Citrus Sinensis ID: 015021


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTTSLNYSVRQR
cccccccEEEEEEEcccccccccccccccccccEEEEcccccHHHHEEccEEEEEEEcccccccEEEEEEcccccccEEEEEEEEEEcccEEEEEEccccEEEEEEcccccHHHHHcccccEEEEEEEcccccccccccccEEEEEEccEEEEEEccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHcccccccEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccEEEEEEccccEEEEEcccccccEEEEEEEEEccccccccccccccccccEEEEEEEccccccHHHHHccccccEEEEEEEccccc
ccccccccEEEEEEHHHHHHHcccccccccccHHHHHHHcHHHHHHHccEEEEEEEcccccccEEEEEEEccccccccEEEEEEEcccccEEEEEEccccEEEEEEccHHHHHHHHcccccEEEEEEEcccccccccccccEEEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccccccEEEEEEEccccccHHHHHHccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEccccccccEEEEEcccccEEEEEccccEEEEEEHHHcEEEEEEccccccEEEEEEEcccccccccccccccccccEEEEEEEEcccccHHHHHHHHHccccccEEccccccc
mskrthttevgsiactdlsdlgagkegwlvndpnllcALDMHTIALANRYQTVIINwadpeglvakirpelspiaSEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLvhrqlihpgrilklrvrgsrrdltqdtaeeevCVVMpgvlarfdgSEIQKMLQRWFqdsnsnfwdqkpkqrdsedLENSYerlphqlwnvskygpcadaaitglmppplmevqssqRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWrseqspkksepkpqsfaraspltclkdhprkgerltlspsgslAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKdaatssayyapvksdyclclaihapRKGIIEHLAgmadenwttslnysvrqr
mskrthttevgsiactdlsdlgaGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLvhrqlihpgrilklrvrgsrrdltqdtaeeevcvvMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAilskvvpatfstiSSLSKMIWRSEqspkksepkpqsfaraspltclkdhprkgerltlspsgsLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAgmadenwttslnysvrqr
MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTTSLNYSVRQR
**********GSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQD************************LPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIW******************************************LAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTTSLN******
*********VGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRV*************EEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSN*******************RLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLS**************************TCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFME*********************CLCLAIHAPRKGIIEHLAGMADENWTTSLNYS****
**********GSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWD*************SYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMI*******************ASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTTSLNYSVRQR
****THTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRS*************FARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVN************VKSDYCLCLAIHAPRKGIIEHLAGMAD**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTTSLNYSVRQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q9H2M9 1393 Rab3 GTPase-activating pr yes no 0.695 0.206 0.269 7e-19
Q5U1Z0 1386 Rab3 GTPase-activating pr yes no 0.693 0.207 0.272 1e-18
Q8BMG7 1366 Rab3 GTPase-activating pr yes no 0.700 0.212 0.259 4e-18
Q9VKB9 1341 Rab3 GTPase-activating pr yes no 0.753 0.232 0.239 4e-12
>sp|Q9H2M9|RBGPR_HUMAN Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens GN=RAB3GAP2 PE=1 SV=1 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 90/334 (26%), Positives = 149/334 (44%), Gaps = 46/334 (13%)

Query: 93  LAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSR--RDLTQDTAEEEVCVVMPGV 150
           + VG + GY   Y   G L+  QL++   +L+L+ R     R        EE+ ++ P  
Sbjct: 156 IVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPGVTEQNEELSILYPAA 215

Query: 151 LARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADA 210
           +   DG  + + L+           +Q  K   S +       L ++ W +       D 
Sbjct: 216 IVTIDGFSLFQSLRA--------CRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDH 267

Query: 211 AITGLM---PPPLMEVQSSQRYFCA------------VTIGEDSVISAFRLSEDRSRSLV 255
           A  G+M   P   M+  S+   F A            +T+G +     F   E  ++ L+
Sbjct: 268 ASVGIMTLSPFDQMKTASNIGGFNAAIKNSPPAMSQYITVGSNPFTGFFYALEGSTQPLL 327

Query: 256 G----AILSKVVPATFSTISSLSKMIWRS---EQSPKKSEPKPQSFARASPLTC---LKD 305
                A+ SK+  A F+  S    + W+S   E++ +K +PK +    A+PL     L D
Sbjct: 328 SHVALAVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPKVEP---ATPLAVRFGLPD 382

Query: 306 HPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVN-KDA 364
             R GE + LSP  +LAA+TD  GR++LLD    + +R+WKGYRDA   +++ + +  + 
Sbjct: 383 SRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQTVEDLHER 442

Query: 365 ATSSAYYAPVK-----SDYCLCLAIHAPRKGIIE 393
               A ++P       S     L I+APR+GI+E
Sbjct: 443 VPEKADFSPFGNSQGPSRVAQFLVIYAPRRGILE 476




Regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3-GDP. Required for normal eye and brain development. May participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non-synaptic vesicular release of neurotransmitters.
Homo sapiens (taxid: 9606)
>sp|Q5U1Z0|RBGPR_RAT Rab3 GTPase-activating protein non-catalytic subunit OS=Rattus norvegicus GN=Rab3gap2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BMG7|RBGPR_MOUSE Rab3 GTPase-activating protein non-catalytic subunit OS=Mus musculus GN=Rab3gap2 PE=1 SV=2 Back     alignment and function description
>sp|Q9VKB9|RBGPR_DROME Rab3 GTPase-activating protein regulatory subunit OS=Drosophila melanogaster GN=rab3-GAP PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
225461677457 PREDICTED: rab3 GTPase-activating protei 0.949 0.859 0.756 0.0
255567076484 rab3 gtpase-activating protein non-catal 0.939 0.803 0.746 1e-173
297830038455 hypothetical protein ARALYDRAFT_478912 [ 0.949 0.863 0.711 1e-170
449456579456 PREDICTED: rab3 GTPase-activating protei 0.949 0.861 0.711 1e-169
15231948455 uncharacterized protein [Arabidopsis tha 0.949 0.863 0.706 1e-169
449516756456 PREDICTED: rab3 GTPase-activating protei 0.949 0.861 0.708 1e-168
356514563460 PREDICTED: rab3 GTPase-activating protei 0.949 0.854 0.685 1e-160
356543215459 PREDICTED: rab3 GTPase-activating protei 0.944 0.851 0.685 1e-157
224116998354 predicted protein [Populus trichocarpa] 0.702 0.822 0.749 1e-128
115478506469 Os09g0315800 [Oryza sativa Japonica Grou 0.942 0.831 0.567 1e-121
>gi|225461677|ref|XP_002285458.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit [Vitis vinifera] gi|302142895|emb|CBI20190.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/398 (75%), Positives = 353/398 (88%), Gaps = 5/398 (1%)

Query: 1   MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWA-- 58
           M++R +TTE+G IAC +LS+LGAGKE WLV +P+L+CALD  ++ALANR   +++ W+  
Sbjct: 1   MARRVYTTELGCIACNELSELGAGKEAWLVENPSLICALDTDSLALANRSFVLVLGWSEN 60

Query: 59  -DPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLI 117
            DP     KIRP LS I +E ITA+EWLVF+E+R LAVGTS GY ++Y L  DL+H+Q+I
Sbjct: 61  GDPYNSPVKIRPTLSQIETERITAVEWLVFDEIRVLAVGTSSGYLMIYSLGADLIHKQMI 120

Query: 118 HPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQ 177
           +PGRILK RVRG++RDLTQ ++ EEVCVVMPGV+ARFDG+++Q MLQRWFQD++S FWD+
Sbjct: 121 NPGRILKFRVRGTKRDLTQGSSSEEVCVVMPGVIARFDGADLQSMLQRWFQDTHSQFWDE 180

Query: 178 KPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGE 237
           KPK+RD ED E SY RLP+QLWNVSKYGPCADAAITG MPPPLME+QSSQRY+CAVTIG+
Sbjct: 181 KPKRRDQEDSEKSYGRLPYQLWNVSKYGPCADAAITGTMPPPLMELQSSQRYYCAVTIGD 240

Query: 238 DSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQ-SPKKSEPKPQSFAR 296
           D+VISAFRLSEDR+RSLVGAILSKVVPATFSTI+S SKMIWRSEQ SPK+SEPKPQ FAR
Sbjct: 241 DAVISAFRLSEDRNRSLVGAILSKVVPATFSTIASFSKMIWRSEQKSPKRSEPKPQPFAR 300

Query: 297 ASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFM 356
           ASPLTCLKDHPRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVVRLWKGYRDASC+F 
Sbjct: 301 ASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFT 360

Query: 357 EMLVNKD-AATSSAYYAPVKSDYCLCLAIHAPRKGIIE 393
           EMLV+KD AA+SS+YY PVKSDYCLCLAIHAPRKGI+E
Sbjct: 361 EMLVSKDTAASSSSYYEPVKSDYCLCLAIHAPRKGIVE 398




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255567076|ref|XP_002524520.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] gi|223536194|gb|EEF37847.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297830038|ref|XP_002882901.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] gi|297328741|gb|EFH59160.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449456579|ref|XP_004146026.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15231948|ref|NP_188109.1| uncharacterized protein [Arabidopsis thaliana] gi|8777474|dbj|BAA97054.1| unnamed protein product [Arabidopsis thaliana] gi|63147384|gb|AAY34165.1| At3g14910 [Arabidopsis thaliana] gi|115646783|gb|ABJ17116.1| At3g14910 [Arabidopsis thaliana] gi|332642066|gb|AEE75587.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449516756|ref|XP_004165412.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356514563|ref|XP_003525975.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|356543215|ref|XP_003540058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|224116998|ref|XP_002331804.1| predicted protein [Populus trichocarpa] gi|222874500|gb|EEF11631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115478506|ref|NP_001062848.1| Os09g0315800 [Oryza sativa Japonica Group] gi|51091645|dbj|BAD36414.1| rab3-GAP regulatory domain-like [Oryza sativa Japonica Group] gi|113631081|dbj|BAF24762.1| Os09g0315800 [Oryza sativa Japonica Group] gi|218201904|gb|EEC84331.1| hypothetical protein OsI_30840 [Oryza sativa Indica Group] gi|222641308|gb|EEE69440.1| hypothetical protein OsJ_28835 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2086390455 AT3G14910 "AT3G14910" [Arabido 0.949 0.863 0.706 3.1e-154
ZFIN|ZDB-GENE-030616-610 1373 rab3gap2 "RAB3 GTPase activati 0.705 0.212 0.278 1.5e-18
UNIPROTKB|E1BVG8 1386 RAB3GAP2 "Uncharacterized prot 0.710 0.212 0.269 1.9e-18
UNIPROTKB|D4ABP4 1367 Rab3gap2 "Rab3 GTPase-activati 0.705 0.213 0.260 2e-17
RGD|1311518 1386 Rab3gap2 "RAB3 GTPase activati 0.702 0.209 0.260 7.6e-17
UNIPROTKB|E2R4W9 1540 RAB3GAP2 "Uncharacterized prot 0.702 0.188 0.262 8.7e-17
UNIPROTKB|F1S9J9 1391 RAB3GAP2 "Uncharacterized prot 0.705 0.209 0.260 1e-16
UNIPROTKB|Q9H2M9 1393 RAB3GAP2 "Rab3 GTPase-activati 0.705 0.209 0.257 1.3e-16
MGI|MGI:1916043 1366 Rab3gap2 "RAB3 GTPase activati 0.702 0.213 0.257 2.8e-16
UNIPROTKB|G5E601 1392 RAB3GAP2 "Uncharacterized prot 0.705 0.209 0.254 4.8e-16
TAIR|locus:2086390 AT3G14910 "AT3G14910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1504 (534.5 bits), Expect = 3.1e-154, P = 3.1e-154
 Identities = 279/395 (70%), Positives = 337/395 (85%)

Query:     1 MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADP 60
             M+KR H TE+G IAC +L++LGAGKEGWLVN+PNLL ALD H++ALANR+  +I+NW DP
Sbjct:     1 MAKRIHLTELGCIACEELTELGAGKEGWLVNNPNLLSALDSHSLALANRFLILIVNWGDP 60

Query:    61 EGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPG 120
             +    KIRP+LSPI +E ITAIEWLVF+++R +  GTS GY LVY + GDL+H+Q++H  
Sbjct:    61 DAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVTGDLIHKQIVHQS 120

Query:   121 RILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPK 180
             RILK+RVRG+++DL Q+T+ EE+C+V+PGV+ARFDGS IQ M+Q+W Q+ NSNFWDQK +
Sbjct:   121 RILKIRVRGTKKDLMQETSSEEICIVLPGVIARFDGSNIQSMVQKWVQEKNSNFWDQKNR 180

Query:   181 QRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSV 240
             + D+ED  + Y+RLP+Q+WNV+K G C DA +TG+MPPPL+E+QSSQRY+CAVTIGEDSV
Sbjct:   181 KGDAEDTGSLYQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQSSQRYYCAVTIGEDSV 240

Query:   241 ISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRS-EQSPK-KSEPKPQSFARAS 298
             ISA+RLSEDR RSLVGAILSKVVPA  STI+S SK+IWRS +QSPK K E K QSFARAS
Sbjct:   241 ISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARAS 300

Query:   299 PLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEM 358
              LTC+KD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEM
Sbjct:   301 SLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEM 360

Query:   359 LVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIE 393
             L  KD   S  +  PVKSDYCLCLAIHAPRKGIIE
Sbjct:   361 LAKKDKGKSVIHTEPVKSDYCLCLAIHAPRKGIIE 395




GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-030616-610 rab3gap2 "RAB3 GTPase activating protein subunit 2 (non-catalytic)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVG8 RAB3GAP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D4ABP4 Rab3gap2 "Rab3 GTPase-activating protein non-catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1311518 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4W9 RAB3GAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9J9 RAB3GAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2M9 RAB3GAP2 "Rab3 GTPase-activating protein non-catalytic subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916043 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G5E601 RAB3GAP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 100.0
KOG2727 1244 consensus Rab3 GTPase-activating protein, non-cata 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.85
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 97.76
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 97.42
KOG0263707 consensus Transcription initiation factor TFIID, s 96.89
KOG0266 456 consensus WD40 repeat-containing protein [General 96.66
PTZ00421 493 coronin; Provisional 96.62
KOG1539 910 consensus WD repeat protein [General function pred 96.61
PLN00181793 protein SPA1-RELATED; Provisional 96.55
KOG0266 456 consensus WD40 repeat-containing protein [General 96.55
KOG0299 479 consensus U3 snoRNP-associated protein (contains W 96.54
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 96.23
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.21
KOG0649 325 consensus WD40 repeat protein [General function pr 95.99
KOG0263707 consensus Transcription initiation factor TFIID, s 95.94
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 95.9
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 95.79
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 95.78
KOG0639 705 consensus Transducin-like enhancer of split protei 94.99
KOG0265 338 consensus U5 snRNP-specific protein-like factor an 94.81
KOG2727 1244 consensus Rab3 GTPase-activating protein, non-cata 94.67
PTZ00421 493 coronin; Provisional 94.5
KOG0315311 consensus G-protein beta subunit-like protein (con 94.47
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 94.23
KOG0279 315 consensus G protein beta subunit-like protein [Sig 94.12
KOG0316 307 consensus Conserved WD40 repeat-containing protein 94.1
KOG1273 405 consensus WD40 repeat protein [General function pr 93.94
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.84
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.82
PTZ00420 568 coronin; Provisional 93.79
KOG0295406 consensus WD40 repeat-containing protein [Function 93.72
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 92.98
PTZ00420 568 coronin; Provisional 92.96
PLN00181 793 protein SPA1-RELATED; Provisional 92.73
PF14727418 PHTB1_N: PTHB1 N-terminus 91.63
KOG0308 735 consensus Conserved WD40 repeat-containing protein 91.16
KOG1274933 consensus WD40 repeat protein [General function pr 91.03
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 90.63
KOG0284 464 consensus Polyadenylation factor I complex, subuni 90.55
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 89.89
KOG0646476 consensus WD40 repeat protein [General function pr 89.83
KOG0279315 consensus G protein beta subunit-like protein [Sig 88.95
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 88.75
KOG0277 311 consensus Peroxisomal targeting signal type 2 rece 88.54
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 88.25
KOG0282503 consensus mRNA splicing factor [Function unknown] 88.14
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 88.07
KOG0283712 consensus WD40 repeat-containing protein [Function 87.56
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 86.82
KOG0318603 consensus WD40 repeat stress protein/actin interac 86.76
KOG1407313 consensus WD40 repeat protein [Function unknown] 86.67
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 86.29
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 86.28
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 86.21
KOG0288459 consensus WD40 repeat protein TipD [General functi 85.97
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 85.78
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 84.91
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 84.83
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 84.47
KOG0296 399 consensus Angio-associated migratory cell protein 84.16
KOG0275 508 consensus Conserved WD40 repeat-containing protein 84.08
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 83.83
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 83.76
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 83.5
KOG0318 603 consensus WD40 repeat stress protein/actin interac 83.07
KOG1912 1062 consensus WD40 repeat protein [General function pr 82.61
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 82.15
KOG0316307 consensus Conserved WD40 repeat-containing protein 81.96
KOG0282 503 consensus mRNA splicing factor [Function unknown] 81.84
COG2319 466 FOG: WD40 repeat [General function prediction only 81.61
KOG2110 391 consensus Uncharacterized conserved protein, conta 80.22
KOG0293519 consensus WD40 repeat-containing protein [Function 80.18
KOG0646 476 consensus WD40 repeat protein [General function pr 80.12
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
Probab=100.00  E-value=2.1e-100  Score=782.62  Aligned_cols=365  Identities=31%  Similarity=0.452  Sum_probs=310.8

Q ss_pred             cccCCCeeeeccCcceeeeeecceEEE--EeecCCC------CCceeecccCCCCCCCeEEEEEeEEe---------CCc
Q 015021           28 WLVNDPNLLCALDMHTIALANRYQTVI--INWADPE------GLVAKIRPELSPIASEYITAIEWLVF---------EEM   90 (414)
Q Consensus        28 WL~~~~~~~~sp~~~~la~A~~~~~v~--~~w~~~~------~~~v~~~g~l~~~~~e~ITs~~~lpl---------~dw   90 (414)
                      ||+| |++++||+||+||+|+++|+||  .+|+.++      .+.+.|+|+|+.+++|+|||++||||         +||
T Consensus         1 WL~~-~~isls~~~d~laiA~~~r~vil~~~w~~~~~~~~~~~~~~~~~g~l~~~~~e~ITsi~clpl~s~~~s~~~~dw   79 (415)
T PF14655_consen    1 WLQD-CSISLSPDGDLLAIARGQRLVILTSKWDSSRKGENENTYSISWSGPLDDEPGECITSILCLPLSSQKRSTGGPDW   79 (415)
T ss_pred             Cccc-ceEEecCCCCEEEEEcCCEEEEEEeeccccccCCCCCeEEEEeeeeccCCCCCEEEEEEEEEeecccccCCCCCc
Confidence            9999 9999999999999999999999  5895533      24489999999977799999999999         899


Q ss_pred             EEEEEeccccEEEEEecCCcEEeecccCccceeEEEEecccCCCCCCCCCCeEEEEeCCeEEEEeChhHHHHHHHHHHhc
Q 015021           91 RALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDS  170 (414)
Q Consensus        91 ~~I~VG~ssG~vrfyte~G~LL~sQ~lh~~pV~~ik~r~~~~~~~~~~~~eel~Ily~~~iv~IdG~sL~~~Lr~c~~~~  170 (414)
                      +||||||++||||||||+|+|||+|+||++||++||||+++++..++...|||+|+||++||+|||++|+++|++|++|+
T Consensus        80 ~~I~VG~ssG~vrfyte~G~LL~~Q~~h~~pV~~ik~~~~~~~~~~~~~~eel~ily~~~v~~Idg~sL~~~L~~~~~~~  159 (415)
T PF14655_consen   80 TCIAVGTSSGYVRFYTENGVLLLSQLLHEEPVLKIKCRSTKIPRHPGDSSEELSILYPSAVVIIDGFSLFSVLRACRNQV  159 (415)
T ss_pred             EEEEEEecccEEEEEeccchHHHHHhcCccceEEEEecccCCCCCCcccccEEEEEECCEEEEEecHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999866666666999999999999999999999999999999


Q ss_pred             cccccCCCCccCCCcccccccCCccceecccCCCCCceeeEEeCCCCCCchhhh--------------ccccceeEEEeC
Q 015021          171 NSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ--------------SSQRYFCAVTIG  236 (414)
Q Consensus       171 ~~~~w~~~~~~~~~~~~~~~~~~L~ykKW~l~~~~~i~Daa~~G~~~p~~~d~~--------------s~~~~~~~i~vG  236 (414)
                      +++.|+.+       + .+.+++|+||||+|++++.|+|++++|+++|++||++              +...++++|++|
T Consensus       160 ~~~~~~~~-------~-~~~~~~L~ykKw~l~~~~~i~D~~~~G~~~~~~fd~l~~aS~~gf~a~~~~s~~~~~~~i~~G  231 (415)
T PF14655_consen  160 ARGAASGS-------D-SPAPPPLSYKKWNLQSQDTINDAAICGPMPPSTFDHLVTASIGGFNAKYRSSPPRMSRYITVG  231 (415)
T ss_pred             hhhhhccc-------c-cCCCCccceeEecCCCCCcEeeEEEecCCCCcHHHHHHhhhcccccceeecCCcceEEEEEec
Confidence            99865321       1 3347889999999999999999999999999999984              335778999999


Q ss_pred             CCceeEEEEeccCCCcchhhhhhhhhhH-HHHHHhhhhhhhhhcC--CCCCC-CC-----CCCCcccccCCCCccccCCC
Q 015021          237 EDSVISAFRLSEDRSRSLVGAILSKVVP-ATFSTISSLSKMIWRS--EQSPK-KS-----EPKPQSFARASPLTCLKDHP  307 (414)
Q Consensus       237 ~~P~la~y~~~~~~~~s~~~al~S~va~-av~S~v~S~ak~~W~~--~~~~~-~~-----e~kp~~~~~a~pl~~l~D~~  307 (414)
                      ++||+|||+.+|+.+++    ++++|+. +|.|+++++++.+|++  .++++ +.     ++++++.++..+.++|+|.+
T Consensus       232 ~~P~v~f~~~~e~~s~~----~ls~va~~aVas~l~sav~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~l~~r~~l~D~~  307 (415)
T PF14655_consen  232 SSPFVSFYYASEGSSQP----LLSDVASSAVASKLTSAVSGWLGWGSWRSEQQPQEKQPPEPKPEPAAPLPMRFGLPDSK  307 (415)
T ss_pred             CCceEEEEEccCCCCcc----cHHHHHHHHHHHHHHhhhHhhcccCCCCCccccccccccccCcCCCcccceEEeeccCC
Confidence            99999999888877765    5667777 8888888876634432  22221 11     22333333333336799999


Q ss_pred             ceeeEEEECCCCCEEEEEcCCCcEEEEEcCcceeEeeecccccceeeEEEEEecccccccccccCCCCCcceEEEEEEcC
Q 015021          308 RKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAP  387 (414)
Q Consensus       308 R~~~~i~~sP~~~laa~tD~lGRV~L~D~~~~~vvrmwKGyRdAq~~wi~~~~~~~~~~~~~~~~~~k~~~~l~LvIyap  387 (414)
                      |++++|++||+|+|||+||++|||+|+|+++++++|||||||||||+|+++.+..+...+..+....+.+++||||||||
T Consensus       308 R~~~~i~~sP~~~laA~tDslGRV~LiD~~~~~vvrmWKGYRdAqc~wi~~~~~~~~~~~~~~~~~~~~~~~l~LvIyap  387 (415)
T PF14655_consen  308 REGESICLSPSGRLAAVTDSLGRVLLIDVARGIVVRMWKGYRDAQCGWIEVPEEGDRDRSNSNSPKSSSRFALFLVIYAP  387 (415)
T ss_pred             ceEEEEEECCCCCEEEEEcCCCcEEEEECCCChhhhhhccCccceEEEEEeecccccccccccccCCCCcceEEEEEEec
Confidence            99999999999999999999999999999999999999999999999999998876432333444445678999999999


Q ss_pred             CCCeEEEeeCCCCcceee
Q 015021          388 RKGIIEHLAGMADENWTT  405 (414)
Q Consensus       388 rRg~lEvW~~~~g~~v~~  405 (414)
                      |||+||||+||||+||++
T Consensus       388 rRg~lEvW~~~~g~Rv~a  405 (415)
T PF14655_consen  388 RRGILEVWSMRQGPRVAA  405 (415)
T ss_pred             cCCeEEEEecCCCCEEEE
Confidence            999999999999999954



>KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 48.3 bits (114), Expect = 4e-06
 Identities = 63/444 (14%), Positives = 127/444 (28%), Gaps = 140/444 (31%)

Query: 45  ALANRYQTVIINWADPEGLVAKIRPEL---SPIASEYITAIEWL-----VFEEM------ 90
            L   Y      +     L++ I+ E    S +   YI   + L     VF +       
Sbjct: 86  VLRINY-----KF-----LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQ 135

Query: 91  ------RALAVGTSRGYFLVYDLKGD----LV-------HRQLIHPGRI--LKLRVRGSR 131
                 +AL         L+  + G     +          Q     +I  L L+   S 
Sbjct: 136 PYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSP 195

Query: 132 RDLTQDTAEEEVCV-VMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQR-----DSE 185
             + +    +++   + P   +R D S   K+     Q         KP +         
Sbjct: 196 ETVLE--MLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLL-- 251

Query: 186 DLENSYERLPHQLWNVSKYGPC------ADAAITGLMPPPLMEVQSSQRYFCAVTIGEDS 239
           +++N+      + WN      C          +T        +  S+      +++   S
Sbjct: 252 NVQNA------KAWNAFNLS-CKILLTTRFKQVT--------DFLSAATT-THISLDHHS 295

Query: 240 VISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASP 299
           +     L+ D  +SL    L K +                 +  P+     P+     +P
Sbjct: 296 MT----LTPDEVKSL----LLKYL-----------------DCRPQDL---PREVLTTNP 327

Query: 300 LTC------LKDHP--------RKGERLTLSPSGSLAAITDSLGR-------ILLLDTQ- 337
                    ++D             ++LT     SL  +  +  R       +       
Sbjct: 328 RRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHI 387

Query: 338 -ALVVVRLWKG--YRDASCVFMEM----LVNKDAATSSAYYAPVKSDYCLCL----AIHA 386
             +++  +W      D   V  ++    LV K    S+     +  +  + L    A+H 
Sbjct: 388 PTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALH- 446

Query: 387 PRKGIIEHLAGM-ADENWTTSLNY 409
             + I++H       ++      Y
Sbjct: 447 --RSIVDHYNIPKTFDSDDLIPPY 468


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.58
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.52
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.45
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 98.35
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.35
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.32
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.28
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.24
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.23
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 98.23
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 98.2
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.19
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.16
3jrp_A379 Fusion protein of protein transport protein SEC13 98.13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.11
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 98.11
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.1
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.09
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.06
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.04
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.03
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.03
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.01
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.01
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.01
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.98
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.96
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.94
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.93
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.91
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.91
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.88
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.84
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.82
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.82
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.77
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.73
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.67
3jro_A 753 Fusion protein of protein transport protein SEC13 97.66
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.62
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.61
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.6
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 97.59
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.58
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.56
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.54
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.48
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 97.48
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.44
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 97.43
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.42
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.39
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 97.32
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.32
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.31
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 97.28
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.26
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 97.24
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.22
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 97.19
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.18
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 97.14
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 97.1
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.97
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.92
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.92
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.9
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 96.9
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.89
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.84
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.81
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.79
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.76
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.75
3jro_A 753 Fusion protein of protein transport protein SEC13 96.72
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.69
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.62
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 96.6
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.58
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.58
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.55
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 96.52
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.48
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.41
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.41
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.4
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.4
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.35
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.33
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 96.29
2pm7_B297 Protein transport protein SEC13, protein transport 96.25
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.25
2pm7_B 297 Protein transport protein SEC13, protein transport 96.2
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.16
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 96.08
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 96.02
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 96.02
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.99
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.97
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.88
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.87
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.87
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.75
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.73
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.7
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 95.63
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.5
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 95.45
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.43
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.35
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.27
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.14
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.01
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.82
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.67
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 94.08
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 94.03
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 93.93
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 93.82
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 93.73
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 93.62
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 93.49
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 92.97
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 92.94
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.79
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 92.74
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 92.73
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 92.64
2w18_A 356 PALB2, fancn, partner and localizer of BRCA2; fanc 92.56
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.74
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.23
1k32_A 1045 Tricorn protease; protein degradation, substrate g 91.04
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 91.01
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 90.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 90.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 90.59
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 90.33
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 90.29
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 90.02
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 90.02
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 89.51
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 89.5
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 88.93
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 88.42
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 88.34
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 87.73
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.07
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 85.68
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 84.89
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 84.77
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 84.06
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 83.59
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.15
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 82.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 82.8
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 81.4
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 81.18
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 81.15
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 81.01
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 80.87
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 80.79
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
Probab=98.58  E-value=3.5e-05  Score=69.56  Aligned_cols=94  Identities=11%  Similarity=0.124  Sum_probs=62.3

Q ss_pred             eeeeccCcceeeeeecceEE-EEeecCCCCCceeecccCCCCCCCeEEEEEeEEeCCcEEEEEeccccEEEEEec-CC--
Q 015021           34 NLLCALDMHTIALANRYQTV-IINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDL-KG--  109 (414)
Q Consensus        34 ~~~~sp~~~~la~A~~~~~v-~~~w~~~~~~~v~~~g~l~~~~~e~ITs~~~lpl~dw~~I~VG~ssG~vrfyte-~G--  109 (414)
                      .++.+|++++||.+.....| +-..... .........+.. ....|+++.|.|-.|-..++.|..+|.|++|+. .|  
T Consensus        16 ~~~~~~~~~~l~~~~~dg~i~iw~~~~~-~~~~~~~~~~~~-~~~~v~~~~~~~~~d~~~l~s~~~dg~v~vwd~~~~~~   93 (351)
T 3f3f_A           16 DVVYDFYGRHVATCSSDQHIKVFKLDKD-TSNWELSDSWRA-HDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQE   93 (351)
T ss_dssp             EEEECSSSSEEEEEETTSEEEEEEECSS-SCCEEEEEEEEC-CSSCEEEEEECCGGGCSEEEEEETTSCEEEEEECTTSC
T ss_pred             EEEEcCCCCEEEEeeCCCeEEEEECCCC-CCcceecceecc-CCCcEEEEEEcCCCCCCEEEEEcCCCeEEEEecCCCcc
Confidence            36678999999988766433 3233222 111222223322 246799999988756678999999999999995 44  


Q ss_pred             -------cEEeecccCccceeEEEEec
Q 015021          110 -------DLVHRQLIHPGRILKLRVRG  129 (414)
Q Consensus       110 -------~LL~sQ~lh~~pV~~ik~r~  129 (414)
                             .++..-.-|..+|..+.+-.
T Consensus        94 ~~~~~~~~~~~~~~~~~~~v~~~~~~~  120 (351)
T 3f3f_A           94 ECSGRRWNKLCTLNDSKGSLYSVKFAP  120 (351)
T ss_dssp             TTSSCSEEEEEEECCCSSCEEEEEECC
T ss_pred             cccccCcceeeeecccCCceeEEEEcC
Confidence                   44555567888999888643



>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.66
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.57
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.54
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.9
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.88
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.79
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.76
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.55
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.54
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.45
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.4
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.37
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 97.14
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 96.99
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.9
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.66
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.6
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.58
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.47
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.31
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.29
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.28
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 96.24
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.1
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.64
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.51
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.48
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.29
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 95.08
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 95.04
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 94.93
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.93
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.29
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 92.39
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 92.08
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 91.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.53
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 91.51
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 91.47
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.19
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 91.08
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 90.9
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.69
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 87.62
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 84.99
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 80.94
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=98.66  E-value=6.4e-06  Score=75.41  Aligned_cols=246  Identities=13%  Similarity=0.065  Sum_probs=139.5

Q ss_pred             CeeeeccCcceeeeeecceEEEEeecCCCCCceeecccCCCCCCCeEEEEEeEEeCCcEEEEEeccccEEEEEe-cCCcE
Q 015021           33 PNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYD-LKGDL  111 (414)
Q Consensus        33 ~~~~~sp~~~~la~A~~~~~v~~~w~~~~~~~v~~~g~l~~~~~e~ITs~~~lpl~dw~~I~VG~ssG~vrfyt-e~G~L  111 (414)
                      ..++.+|+|+.||.+.+..+++-...... ..-.+.|     -.+.||++.|-  ||...+|+|..+|.|++|+ .++..
T Consensus        21 ~~~a~~~~g~~l~~~~~~~v~i~~~~~~~-~~~~~~~-----H~~~v~~~~~s--p~g~~latg~~dg~i~iwd~~~~~~   92 (311)
T d1nr0a1          21 VVLGNTPAGDKIQYCNGTSVYTVPVGSLT-DTEIYTE-----HSHQTTVAKTS--PSGYYCASGDVHGNVRIWDTTQTTH   92 (311)
T ss_dssp             CCCEECTTSSEEEEEETTEEEEEETTCSS-CCEEECC-----CSSCEEEEEEC--TTSSEEEEEETTSEEEEEESSSTTC
T ss_pred             EEEEEcCCCCEEEEEeCCEEEEEECCCCc-eeEEEcC-----CCCCEEEEEEe--CCCCeEeccccCceEeeeeeecccc
Confidence            57899999999999988876653322211 1112222     13669998885  4777899999999999998 45555


Q ss_pred             Eeec--ccCccceeEEEEecccCCCCCCCCCCeEEEEeCCe--EEEEeChhHHHHHHHHHHhccccccCCCCccCCCccc
Q 015021          112 VHRQ--LIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGV--LARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDL  187 (414)
Q Consensus       112 L~sQ--~lh~~pV~~ik~r~~~~~~~~~~~~eel~Ily~~~--iv~IdG~sL~~~Lr~c~~~~~~~~w~~~~~~~~~~~~  187 (414)
                      ++..  ..|..+|..+.+...         ...|.+...+.  .+.|                    |+-...+.     
T Consensus        93 ~~~~~~~~~~~~v~~v~~s~d---------~~~l~~~~~~~~~~~~v--------------------~~~~~~~~-----  138 (311)
T d1nr0a1          93 ILKTTIPVFSGPVKDISWDSE---------SKRIAAVGEGRERFGHV--------------------FLFDTGTS-----  138 (311)
T ss_dssp             CEEEEEECSSSCEEEEEECTT---------SCEEEEEECCSSCSEEE--------------------EETTTCCB-----
T ss_pred             ccccccccccCcccccccccc---------ccccccccccccccccc--------------------cccccccc-----
Confidence            5443  457889988875321         22233332211  1111                    10000000     


Q ss_pred             ccccCCccceecccC-CCCCceeeEEeCCCCCCchhhhccccceeEEEeCCCceeEEEEeccCCCcchhhhhhhhhhHHH
Q 015021          188 ENSYERLPHQLWNVS-KYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPAT  266 (414)
Q Consensus       188 ~~~~~~L~ykKW~l~-~~~~i~Daa~~G~~~p~~~d~~s~~~~~~~i~vG~~P~la~y~~~~~~~~s~~~al~S~va~av  266 (414)
                                +..+. ..+.+.++++.    |        .+.+.+++.+.+-.+-+|-..+..                
T Consensus       139 ----------~~~l~~h~~~v~~v~~~----~--------~~~~~l~sgs~d~~i~i~d~~~~~----------------  180 (311)
T d1nr0a1         139 ----------NGNLTGQARAMNSVDFK----P--------SRPFRIISGSDDNTVAIFEGPPFK----------------  180 (311)
T ss_dssp             ----------CBCCCCCSSCEEEEEEC----S--------SSSCEEEEEETTSCEEEEETTTBE----------------
T ss_pred             ----------ccccccccccccccccc----c--------cceeeecccccccccccccccccc----------------
Confidence                      01111 12234444431    1        122223444444444333221110                


Q ss_pred             HHHhhhhhhhhhcCCCCCCCCCCCCcccccCCCCccccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCcceeEeeec
Q 015021          267 FSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWK  346 (414)
Q Consensus       267 ~S~v~S~ak~~W~~~~~~~~~e~kp~~~~~a~pl~~l~D~~R~~~~i~~sP~~~laa~tD~lGRV~L~D~~~~~vvrmwK  346 (414)
                                                      +...+.+....+.++..+|++++++++...|.|.|+|+.++..++.++
T Consensus       181 --------------------------------~~~~~~~~~~~i~~v~~~p~~~~l~~~~~d~~v~~~d~~~~~~~~~~~  228 (311)
T d1nr0a1         181 --------------------------------FKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFE  228 (311)
T ss_dssp             --------------------------------EEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECB
T ss_pred             --------------------------------cccccccccccccccccCcccccccccccccccccccccccccccccc
Confidence                                            011233345567899999999999999999999999999999888776


Q ss_pred             ccccc---eeeEEEEEecccccccccccCCCCCcceEEEEEEcCCCCeEEEeeCCCCcceee
Q 015021          347 GYRDA---SCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTT  405 (414)
Q Consensus       347 GyRdA---q~~wi~~~~~~~~~~~~~~~~~~k~~~~l~LvIyaprRg~lEvW~~~~g~~v~~  405 (414)
                      ..+.-   .-++|....-.++         +  .   +|+ -+-.+|.|.||++++|+++.|
T Consensus       229 ~~~~~~~~h~~~V~~~~~s~~---------~--~---~l~-tgs~Dg~v~iwd~~t~~~~~~  275 (311)
T d1nr0a1         229 DDSLKNVAHSGSVFGLTWSPD---------G--T---KIA-SASADKTIKIWNVATLKVEKT  275 (311)
T ss_dssp             CTTSSSCSSSSCEEEEEECTT---------S--S---EEE-EEETTSEEEEEETTTTEEEEE
T ss_pred             ccccccccccccccccccCCC---------C--C---EEE-EEeCCCeEEEEECCCCcEEEE
Confidence            43321   1123432211110         1  1   344 366799999999999998754



>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure