gi|449458767|ref|XP_004147118.1| PREDICTED: uncharacterized protein LOC101217845 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449503403|ref|XP_004161985.1| PREDICTED: uncharacterized protein LOC101228788 [Cucumis sativus] Back     alignment and taxonomy information
>gi|5103806|gb|AAD39636.1|AC007591_1 EST gb|F14271 comes from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312283273|dbj|BAJ34502.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query416
TAIR|locus:2196179 578 AT1G15060 [Arabidopsis thalian 0.855 0.615 0.635 4.2e-117
TAIR|locus:2027784452 AT1G73750 "AT1G73750" [Arabido 0.276 0.254 0.588 1.6e-31
UNIPROTKB|Q4KFJ4329 PFL_1870 "Uncharacterized prot 0.168 0.212 0.342 0.00091
TAIR|locus:2196179 AT1G15060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1135 (404.6 bits), Expect = 4.2e-117, Sum P(2) = 4.2e-117
 Identities = 242/381 (63%), Positives = 285/381 (74%)

Query:    40 ASSRPYFSRS-----TTP-FR--LLAFSTNANEPFVEKVSDKPPICSADELHYVSVANCD 91
             ASS  Y  RS     TTP FR         A      K+  KP +C+ADELHYVSV N D
Sbjct:    19 ASSTVYLHRSISTVTTTPSFRHRTTLLRPRAFSSSSVKLPTKPSLCTADELHYVSVPNTD 78

Query:    92 WRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRG 151
             WRLALWRY PPPQAPTRNHPLLLLSGVGTNAIGYDLSPG SFAR+M+GQGF+TWILEVRG
Sbjct:    79 WRLALWRYLPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGCSFARHMSGQGFETWILEVRG 138

Query:   152 AGLSVRGSNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVYSADPQLTDFPGALSD 211
             AGLS R S+LK+ ++SAH +S Q+E+     T+ A A   T    S + Q TD    + D
Sbjct:   139 AGLSTRVSDLKDVEESAHELSNQIES-----TARAAAGKET---CSDEKQTTD----IMD 186

Query:   212 SKISPVKKED-DLTRLATVWDESKLVTKLTETFMSLSERLSGFLSENQSKIMSAKLFDQI 270
             S  +P    D  +   A+ WDES+LV +LT TFMSLSERLSGFLSE QS  MSAKLFD+I
Sbjct:   187 SS-APAPASDVSVVGEASAWDESQLVARLTSTFMSLSERLSGFLSEGQSVFMSAKLFDKI 245

Query:   271 SKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVNMIEEGQLSVSPQLFD 330
             + L++D+QL E FN+IR KL SL+E +Q+S +  Q+RDL+Q LVN+ ++GQ SVSP L D
Sbjct:   246 AMLVDDTQLYERFNDIRSKLLSLIESKQNSGLVNQVRDLAQRLVNLFDDGQRSVSPPLID 305

Query:   331 LQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDVPAAMEYIRAQSKPKDGKLLAIGHSMG 390
             LQERL +TI+DFQKQLDLIV+YDWDFDHYLEEDVPAA+EY+RAQSKPKDGKL AIGHSMG
Sbjct:   306 LQERLTATIEDFQKQLDLIVKYDWDFDHYLEEDVPAAIEYVRAQSKPKDGKLFAIGHSMG 365

Query:   391 GILLYAMLSRC---GKIPSLA 408
             GILLYAMLSRC   G+ PS+A
Sbjct:   366 GILLYAMLSRCAFEGREPSVA 386


GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2027784 AT1G73750 "AT1G73750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KFJ4 PFL_1870 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT1G15060
unknown protein; LOCATED IN- chloroplast; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 14 growth stages; CONTAINS InterPro DOMAIN/s- Uncharacterised conserved protein UCP031088, alpha/beta hydrolase, At1g15070 (InterPro-IPR016969); BEST Arabidopsis thaliana protein match is- unknown protein (TAIR-AT1G73750.1); Has 120 Blast hits to 104 proteins in 29 species- Archae - 0; Bacteria - 61; Metazoa - 1; Fungi - 0; Plants - 47; Viruses - 0; Other Eukaryotes - 11 (source- NCBI BLink). (578 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query416
pfam01738215 pfam01738, DLH, Dienelactone hydrolase family 6e-04
pfam1214680 pfam12146, Hydrolase_4, Putative lysophospholipase 0.003
COG3243 445 COG3243, PhaC, Poly(3-hydroxyalkanoate) synthetase 0.004
>gnl|CDD|216672 pfam01738, DLH, Dienelactone hydrolase family Back     alignment and domain information
 Score = 40.4 bits (95), Expect = 6e-04
 Identities = 22/96 (22%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 305 QIRDLSQNLVNMIEEGQLSVSPQLFDLQERLFSTIDDFQKQLDLIVQYDWDFDHYLEEDV 364
            IRD++  L    EEG +++ P L+  Q    +   +  + +  ++         + +D+
Sbjct: 29  FIRDIAARLA---EEGYVALCPDLYARQGLDPTDPREAARAMRGLL---SKRMEAVVDDL 82

Query: 365 PAAMEYIRAQSKPKDGKLLAIGHSMGGILLYAMLSR 400
            AA+ Y+R Q      K+  +G  +GG L + + +R
Sbjct: 83  LAAINYLRGQPYVDTKKVGVVGFCLGGRLAFLLAAR 118


Length = 215

>gnl|CDD|221442 pfam12146, Hydrolase_4, Putative lysophospholipase Back     alignment and domain information
>gnl|CDD|225783 COG3243, PhaC, Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 416
COG4757281 Predicted alpha/beta hydrolase [General function p 99.76
PLN02872395 triacylglycerol lipase 99.71
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 99.66
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.63
PLN02298330 hydrolase, alpha/beta fold family protein 99.6
PRK10749330 lysophospholipase L2; Provisional 99.56
PLN02385349 hydrolase; alpha/beta fold family protein 99.55
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.54
PRK00870302 haloalkane dehalogenase; Provisional 99.54
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.53
PHA02857276 monoglyceride lipase; Provisional 99.53
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.52
PRK13604307 luxD acyl transferase; Provisional 99.51
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.51
PLN02679360 hydrolase, alpha/beta fold family protein 99.51
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.5
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.49
PLN02652395 hydrolase; alpha/beta fold family protein 99.49
PRK03592295 haloalkane dehalogenase; Provisional 99.49
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.47
PLN02824294 hydrolase, alpha/beta fold family protein 99.47
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.47
PRK10673255 acyl-CoA esterase; Provisional 99.45
PLN02965255 Probable pheophorbidase 99.45
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.4
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.4
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 99.38
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 99.38
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.38
PLN02211273 methyl indole-3-acetate methyltransferase 99.37
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.36
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.34
PLN02578354 hydrolase 99.34
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.34
PLN02511388 hydrolase 99.33
PRK05855 582 short chain dehydrogenase; Validated 99.33
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.32
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.32
PRK10985324 putative hydrolase; Provisional 99.31
PRK03204286 haloalkane dehalogenase; Provisional 99.31
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.3
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.3
PRK06489360 hypothetical protein; Provisional 99.29
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.28
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.27
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.25
PRK10349256 carboxylesterase BioH; Provisional 99.23
COG1647243 Esterase/lipase [General function prediction only] 99.18
PRK07868 994 acyl-CoA synthetase; Validated 99.18
PRK10566249 esterase; Provisional 99.17
KOG3043242 consensus Predicted hydrolase related to dienelact 99.16
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.15
KOG2564343 consensus Predicted acetyltransferases and hydrola 99.15
PLN02894402 hydrolase, alpha/beta fold family protein 99.14
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.14
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.13
PRK08775343 homoserine O-acetyltransferase; Provisional 99.1
PRK07581339 hypothetical protein; Validated 99.1
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.08
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.07
COG1647 243 Esterase/lipase [General function prediction only] 99.06
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 99.04
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.03
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.97
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 98.96
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.96
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 98.95
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.91
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.89
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.87
PRK11071190 esterase YqiA; Provisional 98.87
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.84
PLN00021313 chlorophyllase 98.83
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.81
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 98.81
PRK13604 307 luxD acyl transferase; Provisional 98.76
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.74
KOG1838409 consensus Alpha/beta hydrolase [General function p 98.68
PLN02298 330 hydrolase, alpha/beta fold family protein 98.66
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.66
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.62
PLN02442283 S-formylglutathione hydrolase 98.61
PHA02857 276 monoglyceride lipase; Provisional 98.6
PLN02385 349 hydrolase; alpha/beta fold family protein 98.59
PRK10566 249 esterase; Provisional 98.58
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.57
PRK05077 414 frsA fermentation/respiration switch protein; Revi 98.56
PRK10749 330 lysophospholipase L2; Provisional 98.55
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 98.54
PLN02965 255 Probable pheophorbidase 98.53
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.52
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.52
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.5
PRK00870 302 haloalkane dehalogenase; Provisional 98.5
PF00326 213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.46
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.46
PLN02652 395 hydrolase; alpha/beta fold family protein 98.45
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.43
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.42
PRK10985 324 putative hydrolase; Provisional 98.41
PLN02824 294 hydrolase, alpha/beta fold family protein 98.4
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.38
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.37
PLN02511 388 hydrolase 98.36
PRK03592 295 haloalkane dehalogenase; Provisional 98.36
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.34
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 98.34
PRK10673 255 acyl-CoA esterase; Provisional 98.33
PRK10162318 acetyl esterase; Provisional 98.32
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.29
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.28
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.27
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.25
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.22
PLN02211 273 methyl indole-3-acetate methyltransferase 98.21
PRK11460232 putative hydrolase; Provisional 98.21
KOG4667269 consensus Predicted esterase [Lipid transport and 98.2
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.2
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 98.2
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.19
PLN02679 360 hydrolase, alpha/beta fold family protein 98.19
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 98.18
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.18
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.17
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.17
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 98.16
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 98.14
PLN00021 313 chlorophyllase 98.13
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.12
KOG1552258 consensus Predicted alpha/beta hydrolase [General 98.11
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 98.07
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 98.06
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.04
COG0412236 Dienelactone hydrolase and related enzymes [Second 98.03
PRK03204 286 haloalkane dehalogenase; Provisional 98.02
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 98.01
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 97.99
PLN02872 395 triacylglycerol lipase 97.99
PRK08775 343 homoserine O-acetyltransferase; Provisional 97.98
PLN02578 354 hydrolase 97.98
COG2945210 Predicted hydrolase of the alpha/beta superfamily 97.97
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 97.97
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.95
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 97.94
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 97.93
PRK06489 360 hypothetical protein; Provisional 97.92
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 97.91
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 97.87
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 97.87
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.85
KOG1838 409 consensus Alpha/beta hydrolase [General function p 97.82
PRK10349 256 carboxylesterase BioH; Provisional 97.82
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 97.8
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.77
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.76
PRK06765389 homoserine O-acetyltransferase; Provisional 97.75
PF06500 411 DUF1100: Alpha/beta hydrolase of unknown function 97.74
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.72
KOG2984277 consensus Predicted hydrolase [General function pr 97.71
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.7
COG4188365 Predicted dienelactone hydrolase [General function 97.68
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.68
PRK11071190 esterase YqiA; Provisional 97.67
PLN02442 283 S-formylglutathione hydrolase 97.66
PRK07581 339 hypothetical protein; Validated 97.66
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.66
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 97.65
PLN02894 402 hydrolase, alpha/beta fold family protein 97.64
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 97.64
COG2945210 Predicted hydrolase of the alpha/beta superfamily 97.63
PRK10115686 protease 2; Provisional 97.62
COG3319257 Thioesterase domains of type I polyketide synthase 97.62
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 97.62
PRK11460232 putative hydrolase; Provisional 97.6
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 97.6
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 97.58
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.57
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.57
PRK05855 582 short chain dehydrogenase; Validated 97.55
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.54
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 97.52
COG4757 281 Predicted alpha/beta hydrolase [General function p 97.52
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.5
KOG1552258 consensus Predicted alpha/beta hydrolase [General 97.5
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 97.45
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 97.44
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.44
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.41
COG3208244 GrsT Predicted thioesterase involved in non-riboso 97.36
COG2936 563 Predicted acyl esterases [General function predict 97.34
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 97.34
KOG2564 343 consensus Predicted acetyltransferases and hydrola 97.33
PRK07868 994 acyl-CoA synthetase; Validated 97.33
COG3208 244 GrsT Predicted thioesterase involved in non-riboso 97.32
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 97.28
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 97.28
PRK10162 318 acetyl esterase; Provisional 97.25
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.23
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 97.21
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.2
COG1075336 LipA Predicted acetyltransferases and hydrolases w 97.19
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.19
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 97.15
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.14
KOG2565469 consensus Predicted hydrolases or acyltransferases 97.14
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.13
COG0657312 Aes Esterase/lipase [Lipid metabolism] 97.12
KOG4409 365 consensus Predicted hydrolase/acyltransferase (alp 97.11
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 97.08
PRK10115 686 protease 2; Provisional 97.0
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 96.99
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 96.95
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 96.94
COG4188 365 Predicted dienelactone hydrolase [General function 96.92
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 96.88
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 96.86
PF00975 229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.81
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 96.79
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 96.78
COG4782377 Uncharacterized protein conserved in bacteria [Fun 96.78
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 96.76
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 96.68
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 96.66
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 96.63
PRK06765 389 homoserine O-acetyltransferase; Provisional 96.61
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 96.6
KOG2382 315 consensus Predicted alpha/beta hydrolase [General 96.58
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 96.49
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 96.44
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 96.4
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 96.34
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 96.33
KOG3101283 consensus Esterase D [General function prediction 96.31
KOG2931326 consensus Differentiation-related gene 1 protein ( 96.29
KOG1454 326 consensus Predicted hydrolase/acyltransferase (alp 96.28
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 96.28
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 96.26
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 96.21
PLN02633314 palmitoyl protein thioesterase family protein 96.2
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 96.18
cd00312493 Esterase_lipase Esterases and lipases (includes fu 96.18
COG4814288 Uncharacterized protein with an alpha/beta hydrola 96.17
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 96.11
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 96.03
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 95.98
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 95.96
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 95.86
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 95.86
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 95.78
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 95.76
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 95.75
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 95.72
KOG3724 973 consensus Negative regulator of COPII vesicle form 95.66
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 95.66
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 95.63
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 95.6
PF06028 255 DUF915: Alpha/beta hydrolase of unknown function ( 95.57
PF01674 219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 95.57
KOG3101 283 consensus Esterase D [General function prediction 95.54
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 95.53
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 95.52
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 95.48
COG0400207 Predicted esterase [General function prediction on 95.42
PLN02606306 palmitoyl-protein thioesterase 95.41
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 95.37
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 95.28
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 95.23
COG2936 563 Predicted acyl esterases [General function predict 95.17
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 95.16
TIGR01849 406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 95.01
COG4099387 Predicted peptidase [General function prediction o 94.99
PF00135535 COesterase: Carboxylesterase family The prints ent 94.92
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 94.52
KOG3724 973 consensus Negative regulator of COPII vesicle form 94.49
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 94.48
COG3319 257 Thioesterase domains of type I polyketide synthase 94.44
KOG2281 867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 94.38
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 94.31
PF09752 348 DUF2048: Uncharacterized conserved protein (DUF204 94.26
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 94.18
PRK04940180 hypothetical protein; Provisional 94.08
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 93.97
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 93.85
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 93.83
COG2021 368 MET2 Homoserine acetyltransferase [Amino acid tran 93.82
COG0400207 Predicted esterase [General function prediction on 93.56
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 93.51
KOG4391 300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 93.44
KOG4840299 consensus Predicted hydrolases or acyltransferases 93.4
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 93.35
KOG3043242 consensus Predicted hydrolase related to dienelact 93.24
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 93.13
COG4814 288 Uncharacterized protein with an alpha/beta hydrola 93.07
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 93.06
KOG2237 712 consensus Predicted serine protease [Posttranslati 93.05
KOG3847 399 consensus Phospholipase A2 (platelet-activating fa 92.81
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 92.79
PLN02454 414 triacylglycerol lipase 92.6
COG2819264 Predicted hydrolase of the alpha/beta superfamily 92.58
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 92.57
PF05677 365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 92.49
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 92.48
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 92.46
PRK04940180 hypothetical protein; Provisional 92.45
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 92.38
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 92.29
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 92.28
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 92.28
COG0627 316 Predicted esterase [General function prediction on 92.25
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 92.01
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 91.92
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 91.77
PLN02571 413 triacylglycerol lipase 91.47
COG0627316 Predicted esterase [General function prediction on 91.46
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 91.44
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 91.42
KOG2624 403 consensus Triglyceride lipase-cholesterol esterase 91.32
KOG4667 269 consensus Predicted esterase [Lipid transport and 91.19
PLN02408 365 phospholipase A1 91.19
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 91.06
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 91.04
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 91.02
COG1770 682 PtrB Protease II [Amino acid transport and metabol 90.99
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 90.95
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 90.88
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 90.43
PLN02324 415 triacylglycerol lipase 90.02
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 89.98
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 89.93
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 89.91
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 89.89
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 89.81
PF07167172 PhaC_N: Poly-beta-hydroxybutyrate polymerase (PhaC 89.77
PLN02802 509 triacylglycerol lipase 89.75
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 89.54
KOG2100 755 consensus Dipeptidyl aminopeptidase [Posttranslati 89.46
PLN02310 405 triacylglycerol lipase 88.83
PLN02761 527 lipase class 3 family protein 88.73
PLN03037 525 lipase class 3 family protein; Provisional 88.27
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 88.22
smart00824 212 PKS_TE Thioesterase. Peptide synthetases are invol 88.09
PLN02753 531 triacylglycerol lipase 87.89
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 87.74
PLN00413 479 triacylglycerol lipase 87.38
COG4099387 Predicted peptidase [General function prediction o 87.37
COG5153 425 CVT17 Putative lipase essential for disintegration 87.12
KOG4540 425 consensus Putative lipase essential for disintegra 87.12
PLN02162 475 triacylglycerol lipase 87.1
KOG2029697 consensus Uncharacterized conserved protein [Funct 86.79
COG1505648 Serine proteases of the peptidase family S9A [Amin 86.67
PLN02934 515 triacylglycerol lipase 86.32
PLN02719 518 triacylglycerol lipase 86.31
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 86.19
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 86.06
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 85.84
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 85.22
KOG3975301 consensus Uncharacterized conserved protein [Funct 84.84
PLN02454414 triacylglycerol lipase 84.56
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 84.36
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 84.27
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 84.19
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 84.07
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 83.74
COG3150191 Predicted esterase [General function prediction on 83.62
PLN02847 633 triacylglycerol lipase 83.56
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 81.68
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 81.13
PLN00413479 triacylglycerol lipase 80.9
KOG3975 301 consensus Uncharacterized conserved protein [Funct 80.62
KOG2183492 consensus Prolylcarboxypeptidase (angiotensinase C 80.49
PLN02162475 triacylglycerol lipase 80.19
KOG1516 545 consensus Carboxylesterase and related proteins [G 80.13
COG3150191 Predicted esterase [General function prediction on 80.08
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
Probab=99.76  E-value=4e-18  Score=156.10  Aligned_cols=218  Identities=12%  Similarity=0.091  Sum_probs=163.8

Q ss_pred             EEecCCCeEEEEEEEcCCCCCCCCCceEEEeCCCcCCCcccccCCCChHHHHHhhCCceEEEeCCCCCCCCCCCC----C
Q 014900           85 VSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGAGLSVRGS----N  160 (416)
Q Consensus        85 v~~~~dg~~L~l~ry~p~~~~~~~~~pVlllHG~~~~~~~~~~~~~~sla~~La~~Gy~V~~~D~rG~G~S~~~~----~  160 (416)
                      +.. .||+.|...+| |..+.  ...-|++--+++....+|     +.||.+++.+||+|.++|+||.|.|....    .
T Consensus        10 l~~-~DG~~l~~~~~-pA~~~--~~g~~~va~a~Gv~~~fY-----RrfA~~a~~~Gf~Vlt~dyRG~g~S~p~~~~~~~   80 (281)
T COG4757          10 LPA-PDGYSLPGQRF-PADGK--ASGRLVVAGATGVGQYFY-----RRFAAAAAKAGFEVLTFDYRGIGQSRPASLSGSQ   80 (281)
T ss_pred             ccc-CCCccCccccc-cCCCC--CCCcEEecccCCcchhHh-----HHHHHHhhccCceEEEEecccccCCCccccccCc
Confidence            366 59999999999 44322  233466666777666654     68999999999999999999999998543    2


Q ss_pred             CchHHHHHHHHHHHHHHHH-hcCCCCEEEEEechhhhccCcCcccCCCCCCCCcccccccccccccccccchhhHHHHHH
Q 014900          161 LKEAQQSAHGVSEQMEAVA-NSTTSEAFAKSATNGVYSADPQLTDFPGALSDSKISPVKKEDDLTRLATVWDESKLVTKL  239 (416)
Q Consensus       161 ~~~~~~~~~Dl~~~i~~i~-~~~~~~v~lvGHSmGg~~~~~~~~~~~g~~~~~~~~~v~~~~~~~g~~~~~~~~~~~~~l  239 (416)
                      +.+.|+...|++++++.++ ..+..|.+.||||+||++.++.++.-.-.    ......+...+.|.. ...+...+..|
T Consensus        81 ~~~~DwA~~D~~aal~~~~~~~~~~P~y~vgHS~GGqa~gL~~~~~k~~----a~~vfG~gagwsg~m-~~~~~l~~~~l  155 (281)
T COG4757          81 WRYLDWARLDFPAALAALKKALPGHPLYFVGHSFGGQALGLLGQHPKYA----AFAVFGSGAGWSGWM-GLRERLGAVLL  155 (281)
T ss_pred             cchhhhhhcchHHHHHHHHhhCCCCceEEeeccccceeecccccCcccc----eeeEeccccccccch-hhhhcccceee
Confidence            4568999999999999998 46888999999999999887654322000    000111111222222 11344556667


Q ss_pred             HHHhhhhhHHhhccccccccc---cchHHHHHHHH-------HhcCChhh---hhhHhhhhcccceeEeccCCCCchHHH
Q 014900          240 TETFMSLSERLSGFLSENQSK---IMSAKLFDQIS-------KLLEDSQL---SEGFNEIRGKLSSLLERRQSSAIAIQI  306 (416)
Q Consensus       240 ~~~~~~~~~~~~g~l~~~~~~---~~~~~~~~~~~-------~l~~d~~~---~~r~~~vr~~l~all~~~~~~G~~~~i  306 (416)
                      |++.+|.+..+.||++.+-.+   ++|-.++++|.       ++++|+..   .+.|++++.++......||.++....+
T Consensus       156 ~~lv~p~lt~w~g~~p~~l~G~G~d~p~~v~RdW~RwcR~p~y~fddp~~~~~~q~yaaVrtPi~~~~~~DD~w~P~As~  235 (281)
T COG4757         156 WNLVGPPLTFWKGYMPKDLLGLGSDLPGTVMRDWARWCRHPRYYFDDPAMRNYRQVYAAVRTPITFSRALDDPWAPPASR  235 (281)
T ss_pred             ccccccchhhccccCcHhhcCCCccCcchHHHHHHHHhcCccccccChhHhHHHHHHHHhcCceeeeccCCCCcCCHHHH
Confidence            889999999999999987766   68899999999       46777773   467999999999999999999999999


Q ss_pred             HHHHHHhhhc
Q 014900          307 RDLSQNLVNM  316 (416)
Q Consensus       307 ~~la~~La~~  316 (416)
                      +.+++.+.|+
T Consensus       236 d~f~~~y~nA  245 (281)
T COG4757         236 DAFASFYRNA  245 (281)
T ss_pred             HHHHHhhhcC
Confidence            9999999855



>PLN02872 triacylglycerol lipase Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF07167 PhaC_N: Poly-beta-hydroxybutyrate polymerase (PhaC) N-terminus; InterPro: IPR010941 This entry represents the central domain of the bacterial poly-beta-hydroxybutyrate polymerase (PhaC) Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query416
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 8e-06
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 5e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 53.7 bits (128), Expect = 8e-08
 Identities = 49/352 (13%), Positives = 108/352 (30%), Gaps = 93/352 (26%)

Query: 67  VEKVSDKPPICS-ADELHYVSVANCD---------WRLALWRYNPPPQAPTRNHPLLLLS 116
           ++        C    ++ ++++ NC+          +L L++ +P   + + +   + L 
Sbjct: 168 LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKL-LYQIDPNWTSRSDHSSNIKLR 226

Query: 117 GVGTNAIGYDLSPGSSFARYMAGQGF-----------DTWILEVRGAG----LSVRGSNL 161
               ++I  +L       R +  + +           +              L+ R   +
Sbjct: 227 ---IHSIQAELR------RLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQV 277

Query: 162 KEAQQSAHGVSEQMEAVANS-TTSEA---FAKSATNGVYSADPQLTDFPGALSDSKISPV 217
            +   +A      ++  + + T  E      K          PQ  D P        +P 
Sbjct: 278 TDFLSAATTTHISLDHHSMTLTPDEVKSLLLK-----YLDCRPQ--DLP--REVLTTNPR 328

Query: 218 -------KKEDDLTRLATVWDESKLVT--KLTETF-MSLSERLSGFLSENQSKIMSAKLF 267
                     D L      WD  K V   KLT     SL+      L   + +    K+F
Sbjct: 329 RLSIIAESIRDGLAT----WDNWKHVNCDKLTTIIESSLNV-----LEPAEYR----KMF 375

Query: 268 DQISKLLEDSQLSEGFNEIRGKLSSLLERRQSSAIAIQIRDLSQNLVN--MIEEGQLSVS 325
           D++S     + +             LL       I   +  +   L    ++E+     +
Sbjct: 376 DRLSVFPPSAHIPT----------ILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKEST 425

Query: 326 PQLFDLQERLFSTIDDFQKQL--DLIVQYD----WDFDHYLEEDVPAAMEYI 371
             +  +   L   +++ +  L   ++  Y+    +D D  +    P   +Y 
Sbjct: 426 ISIPSIYLELKVKLEN-EYALHRSIVDHYNIPKTFDSDDLI---PPYLDQYF 473


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Length = 377 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query416
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.72
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.71
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.69
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.68
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.68
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.68
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.67
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.66
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.66
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.66
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.65
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.65
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.65
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.65
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.64
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.64
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.63
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.63
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.62
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.62
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.62
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.61
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.61
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.6
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.6
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.6
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.59
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.59
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.59
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.58
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.58
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.58
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.57
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.57
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.57
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.57
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.56
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.56
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.56
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.55
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.55
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.54
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.54
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.54
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.53
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.53
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.53
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.53
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.53
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.53
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.53
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.53
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.53
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.52
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.52
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.52
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.5
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.5
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.49
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.49
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.48
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.48
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.48
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.48
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.47
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.47
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.47
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.47
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.46
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.46
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.46
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.46
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.45
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.45
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.43
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.43
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.43
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.43
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.42
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.42
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.41
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.4
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.4
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.1
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.39
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.39
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.38
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.37
3h04_A275 Uncharacterized protein; protein with unknown func 99.37
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.36
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.36
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.36
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.35
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.35
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.35
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.34
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.34
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.34
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.34
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.33
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.32
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.32
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.31
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.3
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.3
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.29
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.27
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.27
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 99.27
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.25
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.25
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.25
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.24
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.24
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.2
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.19
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.18
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.18
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.18
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.16
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.15
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.15
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.15
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.15
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.13
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.12
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.12
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.12
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.12
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.11
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.11
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.1
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.1
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.1
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 99.09
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.09
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 99.09
3lp5_A250 Putative cell surface hydrolase; structural genom 99.09
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.07
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.07
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.07
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 99.06
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.05
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.05
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.05
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.04
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.03
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.02
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.02
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.02
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.01
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.01
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.0
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.0
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.0
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 99.0
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.99
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.99
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.99
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.98
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.98
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.98
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.98
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.98
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.97
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.97
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 98.97
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.97
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.96
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.96
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.96
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.95
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 98.95
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.92
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.92
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.92
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.91
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.91
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.9
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.9
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.9
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.9
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.89
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.88
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.87
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.85
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.85
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.84
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.84
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.83
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.83
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.82
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.82
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.82
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.81
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.81
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.81
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 98.81
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.81
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.8
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.8
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.8
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.78
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.77
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.77
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 98.76
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.76
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.75
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.74
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.72
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.72
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.72
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.71
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.71
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.71
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.7
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.7
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.7
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.69
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 98.69
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.68
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.68
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.68
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.67
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.67
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 98.66
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.66
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.65
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.65
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 98.64
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 98.64
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.64
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.63
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.63
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.63
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.63
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.63
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.62
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.62
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.62
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.61
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.61
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 98.6
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.59
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.58
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.58
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 98.58
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.57
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.57
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.57
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.56
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.56
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.55
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.55
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 98.55
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.55
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.55
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.55
1r3d_A 264 Conserved hypothetical protein VC1974; structural 98.54
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.53
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.53
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.53
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.53
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.53
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 98.53
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.51
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 98.5
1iup_A 282 META-cleavage product hydrolase; aromatic compound 98.5
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.5
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.49
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.49
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 98.48
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.48
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.48
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.48
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.47
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 98.47
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.46
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.46
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.46
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 98.46
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 98.46
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.45
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 98.45
3llc_A 270 Putative hydrolase; structural genomics, joint cen 98.44
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 98.44
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.44
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.44
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.43
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.42
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.41
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.41
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.41
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.41
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.41
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.41
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 98.41
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 98.4
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.39
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.39
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.38
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 98.37
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.37
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.36
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.35
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.34
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.34
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 98.33
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.33
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.32
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.32
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 98.32
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 98.31
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.3
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.3
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 98.29
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.29
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.29
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.28
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.27
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 98.27
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.26
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 98.26
3h04_A 275 Uncharacterized protein; protein with unknown func 98.25
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.24
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.23
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.23
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 98.23
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.23
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 98.22
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.22
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.22
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.22
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.21
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.2
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 98.2
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.2
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.19
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.19
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.19
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 98.18
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.18
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.17
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.17
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.17
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 98.16
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.16
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.15
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.15
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.13
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.11
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 98.11
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.1
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.39
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.1
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 98.1
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 98.09
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.09
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.09
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 98.09
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.08
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 98.08
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.08
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.06
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.06
3fle_A 249 SE_1780 protein; structural genomics, APC61035.1, 98.05
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.05
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.05
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 98.05
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.04
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.04
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.04
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 98.01
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.01
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 98.01
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 98.01
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.01
3lp5_A 250 Putative cell surface hydrolase; structural genom 98.01
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.0
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 97.99
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.97
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.97
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 97.97
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 97.96
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 97.96
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.95
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.95
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.94
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.94
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.94
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.94
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.92
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.92
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 97.91
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 97.91
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.91
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.9
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.89
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.89
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.88
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 97.88
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.87
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 97.86
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 97.86
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 97.83
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 97.83
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 97.83
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 97.82
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.8
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.79
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.79
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.78
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 97.78
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 97.78
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 97.77
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 97.77
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 97.77
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 97.76
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 97.75
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.74
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.72
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.7
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.7
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 97.7
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.66
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.65
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 97.64
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.62
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 97.59
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 97.59
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 97.59
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 97.58
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.56
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 97.55
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 97.55
3ds8_A 254 LIN2722 protein; unkonwn function, structural geno 97.54
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.41
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.36
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 97.35
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 97.35
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 97.29
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.28
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 97.27
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 97.23
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 97.18
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 97.16
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 97.15
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 97.02
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 97.0
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 96.93
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 96.92
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 96.92
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 96.92
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 96.83
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 96.81
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 96.73
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 96.73
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 96.72
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 96.71
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 96.7
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 96.7
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 96.47
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 96.28
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 96.28
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 96.27
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 96.06
1ivy_A452 Human protective protein; carboxypeptidase, serine 96.04
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 96.04
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 96.0
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 95.85
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 95.8
4f21_A246 Carboxylesterase/phospholipase family protein; str 95.67
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 95.49
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 95.38
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 95.26
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 95.11
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 95.09
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 94.72
1tia_A 279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 94.67
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 94.61
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 94.4
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 93.7
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 93.3
3ngm_A 319 Extracellular lipase; secret lipase, hydrolase; 2. 93.28
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 93.15
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 93.09
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 93.07
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 93.0
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 92.85
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 92.37
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 92.29
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 92.24
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 92.15
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 92.12
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 91.56
3o0d_A 301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 91.45
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 90.87
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 90.76
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 90.65
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 90.63
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
Probab=99.72  E-value=3.5e-17  Score=159.11  Aligned_cols=114  Identities=18%  Similarity=0.255  Sum_probs=86.9

Q ss_pred             ceEEEEEecCCCeEEEEEEEcCCCCCCCCCceEEEeCCCcCCCcccccCCCChHHHHHhhCCceEEEeCCCCC-CCCCCC
Q 014900           80 DELHYVSVANCDWRLALWRYNPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGSSFARYMAGQGFDTWILEVRGA-GLSVRG  158 (416)
Q Consensus        80 ~e~~~v~~~~dg~~L~l~ry~p~~~~~~~~~pVlllHG~~~~~~~~~~~~~~sla~~La~~Gy~V~~~D~rG~-G~S~~~  158 (416)
                      .+.+++.+ .||.+|+++.+.|.+..+..+++|||+||++.+...|.     .++++|+++||+|+++|+||| |.|...
T Consensus         7 ~~~~~i~~-~dG~~l~~~~~~p~~~~~~~~~~VvllHG~g~~~~~~~-----~~~~~L~~~G~~Vi~~D~rGh~G~S~~~   80 (305)
T 1tht_A            7 TIAHVLRV-NNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFA-----GLAEYLSTNGFHVFRYDSLHHVGLSSGS   80 (305)
T ss_dssp             CEEEEEEE-TTTEEEEEEEECCCTTSCCCSCEEEEECTTCGGGGGGH-----HHHHHHHTTTCCEEEECCCBCC------
T ss_pred             ceEEEEEc-CCCCEEEEEEecCcccCCCCCCEEEEecCCccCchHHH-----HHHHHHHHCCCEEEEeeCCCCCCCCCCc
Confidence            45667787 69999999988765321113678999999999998884     699999999999999999999 999764


Q ss_pred             CCCchHHHHHHHHHHHHHHHHhcCCCCEEEEEechhhhccC
Q 014900          159 SNLKEAQQSAHGVSEQMEAVANSTTSEAFAKSATNGVYSAD  199 (416)
Q Consensus       159 ~~~~~~~~~~~Dl~~~i~~i~~~~~~~v~lvGHSmGg~~~~  199 (416)
                      ......+..++|+.++++++.+.+..+++++||||||.++.
T Consensus        81 ~~~~~~~~~~~D~~~~~~~l~~~~~~~~~lvGhSmGG~iA~  121 (305)
T 1tht_A           81 IDEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVAY  121 (305)
T ss_dssp             --CCCHHHHHHHHHHHHHHHHHTTCCCEEEEEETHHHHHHH
T ss_pred             ccceehHHHHHHHHHHHHHHHhCCCCceEEEEECHHHHHHH
Confidence            33344677888999999998755778999999999999653



>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 416
d1k8qa_377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 1e-05
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 5e-04
d1gs9a_144 a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapien 0.002
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]
 Score = 44.7 bits (104), Expect = 1e-05
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 5/77 (6%)

Query: 81  ELHYVSVANCDWRLALWR---YNPPPQAPTRNHPLLLLSGVGTNAIGYDLS-PGSSFARY 136
           E + V   +  + L + R        +   R     L  G+  +A  +  + P +S A  
Sbjct: 28  EEYEVVTED-GYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLPNNSLAFI 86

Query: 137 MAGQGFDTWILEVRGAG 153
           +A  G+D W+   RG  
Sbjct: 87  LADAGYDVWLGNSRGNT 103


>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Length = 144 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query416
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.83
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.77
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.68
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.66
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.65
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.65
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.65
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.61
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.61
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.61
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.6
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.6
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.6
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.58
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.57
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.56
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.56
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.56
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.55
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.55
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.55
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.52
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.51
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.5
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.49
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.48
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.48
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.45
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.41
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.38
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.37
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.3
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.28
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.28
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.28
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.24
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.16
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.13
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.11
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.1
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.08
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.05
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.05
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.96
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.94
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.86
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.84
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.79
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.78
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 98.75
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.71
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.7
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 98.68
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.68
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.66
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 98.65
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.64
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.61
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.61
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.6
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 98.57
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.55
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.54
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.54
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.53
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.51
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.5
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.49
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.47
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.46
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.43
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.42
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.38
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.38
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.37
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.36
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.36
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.32
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.31
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 98.3
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.3
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.28
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.26
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.25
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.2
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.2
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.19
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.15
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.14
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.14
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.13
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 98.12
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.1
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.06
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.05
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.04
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.02
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.01
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.0
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.95
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 97.93
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 97.91
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.91
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 97.91
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.89
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 97.89
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 97.87
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.85
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.83
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 97.82
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 97.79
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 97.76
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 97.72
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 97.72
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 97.71
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.71
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.7
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 97.69
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 97.65
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 97.6
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.59
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.5
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 97.48
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.47
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 97.46
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 97.46
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 97.42
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.41
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.32
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 97.23
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.2
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 97.2
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 97.15
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.13
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.12
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 97.07
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 97.05
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.04
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 96.9
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 96.81
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 96.8
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 96.77
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 96.72
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 96.71
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 96.65
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 96.62
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 96.36
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 96.28
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 96.19
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 96.18
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 96.17
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 96.11
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 95.91
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 95.69
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 95.46
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 95.41
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 95.24
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 95.21
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 95.18
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 94.99
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 94.99
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 94.72
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 94.62
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 94.27
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 94.26
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 93.86
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 93.74
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 93.23
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 92.95
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 92.61
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 92.56
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 92.46
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 91.3
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 91.1
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 90.19
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 89.68
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 89.48
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 89.47
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 89.47
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 89.24
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 89.23
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 87.72
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 87.3
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 86.69
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 85.78
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 85.31
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 84.69
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 83.81
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 82.53
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 82.12
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]
Probab=99.83  E-value=1.4e-20  Score=181.10  Aligned_cols=119  Identities=16%  Similarity=0.200  Sum_probs=97.4

Q ss_pred             CceEEEEEecCCCeEEEEEEEcCC---CCCCCCCceEEEeCCCcCCCcccccC-CCChHHHHHhhCCceEEEeCCCCCCC
Q 014900           79 ADELHYVSVANCDWRLALWRYNPP---PQAPTRNHPLLLLSGVGTNAIGYDLS-PGSSFARYMAGQGFDTWILEVRGAGL  154 (416)
Q Consensus        79 ~~e~~~v~~~~dg~~L~l~ry~p~---~~~~~~~~pVlllHG~~~~~~~~~~~-~~~sla~~La~~Gy~V~~~D~rG~G~  154 (416)
                      +.|.|+++| .||+.|.++|+...   ......++||||+||++.++..|..+ +..++|++|+++||+||++|+||||.
T Consensus        26 ~~e~h~v~t-~DG~~l~~~ri~~~~~~~~~~~~~~~vlllHG~~~~~~~~~~~~~~~sla~~L~~~Gy~V~~~D~rG~G~  104 (377)
T d1k8qa_          26 PAEEYEVVT-EDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTW  104 (377)
T ss_dssp             CCEEEEEEC-TTSEEEEEEEECSCSSCCTTTTTCCEEEEECCTTCCGGGGSSSCTTTCHHHHHHHTTCEEEECCCTTSTT
T ss_pred             CceEEEEEc-CCCCEEEEEEecCCCCCCccCCCCCeEEEECCCccchhHHhhcCccchHHHHHHHCCCEEEEEcCCCCCC
Confidence            358999999 69999999987321   11112468999999999999999876 55789999999999999999999999


Q ss_pred             CCCCCC----------CchHHHHHHHHHHHHHHHH-hcCCCCEEEEEechhhhcc
Q 014900          155 SVRGSN----------LKEAQQSAHGVSEQMEAVA-NSTTSEAFAKSATNGVYSA  198 (416)
Q Consensus       155 S~~~~~----------~~~~~~~~~Dl~~~i~~i~-~~~~~~v~lvGHSmGg~~~  198 (416)
                      |.++..          ..+.+...+|+.+++++++ ..+.++++++||||||+++
T Consensus       105 S~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~i~~i~~~~g~~~v~lvGhS~GG~ia  159 (377)
T d1k8qa_         105 ARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFILKKTGQDKLHYVGHSQGTTIG  159 (377)
T ss_dssp             SCEESSSCTTSTTTTCCCHHHHHHTHHHHHHHHHHHHHCCSCEEEEEETHHHHHH
T ss_pred             CCCCCCCCCcchhhccCCHHHHhhhhHHHHHHHHHHHcCCCCEEEEEecchHHHH
Confidence            975321          2245677889999999998 6789999999999999854



>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure