Citrus Sinensis ID: 015021
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 414 | ||||||
| 225461677 | 457 | PREDICTED: rab3 GTPase-activating protei | 0.949 | 0.859 | 0.756 | 0.0 | |
| 255567076 | 484 | rab3 gtpase-activating protein non-catal | 0.939 | 0.803 | 0.746 | 1e-173 | |
| 297830038 | 455 | hypothetical protein ARALYDRAFT_478912 [ | 0.949 | 0.863 | 0.711 | 1e-170 | |
| 449456579 | 456 | PREDICTED: rab3 GTPase-activating protei | 0.949 | 0.861 | 0.711 | 1e-169 | |
| 15231948 | 455 | uncharacterized protein [Arabidopsis tha | 0.949 | 0.863 | 0.706 | 1e-169 | |
| 449516756 | 456 | PREDICTED: rab3 GTPase-activating protei | 0.949 | 0.861 | 0.708 | 1e-168 | |
| 356514563 | 460 | PREDICTED: rab3 GTPase-activating protei | 0.949 | 0.854 | 0.685 | 1e-160 | |
| 356543215 | 459 | PREDICTED: rab3 GTPase-activating protei | 0.944 | 0.851 | 0.685 | 1e-157 | |
| 224116998 | 354 | predicted protein [Populus trichocarpa] | 0.702 | 0.822 | 0.749 | 1e-128 | |
| 115478506 | 469 | Os09g0315800 [Oryza sativa Japonica Grou | 0.942 | 0.831 | 0.567 | 1e-121 |
| >gi|225461677|ref|XP_002285458.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit [Vitis vinifera] gi|302142895|emb|CBI20190.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 639 bits (1647), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 301/398 (75%), Positives = 353/398 (88%), Gaps = 5/398 (1%)
Query: 1 MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWA-- 58
M++R +TTE+G IAC +LS+LGAGKE WLV +P+L+CALD ++ALANR +++ W+
Sbjct: 1 MARRVYTTELGCIACNELSELGAGKEAWLVENPSLICALDTDSLALANRSFVLVLGWSEN 60
Query: 59 -DPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLI 117
DP KIRP LS I +E ITA+EWLVF+E+R LAVGTS GY ++Y L DL+H+Q+I
Sbjct: 61 GDPYNSPVKIRPTLSQIETERITAVEWLVFDEIRVLAVGTSSGYLMIYSLGADLIHKQMI 120
Query: 118 HPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQ 177
+PGRILK RVRG++RDLTQ ++ EEVCVVMPGV+ARFDG+++Q MLQRWFQD++S FWD+
Sbjct: 121 NPGRILKFRVRGTKRDLTQGSSSEEVCVVMPGVIARFDGADLQSMLQRWFQDTHSQFWDE 180
Query: 178 KPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGE 237
KPK+RD ED E SY RLP+QLWNVSKYGPCADAAITG MPPPLME+QSSQRY+CAVTIG+
Sbjct: 181 KPKRRDQEDSEKSYGRLPYQLWNVSKYGPCADAAITGTMPPPLMELQSSQRYYCAVTIGD 240
Query: 238 DSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQ-SPKKSEPKPQSFAR 296
D+VISAFRLSEDR+RSLVGAILSKVVPATFSTI+S SKMIWRSEQ SPK+SEPKPQ FAR
Sbjct: 241 DAVISAFRLSEDRNRSLVGAILSKVVPATFSTIASFSKMIWRSEQKSPKRSEPKPQPFAR 300
Query: 297 ASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFM 356
ASPLTCLKDHPRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVVRLWKGYRDASC+F
Sbjct: 301 ASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFT 360
Query: 357 EMLVNKD-AATSSAYYAPVKSDYCLCLAIHAPRKGIIE 393
EMLV+KD AA+SS+YY PVKSDYCLCLAIHAPRKGI+E
Sbjct: 361 EMLVSKDTAASSSSYYEPVKSDYCLCLAIHAPRKGIVE 398
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255567076|ref|XP_002524520.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] gi|223536194|gb|EEF37847.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297830038|ref|XP_002882901.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] gi|297328741|gb|EFH59160.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449456579|ref|XP_004146026.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15231948|ref|NP_188109.1| uncharacterized protein [Arabidopsis thaliana] gi|8777474|dbj|BAA97054.1| unnamed protein product [Arabidopsis thaliana] gi|63147384|gb|AAY34165.1| At3g14910 [Arabidopsis thaliana] gi|115646783|gb|ABJ17116.1| At3g14910 [Arabidopsis thaliana] gi|332642066|gb|AEE75587.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449516756|ref|XP_004165412.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356514563|ref|XP_003525975.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356543215|ref|XP_003540058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224116998|ref|XP_002331804.1| predicted protein [Populus trichocarpa] gi|222874500|gb|EEF11631.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|115478506|ref|NP_001062848.1| Os09g0315800 [Oryza sativa Japonica Group] gi|51091645|dbj|BAD36414.1| rab3-GAP regulatory domain-like [Oryza sativa Japonica Group] gi|113631081|dbj|BAF24762.1| Os09g0315800 [Oryza sativa Japonica Group] gi|218201904|gb|EEC84331.1| hypothetical protein OsI_30840 [Oryza sativa Indica Group] gi|222641308|gb|EEE69440.1| hypothetical protein OsJ_28835 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 414 | ||||||
| TAIR|locus:2086390 | 455 | AT3G14910 "AT3G14910" [Arabido | 0.949 | 0.863 | 0.706 | 3.1e-154 | |
| ZFIN|ZDB-GENE-030616-610 | 1373 | rab3gap2 "RAB3 GTPase activati | 0.705 | 0.212 | 0.278 | 1.5e-18 | |
| UNIPROTKB|E1BVG8 | 1386 | RAB3GAP2 "Uncharacterized prot | 0.710 | 0.212 | 0.269 | 1.9e-18 | |
| UNIPROTKB|D4ABP4 | 1367 | Rab3gap2 "Rab3 GTPase-activati | 0.705 | 0.213 | 0.260 | 2e-17 | |
| RGD|1311518 | 1386 | Rab3gap2 "RAB3 GTPase activati | 0.702 | 0.209 | 0.260 | 7.6e-17 | |
| UNIPROTKB|E2R4W9 | 1540 | RAB3GAP2 "Uncharacterized prot | 0.702 | 0.188 | 0.262 | 8.7e-17 | |
| UNIPROTKB|F1S9J9 | 1391 | RAB3GAP2 "Uncharacterized prot | 0.705 | 0.209 | 0.260 | 1e-16 | |
| UNIPROTKB|Q9H2M9 | 1393 | RAB3GAP2 "Rab3 GTPase-activati | 0.705 | 0.209 | 0.257 | 1.3e-16 | |
| MGI|MGI:1916043 | 1366 | Rab3gap2 "RAB3 GTPase activati | 0.702 | 0.213 | 0.257 | 2.8e-16 | |
| UNIPROTKB|G5E601 | 1392 | RAB3GAP2 "Uncharacterized prot | 0.705 | 0.209 | 0.254 | 4.8e-16 |
| TAIR|locus:2086390 AT3G14910 "AT3G14910" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1504 (534.5 bits), Expect = 3.1e-154, P = 3.1e-154
Identities = 279/395 (70%), Positives = 337/395 (85%)
Query: 1 MSKRTHTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWADP 60
M+KR H TE+G IAC +L++LGAGKEGWLVN+PNLL ALD H++ALANR+ +I+NW DP
Sbjct: 1 MAKRIHLTELGCIACEELTELGAGKEGWLVNNPNLLSALDSHSLALANRFLILIVNWGDP 60
Query: 61 EGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHPG 120
+ KIRP+LSPI +E ITAIEWLVF+++R + GTS GY LVY + GDL+H+Q++H
Sbjct: 61 DAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVTGDLIHKQIVHQS 120
Query: 121 RILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPK 180
RILK+RVRG+++DL Q+T+ EE+C+V+PGV+ARFDGS IQ M+Q+W Q+ NSNFWDQK +
Sbjct: 121 RILKIRVRGTKKDLMQETSSEEICIVLPGVIARFDGSNIQSMVQKWVQEKNSNFWDQKNR 180
Query: 181 QRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSV 240
+ D+ED + Y+RLP+Q+WNV+K G C DA +TG+MPPPL+E+QSSQRY+CAVTIGEDSV
Sbjct: 181 KGDAEDTGSLYQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQSSQRYYCAVTIGEDSV 240
Query: 241 ISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRS-EQSPK-KSEPKPQSFARAS 298
ISA+RLSEDR RSLVGAILSKVVPA STI+S SK+IWRS +QSPK K E K QSFARAS
Sbjct: 241 ISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARAS 300
Query: 299 PLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEM 358
LTC+KD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEM
Sbjct: 301 SLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEM 360
Query: 359 LVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIE 393
L KD S + PVKSDYCLCLAIHAPRKGIIE
Sbjct: 361 LAKKDKGKSVIHTEPVKSDYCLCLAIHAPRKGIIE 395
|
|
| ZFIN|ZDB-GENE-030616-610 rab3gap2 "RAB3 GTPase activating protein subunit 2 (non-catalytic)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVG8 RAB3GAP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ABP4 Rab3gap2 "Rab3 GTPase-activating protein non-catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1311518 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4W9 RAB3GAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S9J9 RAB3GAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H2M9 RAB3GAP2 "Rab3 GTPase-activating protein non-catalytic subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916043 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E601 RAB3GAP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 414 | |||
| PF14655 | 415 | RAB3GAP2_N: Rab3 GTPase-activating protein regulat | 100.0 | |
| KOG2727 | 1244 | consensus Rab3 GTPase-activating protein, non-cata | 100.0 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.85 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 97.76 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 97.42 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 96.89 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 96.66 | |
| PTZ00421 | 493 | coronin; Provisional | 96.62 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 96.61 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 96.55 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 96.55 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 96.54 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 96.23 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 96.21 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 95.99 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 95.94 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 95.9 | |
| PF12341 | 27 | DUF3639: Protein of unknown function (DUF3639) ; I | 95.79 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 95.78 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 94.99 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 94.81 | |
| KOG2727 | 1244 | consensus Rab3 GTPase-activating protein, non-cata | 94.67 | |
| PTZ00421 | 493 | coronin; Provisional | 94.5 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 94.47 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 94.23 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 94.12 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 94.1 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 93.94 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 93.84 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 93.82 | |
| PTZ00420 | 568 | coronin; Provisional | 93.79 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 93.72 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 92.98 | |
| PTZ00420 | 568 | coronin; Provisional | 92.96 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 92.73 | |
| PF14727 | 418 | PHTB1_N: PTHB1 N-terminus | 91.63 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 91.16 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 91.03 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 90.63 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 90.55 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 89.89 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 89.83 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 88.95 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 88.75 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 88.54 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 88.25 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 88.14 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 88.07 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 87.56 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 86.82 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 86.76 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 86.67 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 86.29 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 86.28 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 86.21 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 85.97 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 85.78 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 84.91 | |
| PF08596 | 395 | Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; | 84.83 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 84.47 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 84.16 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 84.08 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 83.83 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 83.76 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 83.5 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 83.07 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 82.61 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 82.15 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 81.96 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 81.84 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 81.61 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 80.22 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 80.18 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 80.12 |
| >PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-100 Score=782.62 Aligned_cols=365 Identities=31% Similarity=0.452 Sum_probs=310.8
Q ss_pred cccCCCeeeeccCcceeeeeecceEEE--EeecCCC------CCceeecccCCCCCCCeEEEEEeEEe---------CCc
Q 015021 28 WLVNDPNLLCALDMHTIALANRYQTVI--INWADPE------GLVAKIRPELSPIASEYITAIEWLVF---------EEM 90 (414)
Q Consensus 28 WL~~~~~~~~sp~~~~la~A~~~~~v~--~~w~~~~------~~~v~~~g~l~~~~~e~ITs~~~lpl---------~dw 90 (414)
||+| |++++||+||+||+|+++|+|| .+|+.++ .+.+.|+|+|+.+++|+|||++|||| +||
T Consensus 1 WL~~-~~isls~~~d~laiA~~~r~vil~~~w~~~~~~~~~~~~~~~~~g~l~~~~~e~ITsi~clpl~s~~~s~~~~dw 79 (415)
T PF14655_consen 1 WLQD-CSISLSPDGDLLAIARGQRLVILTSKWDSSRKGENENTYSISWSGPLDDEPGECITSILCLPLSSQKRSTGGPDW 79 (415)
T ss_pred Cccc-ceEEecCCCCEEEEEcCCEEEEEEeeccccccCCCCCeEEEEeeeeccCCCCCEEEEEEEEEeecccccCCCCCc
Confidence 9999 9999999999999999999999 5895533 24489999999977799999999999 899
Q ss_pred EEEEEeccccEEEEEecCCcEEeecccCccceeEEEEecccCCCCCCCCCCeEEEEeCCeEEEEeChhHHHHHHHHHHhc
Q 015021 91 RALAVGTSRGYFLVYDLKGDLVHRQLIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDS 170 (414)
Q Consensus 91 ~~I~VG~ssG~vrfyte~G~LL~sQ~lh~~pV~~ik~r~~~~~~~~~~~~eel~Ily~~~iv~IdG~sL~~~Lr~c~~~~ 170 (414)
+||||||++||||||||+|+|||+|+||++||++||||+++++..++...|||+|+||++||+|||++|+++|++|++|+
T Consensus 80 ~~I~VG~ssG~vrfyte~G~LL~~Q~~h~~pV~~ik~~~~~~~~~~~~~~eel~ily~~~v~~Idg~sL~~~L~~~~~~~ 159 (415)
T PF14655_consen 80 TCIAVGTSSGYVRFYTENGVLLLSQLLHEEPVLKIKCRSTKIPRHPGDSSEELSILYPSAVVIIDGFSLFSVLRACRNQV 159 (415)
T ss_pred EEEEEEecccEEEEEeccchHHHHHhcCccceEEEEecccCCCCCCcccccEEEEEECCEEEEEecHHHHHHHHHHHHhh
Confidence 99999999999999999999999999999999999999999866666666999999999999999999999999999999
Q ss_pred cccccCCCCccCCCcccccccCCccceecccCCCCCceeeEEeCCCCCCchhhh--------------ccccceeEEEeC
Q 015021 171 NSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ--------------SSQRYFCAVTIG 236 (414)
Q Consensus 171 ~~~~w~~~~~~~~~~~~~~~~~~L~ykKW~l~~~~~i~Daa~~G~~~p~~~d~~--------------s~~~~~~~i~vG 236 (414)
+++.|+.+ + .+.+++|+||||+|++++.|+|++++|+++|++||++ +...++++|++|
T Consensus 160 ~~~~~~~~-------~-~~~~~~L~ykKw~l~~~~~i~D~~~~G~~~~~~fd~l~~aS~~gf~a~~~~s~~~~~~~i~~G 231 (415)
T PF14655_consen 160 ARGAASGS-------D-SPAPPPLSYKKWNLQSQDTINDAAICGPMPPSTFDHLVTASIGGFNAKYRSSPPRMSRYITVG 231 (415)
T ss_pred hhhhhccc-------c-cCCCCccceeEecCCCCCcEeeEEEecCCCCcHHHHHHhhhcccccceeecCCcceEEEEEec
Confidence 99865321 1 3347889999999999999999999999999999984 335778999999
Q ss_pred CCceeEEEEeccCCCcchhhhhhhhhhH-HHHHHhhhhhhhhhcC--CCCCC-CC-----CCCCcccccCCCCccccCCC
Q 015021 237 EDSVISAFRLSEDRSRSLVGAILSKVVP-ATFSTISSLSKMIWRS--EQSPK-KS-----EPKPQSFARASPLTCLKDHP 307 (414)
Q Consensus 237 ~~P~la~y~~~~~~~~s~~~al~S~va~-av~S~v~S~ak~~W~~--~~~~~-~~-----e~kp~~~~~a~pl~~l~D~~ 307 (414)
++||+|||+.+|+.+++ ++++|+. +|.|+++++++.+|++ .++++ +. ++++++.++..+.++|+|.+
T Consensus 232 ~~P~v~f~~~~e~~s~~----~ls~va~~aVas~l~sav~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~l~~r~~l~D~~ 307 (415)
T PF14655_consen 232 SSPFVSFYYASEGSSQP----LLSDVASSAVASKLTSAVSGWLGWGSWRSEQQPQEKQPPEPKPEPAAPLPMRFGLPDSK 307 (415)
T ss_pred CCceEEEEEccCCCCcc----cHHHHHHHHHHHHHHhhhHhhcccCCCCCccccccccccccCcCCCcccceEEeeccCC
Confidence 99999999888877765 5667777 8888888876634432 22221 11 22333333333336799999
Q ss_pred ceeeEEEECCCCCEEEEEcCCCcEEEEEcCcceeEeeecccccceeeEEEEEecccccccccccCCCCCcceEEEEEEcC
Q 015021 308 RKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAP 387 (414)
Q Consensus 308 R~~~~i~~sP~~~laa~tD~lGRV~L~D~~~~~vvrmwKGyRdAq~~wi~~~~~~~~~~~~~~~~~~k~~~~l~LvIyap 387 (414)
|++++|++||+|+|||+||++|||+|+|+++++++|||||||||||+|+++.+..+...+..+....+.+++||||||||
T Consensus 308 R~~~~i~~sP~~~laA~tDslGRV~LiD~~~~~vvrmWKGYRdAqc~wi~~~~~~~~~~~~~~~~~~~~~~~l~LvIyap 387 (415)
T PF14655_consen 308 REGESICLSPSGRLAAVTDSLGRVLLIDVARGIVVRMWKGYRDAQCGWIEVPEEGDRDRSNSNSPKSSSRFALFLVIYAP 387 (415)
T ss_pred ceEEEEEECCCCCEEEEEcCCCcEEEEECCCChhhhhhccCccceEEEEEeecccccccccccccCCCCcceEEEEEEec
Confidence 99999999999999999999999999999999999999999999999999998876432333444445678999999999
Q ss_pred CCCeEEEeeCCCCcceee
Q 015021 388 RKGIIEHLAGMADENWTT 405 (414)
Q Consensus 388 rRg~lEvW~~~~g~~v~~ 405 (414)
|||+||||+||||+||++
T Consensus 388 rRg~lEvW~~~~g~Rv~a 405 (415)
T PF14655_consen 388 RRGILEVWSMRQGPRVAA 405 (415)
T ss_pred cCCeEEEEecCCCCEEEE
Confidence 999999999999999954
|
|
| >KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >PF14727 PHTB1_N: PTHB1 N-terminus | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 414 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 48.3 bits (114), Expect = 4e-06
Identities = 63/444 (14%), Positives = 127/444 (28%), Gaps = 140/444 (31%)
Query: 45 ALANRYQTVIINWADPEGLVAKIRPEL---SPIASEYITAIEWL-----VFEEM------ 90
L Y + L++ I+ E S + YI + L VF +
Sbjct: 86 VLRINY-----KF-----LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQ 135
Query: 91 ------RALAVGTSRGYFLVYDLKGD----LV-------HRQLIHPGRI--LKLRVRGSR 131
+AL L+ + G + Q +I L L+ S
Sbjct: 136 PYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSP 195
Query: 132 RDLTQDTAEEEVCV-VMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQR-----DSE 185
+ + +++ + P +R D S K+ Q KP +
Sbjct: 196 ETVLE--MLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLL-- 251
Query: 186 DLENSYERLPHQLWNVSKYGPC------ADAAITGLMPPPLMEVQSSQRYFCAVTIGEDS 239
+++N+ + WN C +T + S+ +++ S
Sbjct: 252 NVQNA------KAWNAFNLS-CKILLTTRFKQVT--------DFLSAATT-THISLDHHS 295
Query: 240 VISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASP 299
+ L+ D +SL L K + + P+ P+ +P
Sbjct: 296 MT----LTPDEVKSL----LLKYL-----------------DCRPQDL---PREVLTTNP 327
Query: 300 LTC------LKDHP--------RKGERLTLSPSGSLAAITDSLGR-------ILLLDTQ- 337
++D ++LT SL + + R +
Sbjct: 328 RRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHI 387
Query: 338 -ALVVVRLWKG--YRDASCVFMEM----LVNKDAATSSAYYAPVKSDYCLCL----AIHA 386
+++ +W D V ++ LV K S+ + + + L A+H
Sbjct: 388 PTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALH- 446
Query: 387 PRKGIIEHLAGM-ADENWTTSLNY 409
+ I++H ++ Y
Sbjct: 447 --RSIVDHYNIPKTFDSDDLIPPY 468
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 414 | |||
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 98.58 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 98.52 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 98.45 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 98.35 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 98.35 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 98.32 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 98.28 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 98.24 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 98.23 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 98.23 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 98.2 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 98.19 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 98.16 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.13 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.11 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.11 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 98.1 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.09 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 98.06 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 98.04 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 98.03 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.03 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.01 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.01 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 98.01 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 98.0 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 97.98 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.96 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 97.96 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 97.94 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 97.93 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.91 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.91 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 97.88 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.84 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.82 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 97.82 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 97.77 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 97.73 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.67 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 97.66 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 97.62 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.61 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.6 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 97.59 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 97.58 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 97.56 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 97.54 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.48 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.48 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.44 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.43 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 97.42 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.39 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 97.32 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 97.32 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 97.31 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 97.28 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.26 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.24 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 97.22 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 97.19 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.18 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 97.14 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.1 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 96.97 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 96.92 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 96.92 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 96.9 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 96.9 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 96.89 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 96.84 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 96.81 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 96.79 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 96.76 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 96.75 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 96.72 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 96.69 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 96.62 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 96.6 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.58 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 96.58 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 96.55 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 96.52 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 96.48 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 96.41 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 96.41 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 96.4 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 96.4 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 96.35 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 96.33 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 96.29 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 96.25 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 96.25 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 96.2 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 96.16 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 96.08 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 96.02 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 96.02 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 95.99 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 95.97 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 95.88 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 95.87 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 95.87 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 95.75 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 95.73 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 95.7 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 95.63 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 95.5 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 95.45 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 95.43 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 95.35 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 95.27 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 95.14 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 95.01 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 94.89 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 94.82 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 94.67 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 94.08 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 94.03 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 93.93 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 93.82 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 93.73 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 93.62 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 93.49 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 92.97 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 92.94 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 92.79 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 92.74 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 92.73 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 92.64 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 92.56 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 91.74 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 91.23 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 91.04 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 91.01 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 90.98 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 90.86 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 90.59 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 90.33 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 90.29 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 90.02 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 90.02 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 89.51 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 89.5 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 88.93 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 88.42 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 88.34 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 87.73 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 87.07 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 85.68 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 84.89 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 84.77 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 84.06 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 83.59 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 83.15 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 82.83 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 82.8 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 81.4 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 81.18 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 81.15 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 81.01 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 80.87 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 80.79 |
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
Probab=98.58 E-value=3.5e-05 Score=69.56 Aligned_cols=94 Identities=11% Similarity=0.124 Sum_probs=62.3
Q ss_pred eeeeccCcceeeeeecceEE-EEeecCCCCCceeecccCCCCCCCeEEEEEeEEeCCcEEEEEeccccEEEEEec-CC--
Q 015021 34 NLLCALDMHTIALANRYQTV-IINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDL-KG-- 109 (414)
Q Consensus 34 ~~~~sp~~~~la~A~~~~~v-~~~w~~~~~~~v~~~g~l~~~~~e~ITs~~~lpl~dw~~I~VG~ssG~vrfyte-~G-- 109 (414)
.++.+|++++||.+.....| +-..... .........+.. ....|+++.|.|-.|-..++.|..+|.|++|+. .|
T Consensus 16 ~~~~~~~~~~l~~~~~dg~i~iw~~~~~-~~~~~~~~~~~~-~~~~v~~~~~~~~~d~~~l~s~~~dg~v~vwd~~~~~~ 93 (351)
T 3f3f_A 16 DVVYDFYGRHVATCSSDQHIKVFKLDKD-TSNWELSDSWRA-HDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQE 93 (351)
T ss_dssp EEEECSSSSEEEEEETTSEEEEEEECSS-SCCEEEEEEEEC-CSSCEEEEEECCGGGCSEEEEEETTSCEEEEEECTTSC
T ss_pred EEEEcCCCCEEEEeeCCCeEEEEECCCC-CCcceecceecc-CCCcEEEEEEcCCCCCCEEEEEcCCCeEEEEecCCCcc
Confidence 36678999999988766433 3233222 111222223322 246799999988756678999999999999995 44
Q ss_pred -------cEEeecccCccceeEEEEec
Q 015021 110 -------DLVHRQLIHPGRILKLRVRG 129 (414)
Q Consensus 110 -------~LL~sQ~lh~~pV~~ik~r~ 129 (414)
.++..-.-|..+|..+.+-.
T Consensus 94 ~~~~~~~~~~~~~~~~~~~v~~~~~~~ 120 (351)
T 3f3f_A 94 ECSGRRWNKLCTLNDSKGSLYSVKFAP 120 (351)
T ss_dssp TTSSCSEEEEEEECCCSSCEEEEEECC
T ss_pred cccccCcceeeeecccCCceeEEEEcC
Confidence 44555567888999888643
|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 414 | |||
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.66 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.57 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 98.54 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 97.97 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 97.9 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.88 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 97.79 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 97.76 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 97.55 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 97.54 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 97.45 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 97.4 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.37 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 97.14 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 96.99 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 96.9 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.66 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.6 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 96.58 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 96.47 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.31 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 96.29 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.28 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.24 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 96.1 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 95.64 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 95.51 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 95.48 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 95.29 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 95.08 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 95.04 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 94.93 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 94.93 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 93.29 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 92.39 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 92.08 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 91.96 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 91.53 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 91.51 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 91.47 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 91.19 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 91.08 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 90.9 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 90.69 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 87.62 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 84.99 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 80.94 |
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Actin interacting protein 1 species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=98.66 E-value=6.4e-06 Score=75.41 Aligned_cols=246 Identities=13% Similarity=0.065 Sum_probs=139.5
Q ss_pred CeeeeccCcceeeeeecceEEEEeecCCCCCceeecccCCCCCCCeEEEEEeEEeCCcEEEEEeccccEEEEEe-cCCcE
Q 015021 33 PNLLCALDMHTIALANRYQTVIINWADPEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYD-LKGDL 111 (414)
Q Consensus 33 ~~~~~sp~~~~la~A~~~~~v~~~w~~~~~~~v~~~g~l~~~~~e~ITs~~~lpl~dw~~I~VG~ssG~vrfyt-e~G~L 111 (414)
..++.+|+|+.||.+.+..+++-...... ..-.+.| -.+.||++.|- ||...+|+|..+|.|++|+ .++..
T Consensus 21 ~~~a~~~~g~~l~~~~~~~v~i~~~~~~~-~~~~~~~-----H~~~v~~~~~s--p~g~~latg~~dg~i~iwd~~~~~~ 92 (311)
T d1nr0a1 21 VVLGNTPAGDKIQYCNGTSVYTVPVGSLT-DTEIYTE-----HSHQTTVAKTS--PSGYYCASGDVHGNVRIWDTTQTTH 92 (311)
T ss_dssp CCCEECTTSSEEEEEETTEEEEEETTCSS-CCEEECC-----CSSCEEEEEEC--TTSSEEEEEETTSEEEEEESSSTTC
T ss_pred EEEEEcCCCCEEEEEeCCEEEEEECCCCc-eeEEEcC-----CCCCEEEEEEe--CCCCeEeccccCceEeeeeeecccc
Confidence 57899999999999988876653322211 1112222 13669998885 4777899999999999998 45555
Q ss_pred Eeec--ccCccceeEEEEecccCCCCCCCCCCeEEEEeCCe--EEEEeChhHHHHHHHHHHhccccccCCCCccCCCccc
Q 015021 112 VHRQ--LIHPGRILKLRVRGSRRDLTQDTAEEEVCVVMPGV--LARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDL 187 (414)
Q Consensus 112 L~sQ--~lh~~pV~~ik~r~~~~~~~~~~~~eel~Ily~~~--iv~IdG~sL~~~Lr~c~~~~~~~~w~~~~~~~~~~~~ 187 (414)
++.. ..|..+|..+.+... ...|.+...+. .+.| |+-...+.
T Consensus 93 ~~~~~~~~~~~~v~~v~~s~d---------~~~l~~~~~~~~~~~~v--------------------~~~~~~~~----- 138 (311)
T d1nr0a1 93 ILKTTIPVFSGPVKDISWDSE---------SKRIAAVGEGRERFGHV--------------------FLFDTGTS----- 138 (311)
T ss_dssp CEEEEEECSSSCEEEEEECTT---------SCEEEEEECCSSCSEEE--------------------EETTTCCB-----
T ss_pred ccccccccccCcccccccccc---------ccccccccccccccccc--------------------cccccccc-----
Confidence 5443 457889988875321 22233332211 1111 10000000
Q ss_pred ccccCCccceecccC-CCCCceeeEEeCCCCCCchhhhccccceeEEEeCCCceeEEEEeccCCCcchhhhhhhhhhHHH
Q 015021 188 ENSYERLPHQLWNVS-KYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPAT 266 (414)
Q Consensus 188 ~~~~~~L~ykKW~l~-~~~~i~Daa~~G~~~p~~~d~~s~~~~~~~i~vG~~P~la~y~~~~~~~~s~~~al~S~va~av 266 (414)
+..+. ..+.+.++++. | .+.+.+++.+.+-.+-+|-..+..
T Consensus 139 ----------~~~l~~h~~~v~~v~~~----~--------~~~~~l~sgs~d~~i~i~d~~~~~---------------- 180 (311)
T d1nr0a1 139 ----------NGNLTGQARAMNSVDFK----P--------SRPFRIISGSDDNTVAIFEGPPFK---------------- 180 (311)
T ss_dssp ----------CBCCCCCSSCEEEEEEC----S--------SSSCEEEEEETTSCEEEEETTTBE----------------
T ss_pred ----------ccccccccccccccccc----c--------cceeeecccccccccccccccccc----------------
Confidence 01111 12234444431 1 122223444444444333221110
Q ss_pred HHHhhhhhhhhhcCCCCCCCCCCCCcccccCCCCccccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCcceeEeeec
Q 015021 267 FSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWK 346 (414)
Q Consensus 267 ~S~v~S~ak~~W~~~~~~~~~e~kp~~~~~a~pl~~l~D~~R~~~~i~~sP~~~laa~tD~lGRV~L~D~~~~~vvrmwK 346 (414)
+...+.+....+.++..+|++++++++...|.|.|+|+.++..++.++
T Consensus 181 --------------------------------~~~~~~~~~~~i~~v~~~p~~~~l~~~~~d~~v~~~d~~~~~~~~~~~ 228 (311)
T d1nr0a1 181 --------------------------------FKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFE 228 (311)
T ss_dssp --------------------------------EEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECB
T ss_pred --------------------------------cccccccccccccccccCcccccccccccccccccccccccccccccc
Confidence 011233345567899999999999999999999999999999888776
Q ss_pred ccccc---eeeEEEEEecccccccccccCCCCCcceEEEEEEcCCCCeEEEeeCCCCcceee
Q 015021 347 GYRDA---SCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEHLAGMADENWTT 405 (414)
Q Consensus 347 GyRdA---q~~wi~~~~~~~~~~~~~~~~~~k~~~~l~LvIyaprRg~lEvW~~~~g~~v~~ 405 (414)
..+.- .-++|....-.++ + . +|+ -+-.+|.|.||++++|+++.|
T Consensus 229 ~~~~~~~~h~~~V~~~~~s~~---------~--~---~l~-tgs~Dg~v~iwd~~t~~~~~~ 275 (311)
T d1nr0a1 229 DDSLKNVAHSGSVFGLTWSPD---------G--T---KIA-SASADKTIKIWNVATLKVEKT 275 (311)
T ss_dssp CTTSSSCSSSSCEEEEEECTT---------S--S---EEE-EEETTSEEEEEETTTTEEEEE
T ss_pred ccccccccccccccccccCCC---------C--C---EEE-EEeCCCeEEEEECCCCcEEEE
Confidence 43321 1123432211110 1 1 344 366799999999999998754
|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|