Citrus Sinensis ID: 015044

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----

MAAIIKPALQPSQALLPKPNYNSPFICDSRKSYSFPARVPFSLSNYKASSRRAASKPVVCATIIDGAFSFSSTNRSELRRISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKFCAEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRREKLGASVPSSGFSAASYPDLCETPTFGVLVGAGDRAFLSQTGAVERGPVYCAGSVPLLEAADSSIERVTDPRTDVIIVLQHPSDYNVMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGSPVIGVPVRASGVTGFPHQFVEMCPKHAILLVPVNDAKGAARQAMIICDMVHPGGRTLKRM

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHcccccccEEEEccccccccEEEEEEcccHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEEEEccccEEEEEEccHHHHHHHHHHHccccEEEEEEEHHHHHHcccccccccccccccccccccccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHccccccEEEEEEEccccccccHHHHHcccccEEEEEEcccHHHHHHHHEEEEEEccccccccccc

ccEEEEcccccHHHcccccccccccEEEcccccccccEEEccEEccccccccccEEEEEEEEccccEEEccccccccEEEEEEEEccccHHHHHHHHHHHHccccEcEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHHcHEEEEEccccccHHHHHEEEEEccccEEEEEEEccHHHHHHHHHHHccccEEEEEEccEEEEEEcccccccccccccccccccHHHcccccccHccccccccccccccccccEEEEEcccccccccccccEEEccccEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHcccccEEEEEEEEcccccccccEEEcccccEEEEEEcccHHHHHHHHHHHHHccccccccHccc

maaiikpalqpsqallpkpnynspficdsrksysfparvpfslsnykassrraaskpvvCATIIdgafsfsstnrselRRISvfvrdesgvvdlIDEVFARrgynieslavsgnkdkgLFTIVVSGTDRVLQQVIEQLQKLVNVLkvedfsnepviERELMLIKVnadpkfcaevsgdpgkvaaVQRNSSTVGILEIARTGktafrreklgasvpssgfsaasypdlcetptfgvlvgagdraflsqtgavergpvycagsvplleaadssiervtdprtdVIIVlqhpsdynvMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIdllasgspvigvpvrasgvtgfphqfvemcpkhaillvpvndakgAARQAMIICDmvhpggrtlkrm

maaiikpalqpsqallpkpNYNSPFICDSRKSYSFPARVPFSLSNYKASSRRAASKPVVCATIIDgafsfsstnrselrrisvfvrdesgvvdLIDEVFARRGYNIeslavsgnkdkgLFTIVVSGTDRVLQQVIEQLQKLVNvlkvedfsnepVIERELMLIKVNADPKFCAEVSgdpgkvaavqrnsstvgileiartgktafrreklgasvpssgfsaasypdLCETPTFGVLVGAGDRAFLSQTGAVERGPVYCAGSVPLLEAAdssiervtdprTDVIIVLQHPSDYNVMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGSPVIGVPVRASGVTGFPHQFVEMCPKHAILLVPVNDAKGAARQAMIICDMvhpggrtlkrm

************************FICDSRKSYSFPARVPFSL************KPVVCATIIDGAFSFSSTNRSELRRISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKFCAEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFR************FSAASYPDLCETPTFGVLVGAGDRAFLSQTGAVERGPVYCAGSVPLLEAADSSIERVTDPRTDVIIVLQHPSDYNVMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGSPVIGVPVRASGVTGFPHQFVEMCPKHAILLVPVNDAKGAARQAMIICDMVH*********

*******************************************************************************RISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKFCAEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFR***************************************************CAGSVPLLEAADSSIERVTDPRTDVIIVLQHPSDYNVMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGSPVIGVPVRASGVTGFPHQFVEMCPKHAILLVPVNDAKGAARQAMIICDMVHPGG******

MAAIIKPALQPSQALLPKPNYNSPFICDSRKSYSFPARVPFSLSNY*********KPVVCATIIDGAFSFSSTNRSELRRISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKFCAEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRREKLGASVPSSGFSAASYPDLCETPTFGVLVGAGDRAFLSQTGAVERGPVYCAGSVPLLEAADSSIERVTDPRTDVIIVLQHPSDYNVMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGSPVIGVPVRASGVTGFPHQFVEMCPKHAILLVPVNDAKGAARQAMIICDMVHPGGRTLKRM

********LQPSQALLPKPNYNSPFICDSRKSYSFPARVPFSLSNYKASSRRAASKPVVCATIIDGAFSFSSTNRSELRRISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKFCAEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRREKLGASVPSSGFSAASYPDLCETPTF*******************RGPVYCAGSVPLLEAADSSIERVTDPRTDVIIVLQHPSDYNVMQDAIAILCENDNICCQVMKSYTKKQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGSPVIGVPVRASGVTGFPHQFVEMCPKHAILLVPVNDAKGAARQAMIICDMVHPG*******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		414	2.2.26 [Sep-21-2011]
Q93YZ7		491	Acetolactate synthase sma	yes	no	0.603	0.509	0.468	1e-53
Q9FFF4		477	Acetolactate synthase sma	no	no	0.555	0.482	0.461	4e-52
Q9SMC2		449	Acetolactate synthase sma	N/A	no	0.454	0.418	0.518	4e-49
Q9TLY1		172	Acetolactate synthase sma	N/A	no	0.306	0.738	0.447	1e-26
Q9MS98		181	Acetolactate synthase sma	N/A	no	0.309	0.707	0.431	5e-26
P51230		174	Acetolactate synthase sma	N/A	no	0.306	0.729	0.421	2e-24
Q1XDQ7		174	Acetolactate synthase sma	N/A	no	0.306	0.729	0.421	3e-24
O78451		169	Acetolactate synthase sma	yes	no	0.309	0.757	0.431	4e-24
Q55141		172	Acetolactate synthase sma	N/A	no	0.306	0.738	0.428	4e-23
O67703		192	Acetolactate synthase sma	yes	no	0.309	0.666	0.396	4e-18

>sp\|Q93YZ7\|ILVH2_ARATH Acetolactate synthase small subunit 2, chloroplastic OS=Arabidopsis thaliana GN=At2g31810 PE=1 SV=1	Back alignment and function desciption

 Score =  211 bits (536), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 135/288 (46%), Positives = 170/288 (59%), Gaps = 38/288 (13%)

Query: 22  NSPFICDSRKSYSFPARVPF--SLSNYKASS---RRAASKPVVCATIIDGAFS--FSSTN 74
           +SP +  S +  SFPA++ +   +S+++      R       V   I D +FS   S+T 
Sbjct: 22  SSPALVSSTR-VSFPAKISYLSGISSHRGDEMGKRMEGFVRSVDGKISDASFSEASSATP 80

Query: 75  RSELRR--ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQ 132
           +S++R+  ISVFV DESG+++ I  VFARRGYNIESLAV  N+DK LFTIVV GT+RVLQ
Sbjct: 81  KSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQ 140

Query: 133 QVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPK---------------------- 170
           QVIEQLQKLVNVLKVED S+EP +ERELML+KVNA P+                      
Sbjct: 141 QVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEH 200

Query: 171 -FCAEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRREKLGASVPSSGFSAASYPDLCE 229
               EV+GDPGK+ AV+RN     I EI RTGK A RREK+GA+ P   FSAASYPDL E
Sbjct: 201 ALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPFWRFSAASYPDLKE 260

Query: 230 TPTFGVLVGAGDRAFLSQTGAVERGPVYCAGSVPLLEAADSSIERVTD 277
                VL  +   A + Q      G VY     P+    D  + R+ D
Sbjct: 261 QAPVSVLRSSKKGAIVPQKETSAGGDVY-----PVEPFFDPKVHRILD 303

Regulatory subunit of acetohydroxy-acid synthase. Involved in the feed-back inhibition by branched-chain amino acids. Contains 2 repeats, each of them being able to activate partially the catalytic subunit. The enzyme reconstituted with the first repeat is inhibited by leucine, but not by valine or isoleucine and the enzyme reconstituted with the second repeat is not inhibited by any branched-chain amino acid.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9FFF4\|ILVH1_ARATH Acetolactate synthase small subunit 1, chloroplastic OS=Arabidopsis thaliana GN=VAT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9SMC2\|ILVH_NICPL Acetolactate synthase small subunit 1, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1	Back alignment and function description

>sp\|Q9TLY1\|ILVH_CYACA Acetolactate synthase small subunit OS=Cyanidium caldarium GN=ilvH PE=3 SV=1	Back alignment and function description

>sp\|Q9MS98\|ILVH_GALSU Acetolactate synthase small subunit OS=Galdieria sulphuraria GN=ilvH PE=3 SV=1	Back alignment and function description

>sp\|P51230\|ILVH_PORPU Acetolactate synthase small subunit OS=Porphyra purpurea GN=ilvH PE=3 SV=1	Back alignment and function description

>sp\|Q1XDQ7\|ILVH_PORYE Acetolactate synthase small subunit OS=Porphyra yezoensis GN=ilvH PE=3 SV=1	Back alignment and function description

>sp\|O78451\|ILVH_GUITH Acetolactate synthase small subunit OS=Guillardia theta GN=ilvH PE=3 SV=1	Back alignment and function description

>sp\|Q55141\|ILVH_SYNY3 Acetolactate synthase small subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvH PE=3 SV=2	Back alignment and function description

>sp\|O67703\|ILVH_AQUAE Acetolactate synthase small subunit OS=Aquifex aeolicus (strain VF5) GN=ilvH PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		414
255577893		493	acetolactate synthase, putative [Ricinus	0.439	0.369	0.594	7e-55
297822923		492	hypothetical protein ARALYDRAFT_482103 [	0.577	0.485	0.489	2e-53
356511027		476	PREDICTED: uncharacterized protein LOC10	0.442	0.384	0.586	6e-53
356528404		474	PREDICTED: uncharacterized protein LOC10	0.466	0.407	0.568	1e-52
30685076		469	ACT domain-containing small subunit of a	0.603	0.533	0.468	5e-52
30685071		491	ACT domain-containing small subunit of a	0.603	0.509	0.468	8e-52
225434187		482	PREDICTED: uncharacterized protein LOC10	0.449	0.385	0.568	2e-51
388506728		478	unknown [Lotus japonicus]	0.427	0.370	0.58	5e-51
357519313		478	Acetolactate synthase small subunit [Med	0.427	0.370	0.58	5e-51
147792338		451	hypothetical protein VITISV_043824 [Viti	0.442	0.405	0.567	6e-51

>gi\|255577893\|ref\|XP_002529819.1\| acetolactate synthase, putative [Ricinus communis] gi\|223530696\|gb\|EEF32568.1\| acetolactate synthase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  221 bits (562), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 140/207 (67%), Gaps = 25/207 (12%)

Query: 76  SELRR--ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRVLQQ 133
           S++RR  ISVFV DESG+++ I  VFARRGYNIESLAV  NKDK LFTIVVSGT+RVLQQ
Sbjct: 86  SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQ 145

Query: 134 VIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKFCA-------------------- 173
           V+EQLQKLVNV+KVED S+EP +ERELMLIKVNADP + A                    
Sbjct: 146 VVEQLQKLVNVMKVEDLSSEPQVERELMLIKVNADPSYRAEIMWLVGIFRAKIVDISEHS 205

Query: 174 ---EVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRREKLGASVPSSGFSAASYPDLCET 230
              EV+GDPGK+ AVQRN S  GI EIARTGK A RREK+G   P   FSAASYPDL E 
Sbjct: 206 LTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGECAPFWRFSAASYPDLGEI 265

Query: 231 PTFGVLVGAGDRAFLSQTGAVERGPVY 257
            +   L+G+  RA L        G VY
Sbjct: 266 RSEDALLGSKSRAVLGDDETSAGGDVY 292

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297822923\|ref\|XP_002879344.1\| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] gi\|297325183\|gb\|EFH55603.1\| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356511027\|ref\|XP_003524233.1\| PREDICTED: uncharacterized protein LOC100779210 [Glycine max]	Back alignment and taxonomy information

>gi\|356528404\|ref\|XP_003532793.1\| PREDICTED: uncharacterized protein LOC100810297 [Glycine max]	Back alignment and taxonomy information

>gi\|30685076\|ref\|NP_850174.1\| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi\|330253494\|gb\|AEC08588.1\| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|30685071|ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|75249445|sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; AltName: Full=Acetohydroxy-acid synthase small subunit; Short=AHAS; Short=ALS; Flags: Precursor gi|16604523|gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|21655295|gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|330253492|gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|225434187\|ref\|XP_002279286.1\| PREDICTED: uncharacterized protein LOC100261174 [Vitis vinifera] gi\|296084341\|emb\|CBI24729.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|388506728\|gb\|AFK41430.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|357519313\|ref\|XP_003629945.1\| Acetolactate synthase small subunit [Medicago truncatula] gi\|355523967\|gb\|AET04421.1\| Acetolactate synthase small subunit [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147792338\|emb\|CAN61470.1\| hypothetical protein VITISV_043824 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		414
TAIR\|locus:2045248		491	AT2G31810 [Arabidopsis thalian	0.420	0.354	0.516	1.3e-53
TAIR\|locus:2171292		477	VAT1 "VALINE-TOLERANT 1" [Arab	0.357	0.310	0.554	1.2e-41
TIGR_CMR\|CHY_0518		170	CHY_0518 "acetolactate synthas	0.229	0.558	0.484	1.2e-23
TIGR_CMR\|GSU_1910		163	GSU_1910 "acetolactate synthas	0.229	0.582	0.453	4.4e-16
UNIPROTKB\|P65161		168	ilvH "Putative acetolactate sy	0.212	0.523	0.488	5.7e-16
TIGR_CMR\|SO_2278		164	SO_2278 "acetolactate synthase	0.328	0.829	0.368	4.2e-14
UNIPROTKB\|P00894		163	ilvH "IlvH" [Escherichia coli	0.217	0.552	0.440	1.2e-13
TIGR_CMR\|CPS_3237		165	CPS_3237 "acetolactate synthas	0.239	0.6	0.398	1.2e-13
TIGR_CMR\|DET_0832		178	DET_0832 "acetolactate synthas	0.229	0.533	0.412	1.9e-13
UNIPROTKB\|Q9KP91		164	Ptgds2 "Acetolactate synthase	0.371	0.939	0.337	4.1e-13

TAIR\|locus:2045248 AT2G31810 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 382 (139.5 bits), Expect = 1.3e-53, Sum P(2) = 1.3e-53
 Identities = 95/184 (51%), Positives = 124/184 (67%)

Query:     1 MAAIIKPALQPSQALLPKPNYNSPFICDSRKSYSFPARVPF--SLSNYKASS---RRAAS 55
             MAAI   +    + L    + +SP +  S +  SFPA++ +   +S+++      R    
Sbjct:     1 MAAISVSSSPSIRCLRSACSDSSPALVSSTR-VSFPAKISYLSGISSHRGDEMGKRMEGF 59

Query:    56 KPVVCATIIDGAFS--FSSTNRSELRR--ISVFVRDESGVVDLIDEVFARRGYNIESLAV 111
                V   I D +FS   S+T +S++R+  ISVFV DESG+++ I  VFARRGYNIESLAV
Sbjct:    60 VRSVDGKISDASFSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAV 119

Query:   112 SGNKDKGLFTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPKF 171
               N+DK LFTIVV GT+RVLQQVIEQLQKLVNVLKVED S+EP +ERELML+KVNA P+ 
Sbjct:   120 GLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPES 179

Query:   172 CAEV 175
              AE+
Sbjct:   180 RAEI 183

GO:0003984 "acetolactate synthase activity" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0009082 "branched-chain amino acid biosynthetic process" evidence=IEA;TAS

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0016597 "amino acid binding" evidence=IEA

GO:0006094 "gluconeogenesis" evidence=RCA

GO:0007010 "cytoskeleton organization" evidence=RCA

GO:0010498 "proteasomal protein catabolic process" evidence=RCA

TAIR\|locus:2171292 VAT1 "VALINE-TOLERANT 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_0518 CHY_0518 "acetolactate synthase, small subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1910 GSU_1910 "acetolactate synthase, small subunit" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

UNIPROTKB\|P65161 ilvH "Putative acetolactate synthase small subunit" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_2278 SO_2278 "acetolactate synthase III, small subunit" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|P00894 ilvH "IlvH" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_3237 CPS_3237 "acetolactate synthase III, small subunit" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

TIGR_CMR\|DET_0832 DET_0832 "acetolactate synthase, small subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KP91 Ptgds2 "Acetolactate synthase III, small subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.2.1	LOW CONFIDENCE prediction!
4th Layer	2.2.1.6	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		414
PRK11895		161	PRK11895, ilvH, acetolactate synthase 3 regulatory	9e-41
CHL00100		174	CHL00100, ilvH, acetohydroxyacid synthase small su	6e-40
COG0440		163	COG0440, IlvH, Acetolactate synthase, small (regul	6e-35
TIGR00119		157	TIGR00119, acolac_sm, acetolactate synthase, small	9e-35
cd04878		72	cd04878, ACT_AHAS, N-terminal ACT domain of the Es	4e-23
pfam10369		75	pfam10369, ALS_ss_C, Small subunit of acetolactate	1e-09
pfam13710		63	pfam13710, ACT_5, ACT domain	1e-08
PRK08178		96	PRK08178, PRK08178, acetolactate synthase 1 regula	1e-06
pfam01842		66	pfam01842, ACT, ACT domain	6e-06
PRK06737		76	PRK06737, PRK06737, acetolactate synthase 1 regula	2e-04
cd04876		71	cd04876, ACT_RelA-SpoT, ACT domain found C-termina	8e-04
cd02116		60	cd02116, ACT, ACT domains are commonly involved in	9e-04
PLN02948		577	PLN02948, PLN02948, phosphoribosylaminoimidazole c	0.002
pfam13291		77	pfam13291, ACT_4, ACT domain	0.003

>gnl\|CDD\|183365 PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed	Back alignment and domain information

 Score =  141 bits (359), Expect = 9e-41
 Identities = 60/152 (39%), Positives = 81/152 (53%), Gaps = 25/152 (16%)

Query: 81  ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGL--FTIVVSGTDRVLQQVIEQL 138
           +SV V +E GV+  +  +F+RRGYNIESL V   +D GL   TIV SG ++V++Q+ +QL
Sbjct: 5   LSVLVENEPGVLSRVAGLFSRRGYNIESLTVGPTEDPGLSRMTIVTSGDEQVIEQITKQL 64

Query: 139 QKLVNVLKVEDFSNEPVIERELMLIKVNADPK-----------------------FCAEV 175
            KL++VLKV D + E  +EREL L+KV A  +                          EV
Sbjct: 65  NKLIDVLKVVDLTEEAHVERELALVKVRASGENRAEILRLADIFRAKIVDVTPESLTIEV 124

Query: 176 SGDPGKVAAVQRNSSTVGILEIARTGKTAFRR 207
           +GD  K+ A        GI EI RTG  A  R
Sbjct: 125 TGDSDKIDAFIDLLRPYGIKEIVRTGVVAIGR 156

Length = 161

>gnl\|CDD\|214364 CHL00100, ilvH, acetohydroxyacid synthase small subunit	Back alignment and domain information

>gnl\|CDD\|223517 COG0440, IlvH, Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|129225 TIGR00119, acolac_sm, acetolactate synthase, small subunit	Back alignment and domain information

>gnl\|CDD\|153150 cd04878, ACT_AHAS, N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS)	Back alignment and domain information

>gnl\|CDD\|204463 pfam10369, ALS_ss_C, Small subunit of acetolactate synthase	Back alignment and domain information

>gnl\|CDD\|222334 pfam13710, ACT_5, ACT domain	Back alignment and domain information

>gnl\|CDD\|236174 PRK08178, PRK08178, acetolactate synthase 1 regulatory subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|190133 pfam01842, ACT, ACT domain	Back alignment and domain information

>gnl\|CDD\|180675 PRK06737, PRK06737, acetolactate synthase 1 regulatory subunit; Validated	Back alignment and domain information

>gnl\|CDD\|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains	Back alignment and domain information

>gnl\|CDD\|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme	Back alignment and domain information

>gnl\|CDD\|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase	Back alignment and domain information

>gnl\|CDD\|222030 pfam13291, ACT_4, ACT domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		414
KOG2663		309	consensus Acetolactate synthase, small subunit [Am	100.0
COG0041		162	PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m	100.0
PRK11895		161	ilvH acetolactate synthase 3 regulatory subunit; R	100.0
COG0440		163	IlvH Acetolactate synthase, small (regulatory) sub	100.0
TIGR00119		157	acolac_sm acetolactate synthase, small subunit. ac	100.0
CHL00100		174	ilvH acetohydroxyacid synthase small subunit	100.0
TIGR01162		156	purE phosphoribosylaminoimidazole carboxylase, Pur	100.0
PF00731		150	AIRC: AIR carboxylase; InterPro: IPR000031 Phospho	100.0
PLN02948		577	phosphoribosylaminoimidazole carboxylase	100.0
PRK13562		84	acetolactate synthase 1 regulatory subunit; Provis	99.95
PRK08178		96	acetolactate synthase 1 regulatory subunit; Review	99.95
PRK06737		76	acetolactate synthase 1 regulatory subunit; Valida	99.94
COG1691		254	NCAIR mutase (PurE)-related proteins [General func	99.92
PRK11152		76	ilvM acetolactate synthase 2 regulatory subunit; P	99.91
PF13710		63	ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B.	99.84
PF10369		75	ALS_ss_C: Small subunit of acetolactate synthase;	99.58
KOG2835		373	consensus Phosphoribosylamidoimidazole-succinocarb	99.48
COG4747		142	ACT domain-containing protein [General function pr	98.92
cd04908		66	ACT_Bt0572_1 N-terminal ACT domain of a novel prot	98.82
COG3978		86	Acetolactate synthase (isozyme II), small (regulat	98.69
PF01842		66	ACT: ACT domain; InterPro: IPR002912 The ACT domai	98.66
cd04878		72	ACT_AHAS N-terminal ACT domain of the Escherichia	98.5
cd04879		71	ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te	98.49
PF13291		80	ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A.	98.41
cd04901		69	ACT_3PGDH C-terminal ACT (regulatory) domain of D-	98.35
cd04903		71	ACT_LSD C-terminal ACT domain of the L-serine dehy	98.31
cd04874		72	ACT_Af1403 N-terminal ACT domain of the yet unchar	98.27
PRK06349		426	homoserine dehydrogenase; Provisional	98.26
cd04889		56	ACT_PDH-BS-like C-terminal ACT domain of the monof	98.24
cd04881		79	ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin	98.24
cd04888		76	ACT_PheB-BS C-terminal ACT domain of a small (~147	98.23
cd04902		73	ACT_3PGDH-xct C-terminal ACT (regulatory) domain o	98.15
PRK08577		136	hypothetical protein; Provisional	98.11
cd04877		74	ACT_TyrR N-terminal ACT domain of the TyrR protein	98.1
cd04876		71	ACT_RelA-SpoT ACT domain found C-terminal of the R	98.03
PRK04435		147	hypothetical protein; Provisional	97.9
cd04905		80	ACT_CM-PDT C-terminal ACT domain of the bifunction	97.9
cd04887		74	ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te	97.9
cd04869		81	ACT_GcvR_2 ACT domains that comprise the Glycine C	97.9
cd04883		72	ACT_AcuB C-terminal ACT domain of the Bacillus sub	97.87
cd04884		72	ACT_CBS C-terminal ACT domain of the cystathionine	97.87
cd04880		75	ACT_AAAH-PDT-like ACT domain of the nonheme iron-d	97.81
PRK00194		90	hypothetical protein; Validated	97.8
cd04909		69	ACT_PDH-BS C-terminal ACT domain of the monofuncti	97.75
cd04882		65	ACT_Bt0572_2 C-terminal ACT domain of a novel prot	97.7
cd04886		73	ACT_ThrD-II-like C-terminal ACT domain of biodegra	97.69
cd04872		88	ACT_1ZPV ACT domain proteins similar to the yet un	97.66
cd04875		74	ACT_F4HF-DF N-terminal ACT domain of formyltetrahy	97.65
cd04873		70	ACT_UUR-ACR-like ACT domains of the bacterial sign	97.64
cd02116		60	ACT ACT domains are commonly involved in specifica	97.59
cd04870		75	ACT_PSP_1 CT domains found N-terminal of phosphose	97.59
PF13740		76	ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A.	97.57
cd04899		70	ACT_ACR-UUR-like_2 C-terminal ACT domains of the b	97.47
cd04926		72	ACT_ACR_4 C-terminal ACT domain, of a novel type o	97.42
cd04900		73	ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1,	97.32
cd04925		74	ACT_ACR_2 ACT domain-containing protein which is c	97.18
cd04893		77	ACT_GcvR_1 ACT domains that comprise the Glycine C	97.17
cd04904		74	ACT_AAAH ACT domain of the nonheme iron-dependent,	97.15
cd04927		76	ACT_ACR-like_2 Second ACT domain, of a novel type	97.0
COG4492		150	PheB ACT domain-containing protein [General functi	96.96
COG1707		218	ACT domain-containing protein [General function pr	96.9
PRK11589		190	gcvR glycine cleavage system transcriptional repre	96.84
PRK13011		286	formyltetrahydrofolate deformylase; Reviewed	96.81
PRK06027		286	purU formyltetrahydrofolate deformylase; Reviewed	96.75
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	96.69
cd04930		115	ACT_TH ACT domain of the nonheme iron-dependent ar	96.59
cd04931		90	ACT_PAH ACT domain of the nonheme iron-dependent a	96.51
cd04928		68	ACT_TyrKc Uncharacterized, N-terminal ACT domain o	96.5
cd04895		72	ACT_ACR_1 ACT domain-containing protein which is c	96.34
PRK11092		702	bifunctional (p)ppGpp synthetase II/ guanosine-3',	96.33
PRK11589		190	gcvR glycine cleavage system transcriptional repre	96.31
TIGR00655		280	PurU formyltetrahydrofolate deformylase. This mode	96.25
cd04929		74	ACT_TPH ACT domain of the nonheme iron-dependent a	96.2
PRK10872		743	relA (p)ppGpp synthetase I/GTP pyrophosphokinase;	96.1
TIGR00691		683	spoT_relA (p)ppGpp synthetase, RelA/SpoT family. (	96.06
TIGR00719		208	sda_beta L-serine dehydratase, iron-sulfur-depende	96.02
PRK13010		289	purU formyltetrahydrofolate deformylase; Reviewed	96.01
cd04896		75	ACT_ACR-like_3 ACT domain-containing protein which	95.98
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	95.86
cd04897		75	ACT_ACR_3 ACT domain-containing protein which is c	95.75
PRK11899		279	prephenate dehydratase; Provisional	95.58
cd04891		61	ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-	95.31
cd04935		75	ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK	95.11
cd04871		84	ACT_PSP_2 ACT domains found N-terminal of phosphos	95.09
PRK07334		403	threonine dehydratase; Provisional	95.08
COG2716		176	GcvR Glycine cleavage system regulatory protein [A	95.07
COG0317		701	SpoT Guanosine polyphosphate pyrophosphohydrolases	95.06
PRK06382		406	threonine dehydratase; Provisional	95.01
TIGR01327		525	PGDH D-3-phosphoglycerate dehydrogenase. This mode	94.78
TIGR01127		380	ilvA_1Cterm threonine dehydratase, medium form. A	94.74
PRK06545		359	prephenate dehydrogenase; Validated	94.7
PRK06635		404	aspartate kinase; Reviewed	94.63
cd04885		68	ACT_ThrD-I Tandem C-terminal ACT domains of threon	94.62
TIGR00656		401	asp_kin_monofn aspartate kinase, monofunctional cl	94.14
cd04913		75	ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-	94.05
COG4747		142	ACT domain-containing protein [General function pr	94.05
PRK08818		370	prephenate dehydrogenase; Provisional	94.01
cd04912		75	ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter	93.96
COG0077		279	PheA Prephenate dehydratase [Amino acid transport	93.73
PRK08210		403	aspartate kinase I; Reviewed	93.62
PRK10622		386	pheA bifunctional chorismate mutase/prephenate deh	93.58
cd04932		75	ACT_AKiii-LysC-EC_1 ACT domains located C-terminal	93.45
COG2150		167	Predicted regulator of amino acid metabolism, cont	93.31
PRK11898		283	prephenate dehydratase; Provisional	93.27
PRK08198		404	threonine dehydratase; Provisional	93.0
cd04890		62	ACT_AK-like_1 ACT domains found C-terminal to the	92.9
PRK03059		856	PII uridylyl-transferase; Provisional	92.81
PRK05092		931	PII uridylyl-transferase; Provisional	92.62
cd04934		73	ACT_AK-Hom3_1 CT domains located C-terminal to the	92.18
PRK03381		774	PII uridylyl-transferase; Provisional	91.96
PRK12483		521	threonine dehydratase; Reviewed	91.91
TIGR01268		436	Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra	91.61
PLN02317		382	arogenate dehydratase	91.56
cd04906		85	ACT_ThrD-I_1 First of two tandem C-terminal ACT do	91.5
TIGR01270		464	Trp_5_monoox tryptophan 5-monooxygenase, tetrameri	91.28
PF04350		144	PilO: Pilus assembly protein, PilO; PDB: 2RJZ_B.	91.28
cd04936		63	ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-	90.62
cd04933		78	ACT_AK1-AT_1 ACT domains located C-terminal to the	90.46
PRK05092		931	PII uridylyl-transferase; Provisional	90.3
TIGR01693		850	UTase_glnD [Protein-PII] uridylyltransferase. This	90.27
cd04892		65	ACT_AK-like_2 ACT domains C-terminal to the cataly	90.18
PRK07431		587	aspartate kinase; Provisional	89.44
COG0527		447	LysC Aspartokinases [Amino acid transport and meta	89.35
PF13840		65	ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2	89.11
cd08170		351	GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox	88.96
PRK00275		895	glnD PII uridylyl-transferase; Provisional	88.76
cd04919		66	ACT_AK-Hom3_2 ACT domains located C-terminal to th	88.69
TIGR01693		850	UTase_glnD [Protein-PII] uridylyltransferase. This	88.64
cd04922		66	ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona	88.59
cd08171		345	GlyDH-like2 Glycerol dehydrogenase-like. Glycerol	88.28
cd04916		66	ACT_AKiii-YclM-BS_2 ACT domains located C-terminal	88.26
PRK05007		884	PII uridylyl-transferase; Provisional	88.02
PRK03381		774	PII uridylyl-transferase; Provisional	87.84
PRK01759		854	glnD PII uridylyl-transferase; Provisional	86.7
PRK05007		884	PII uridylyl-transferase; Provisional	86.6
cd04868		60	ACT_AK-like ACT domains C-terminal to the catalyti	86.46
PRK09423		366	gldA glycerol dehydrogenase; Provisional	86.24
cd04924		66	ACT_AK-Arch_2 ACT domains of a monofunctional aspa	86.12
PRK03059		856	PII uridylyl-transferase; Provisional	86.04
PRK00275		895	glnD PII uridylyl-transferase; Provisional	85.69
cd08549		332	G1PDH_related Glycerol-1-phosphate_dehydrogenase a	84.95
COG3830		90	ACT domain-containing protein [Signal transduction	84.61
cd04911		76	ACT_AKiii-YclM-BS_1 ACT domains located C-terminal	84.51
PRK04374		869	PII uridylyl-transferase; Provisional	84.41
KOG2663		309	consensus Acetolactate synthase, small subunit [Am	84.38
PRK04374		869	PII uridylyl-transferase; Provisional	84.21
cd08550		349	GlyDH-like Glycerol_dehydrogenase-like. Families o	83.99
cd04923		63	ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-	83.96
cd04921		80	ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc	83.95
cd04914		67	ACT_AKi-DapG-BS_1 ACT domains of the diaminopimela	83.78
COG0788		287	PurU Formyltetrahydrofolate hydrolase [Nucleotide	83.53
PRK09084		448	aspartate kinase III; Validated	83.51
PRK15385		225	magnesium transport protein MgtC; Provisional	83.45
cd04937		64	ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela	83.41
PRK08961		861	bifunctional aspartate kinase/diaminopimelate deca	83.4
cd08551		370	Fe-ADH iron-containing alcohol dehydrogenases (Fe-	83.36
cd08182		367	HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c	83.34
cd08173		339	Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro	83.05
PLN02551		521	aspartokinase	82.98
cd08195		345	DHQS Dehydroquinate synthase (DHQS) catalyzes the	82.82
PRK09034		454	aspartate kinase; Reviewed	82.8
PRK00843		350	egsA NAD(P)-dependent glycerol-1-phosphate dehydro	82.63
PRK06291		465	aspartate kinase; Provisional	82.47
TIGR00657		441	asp_kinases aspartate kinase. The Lys-sensitive en	82.4
cd08174		331	G1PDH-like Glycerol-1-phosphate dehydrogenase-like	82.33
PF10741		110	T2SM_b: Type II secretion system (T2SS), protein M	81.92
PLN02550		591	threonine dehydratase	81.82
cd07766		332	DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like)	80.91
cd08192		370	Fe-ADH7 Iron-containing alcohol dehydrogenases-lik	80.88
cd04918		65	ACT_AK1-AT_2 ACT domains located C-terminal to the	80.85
PRK09224		504	threonine dehydratase; Reviewed	80.73
COG2716		176	GcvR Glycine cleavage system regulatory protein [A	80.13

>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=9.5e-47  Score=361.86  Aligned_cols=221  Identities=36%  Similarity=0.478  Sum_probs=196.0

Q ss_pred             cccccccccccccc-chhhhhhhcc--ccCCCCcccccccC------Cc-cccCCCccccccE--EEEEEeCchhHHHHH
Q 015044           28 DSRKSYSFPARVPF-SLSNYKASSR--RAASKPVVCATIID------GA-FSFSSTNRSELRR--ISVFVRDESGVVDLI   95 (414)
Q Consensus        28 ~~~~~~~~~~~~~~-~~~~~~~~~~--~~~~~p~~~~~~~~------~i-~~~~~~~~~~Mkr--LSVlVeN~pGVLsRI   95 (414)
                      .|.+|+|||+.-+. ++++||+.||  +.++.|+.+.|.+.      .| -.+|.+.+++.||  |++||+|+||+|+||
T Consensus        15 ~ss~~~~~~~sts~ts~i~yk~~h~~~~rp~~~~~~~p~~~~d~avS~ii~~tP~~~~qr~krHvinclVqnEpGvlsRi   94 (309)
T KOG2663|consen   15 ASSCRTMFPASTSSTSAIAYKQMHRHGTRPRLPTLDTPSANADSAVSSIISETPAPSRQRVKRHVINCLVQNEPGVLSRI   94 (309)
T ss_pred             hhccceeeeccCcccchhhHHHHHhcCCCCCCceecCccccchHHHHHHhhcCCccccccccceeEEEEecCCchHHHHH
Confidence            46689999998874 7899999997  45567777777542      23 3588888888766  999999999999999


Q ss_pred             HHHHhccCcceeeEEeeecCCCcE--EEEEEeCchhHHHHHHHHHhcCccEEEEEecCCchhhheeeeEEEEecCcc--c
Q 015044           96 DEVFARRGYNIESLAVSGNKDKGL--FTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSNEPVIERELMLIKVNADPK--F  171 (414)
Q Consensus        96 tgLFsRRGyNIeSLtVg~Ted~~i--iTIVV~gde~~veQl~kQL~KLidVikV~dlt~~~~V~REL~LiKV~~~~~--~  171 (414)
                      +|+|++||||||||.||.||++.+  ||||+.|+|++++|.++||+||++|++|+||+++++|+|||||+||+.-.-  -
T Consensus        95 sGvlAaRGfNIdSLvVc~tevk~LsrmTIVl~Gtd~VveQa~rQiedlVnV~aVlDyt~e~~VeRELmlakvsllg~d~F  174 (309)
T KOG2663|consen   95 SGVLAARGFNIDSLVVCLTEVKALSRMTIVLQGTDGVVEQARRQIEDLVNVYAVLDYTNEPIVERELMLAKVSLLGVDYF  174 (309)
T ss_pred             HHHHHhccCCchheeeechhhhhhhhceEEEeccHHHHHHHHHHHHHhhhhheeeecCCChHHHHHHHHHHHHhhhHHHH
Confidence            999999999999999999999986  899999999999999999999999999999999999999999999986321  1


Q ss_pred             c----------ccccCCHHHHHHHHHhhccCCcEEEecccceeeecccCCcCCCCCCccccCCCCcCCCCCccccccccc
Q 015044          172 C----------AEVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRREKLGASVPSSGFSAASYPDLCETPTFGVLVGAGD  241 (414)
Q Consensus       172 r----------~EvTG~~~KIdafi~~L~~fGIlEiaRTG~iAl~R~~~~~~~~~~~~~~~~yp~~~~~~~~~~~~~~~~  241 (414)
                      |          .|+|||++   ++...|++|+|-|++|||. |+.|.+++...++|+|++++||++.+..+...+++.. 
T Consensus       175 ravd~~eh~~t~e~tadsg---al~tnlkkkq~~e~v~tak-allrlk~~~la~i~rlta~f~grvvdis~~s~i~elt-  249 (309)
T KOG2663|consen  175 RAVDLHEHTLTIEVTADSG---ALVTNLKKKQIHEIVRTAK-ALLRLKMGHLAPIWRLTAAFYGRVVDISETSCIVELT-  249 (309)
T ss_pred             HhhhhhhhhhhhhhccCch---HHHhhHHHhccchhhccHH-HHHHHhhhccchHHHHhhhhccchhccccceeeeeec-
Confidence            2          29999999   7889999999999999999 9999999999999999999999999988888776654 


Q ss_pred             ccccCCCCCCCCCceeecCCC
Q 015044          242 RAFLSQTGAVERGPVYCAGSV  262 (414)
Q Consensus       242 ~~~~~~~~~~~~gdvy~v~~~  262 (414)
                               +.+|||||++++
T Consensus       250 ---------a~p~rV~~fl~l  261 (309)
T KOG2663|consen  250 ---------AKPGRVYPFLPL  261 (309)
T ss_pred             ---------cCCCcccccccc
Confidence                     778999999885

>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed	Back alignment and domain information

>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00119 acolac_sm acetolactate synthase, small subunit	Back alignment and domain information

>CHL00100 ilvH acetohydroxyacid synthase small subunit	Back alignment and domain information

>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein	Back alignment and domain information

>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE	Back alignment and domain information

>PLN02948 phosphoribosylaminoimidazole carboxylase	Back alignment and domain information

>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional	Back alignment and domain information

>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed	Back alignment and domain information

>PRK06737 acetolactate synthase 1 regulatory subunit; Validated	Back alignment and domain information

>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only]	Back alignment and domain information

>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional	Back alignment and domain information

>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B	Back alignment and domain information

>PF10369 ALS_ss_C: Small subunit of acetolactate synthase; InterPro: IPR019455 This entry represents the C-terminal domain of the small subunit of acetolactate synthase (the N-terminal domain being an ACT domain)	Back alignment and domain information

>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG4747 ACT domain-containing protein [General function prediction only]	Back alignment and domain information

>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains	Back alignment and domain information

>COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown]	Back alignment and domain information

>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold	Back alignment and domain information

>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS)	Back alignment and domain information

>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH)	Back alignment and domain information

>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A	Back alignment and domain information

>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria	Back alignment and domain information

>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit	Back alignment and domain information

>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a	Back alignment and domain information

>PRK06349 homoserine dehydrogenase; Provisional	Back alignment and domain information

>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate	Back alignment and domain information

>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains	Back alignment and domain information

>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a	Back alignment and domain information

>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH)	Back alignment and domain information

>PRK08577 hypothetical protein; Provisional	Back alignment and domain information

>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein	Back alignment and domain information

>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains	Back alignment and domain information

>PRK04435 hypothetical protein; Provisional	Back alignment and domain information

>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme	Back alignment and domain information

>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains	Back alignment and domain information

>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains	Back alignment and domain information

>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB	Back alignment and domain information

>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria	Back alignment and domain information

>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH)	Back alignment and domain information

>PRK00194 hypothetical protein; Validated	Back alignment and domain information

>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH)	Back alignment and domain information

>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains	Back alignment and domain information

>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains	Back alignment and domain information

>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein	Back alignment and domain information

>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase)	Back alignment and domain information

>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD	Back alignment and domain information

>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme	Back alignment and domain information

>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB)	Back alignment and domain information

>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A	Back alignment and domain information

>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains	Back alignment and domain information

>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)	Back alignment and domain information

>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains	Back alignment and domain information

>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)	Back alignment and domain information

>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains	Back alignment and domain information

>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH)	Back alignment and domain information

>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)	Back alignment and domain information

>COG4492 PheB ACT domain-containing protein [General function prediction only]	Back alignment and domain information

>COG1707 ACT domain-containing protein [General function prediction only]	Back alignment and domain information

>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional	Back alignment and domain information

>PRK13011 formyltetrahydrofolate deformylase; Reviewed	Back alignment and domain information

>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH)	Back alignment and domain information

>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH)	Back alignment and domain information

>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains	Back alignment and domain information

>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)	Back alignment and domain information

>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional	Back alignment and domain information

>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional	Back alignment and domain information

>TIGR00655 PurU formyltetrahydrofolate deformylase	Back alignment and domain information

>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes	Back alignment and domain information

>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional	Back alignment and domain information

>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family	Back alignment and domain information

>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit	Back alignment and domain information

>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed	Back alignment and domain information

>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)	Back alignment and domain information

>PRK11899 prephenate dehydratase; Provisional	Back alignment and domain information

>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins	Back alignment and domain information

>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein	Back alignment and domain information

>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB)	Back alignment and domain information

>PRK07334 threonine dehydratase; Provisional	Back alignment and domain information

>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism]	Back alignment and domain information

>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription]	Back alignment and domain information

>PRK06382 threonine dehydratase; Provisional	Back alignment and domain information

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form	Back alignment and domain information

>PRK06545 prephenate dehydrogenase; Validated	Back alignment and domain information

>PRK06635 aspartate kinase; Reviewed	Back alignment and domain information

>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase)	Back alignment and domain information

>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class	Back alignment and domain information

>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins	Back alignment and domain information

>COG4747 ACT domain-containing protein [General function prediction only]	Back alignment and domain information

>PRK08818 prephenate dehydrogenase; Provisional	Back alignment and domain information

>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII	Back alignment and domain information

>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08210 aspartate kinase I; Reviewed	Back alignment and domain information

>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional	Back alignment and domain information

>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII	Back alignment and domain information

>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only]	Back alignment and domain information

>PRK11898 prephenate dehydratase; Provisional	Back alignment and domain information

>PRK08198 threonine dehydratase; Provisional	Back alignment and domain information

>cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase)	Back alignment and domain information

>PRK03059 PII uridylyl-transferase; Provisional	Back alignment and domain information

>PRK05092 PII uridylyl-transferase; Provisional	Back alignment and domain information

>cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains	Back alignment and domain information

>PRK03381 PII uridylyl-transferase; Provisional	Back alignment and domain information

>PRK12483 threonine dehydratase; Reviewed	Back alignment and domain information

>TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form	Back alignment and domain information

>PLN02317 arogenate dehydratase	Back alignment and domain information

>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase)	Back alignment and domain information

>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric	Back alignment and domain information

>PF04350 PilO: Pilus assembly protein, PilO; PDB: 2RJZ_B	Back alignment and domain information

>cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains	Back alignment and domain information

>cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1)	Back alignment and domain information

>PRK05092 PII uridylyl-transferase; Provisional	Back alignment and domain information

>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase	Back alignment and domain information

>cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase)	Back alignment and domain information

>PRK07431 aspartate kinase; Provisional	Back alignment and domain information

>COG0527 LysC Aspartokinases [Amino acid transport and metabolism]	Back alignment and domain information

>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D	Back alignment and domain information

>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation	Back alignment and domain information

>PRK00275 glnD PII uridylyl-transferase; Provisional	Back alignment and domain information

>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3	Back alignment and domain information

>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase	Back alignment and domain information

>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH)	Back alignment and domain information

>cd08171 GlyDH-like2 Glycerol dehydrogenase-like	Back alignment and domain information

>cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII	Back alignment and domain information

>PRK05007 PII uridylyl-transferase; Provisional	Back alignment and domain information

>PRK03381 PII uridylyl-transferase; Provisional	Back alignment and domain information

>PRK01759 glnD PII uridylyl-transferase; Provisional	Back alignment and domain information

>PRK05007 PII uridylyl-transferase; Provisional	Back alignment and domain information

>cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase)	Back alignment and domain information

>PRK09423 gldA glycerol dehydrogenase; Provisional	Back alignment and domain information

>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2)	Back alignment and domain information

>PRK03059 PII uridylyl-transferase; Provisional	Back alignment and domain information

>PRK00275 glnD PII uridylyl-transferase; Provisional	Back alignment and domain information

>cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins	Back alignment and domain information

>COG3830 ACT domain-containing protein [Signal transduction mechanisms]	Back alignment and domain information

>cd04911 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII	Back alignment and domain information

>PRK04374 PII uridylyl-transferase; Provisional	Back alignment and domain information

>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism]	Back alignment and domain information

>PRK04374 PII uridylyl-transferase; Provisional	Back alignment and domain information

>cd08550 GlyDH-like Glycerol_dehydrogenase-like	Back alignment and domain information

>cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains	Back alignment and domain information

>cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH)	Back alignment and domain information

>cd04914 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI	Back alignment and domain information

>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09084 aspartate kinase III; Validated	Back alignment and domain information

>PRK15385 magnesium transport protein MgtC; Provisional	Back alignment and domain information

>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI	Back alignment and domain information

>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional	Back alignment and domain information

>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like	Back alignment and domain information

>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP)	Back alignment and domain information

>cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme	Back alignment and domain information

>PLN02551 aspartokinase	Back alignment and domain information

>cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis	Back alignment and domain information

>PRK09034 aspartate kinase; Reviewed	Back alignment and domain information

>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK06291 aspartate kinase; Provisional	Back alignment and domain information

>TIGR00657 asp_kinases aspartate kinase	Back alignment and domain information

>cd08174 G1PDH-like Glycerol-1-phosphate dehydrogenase-like	Back alignment and domain information

>PF10741 T2SM_b: Type II secretion system (T2SS), protein M subtype b; InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria	Back alignment and domain information

>PLN02550 threonine dehydratase	Back alignment and domain information

>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH)	Back alignment and domain information

>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway	Back alignment and domain information

>cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1)	Back alignment and domain information

>PRK09224 threonine dehydratase; Reviewed	Back alignment and domain information

>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		414
2pc6_A		165	Crystal Structure Of Putative Acetolactate Synthase		3e-14
2f1f_A		164	Crystal Structure Of The Regulatory Subunit Of Acet		2e-13
2fgc_A		193	Crystal Structure Of Acetolactate Synthase- Small S		5e-08

>pdb|2PC6|A Chain A, Crystal Structure Of Putative Acetolactate Synthase- Small Subunit From Nitrosomonas Europaea Length = 165

Back alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 25/152 (16%) Query: 81 ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGL--FTIVVSGTDRVLQQVIEQL 138 IS+ +E+G + + +F+ RGYNIESL+V+ +D L T+V +G D +++Q+ +QL Sbjct: 7 ISLLXENEAGALSRVAGLFSARGYNIESLSVAPTEDPTLSRXTLVTNGPDEIVEQITKQL 66 Query: 139 QKLVNVLKVEDFSNEPVIERELMLIKVNADPK-----------------------FCAEV 175 KL+ V+K+ D S+E +EREL L+KV A K + E+ Sbjct: 67 NKLIEVVKLIDLSSEGYVERELXLVKVRAVGKDREEXKRLADIFRGNIIDVTNELYTIEL 126 Query: 176 SGDPGKVAAVQRNSSTVGILEIARTGKTAFRR 207 +G K+ + ILEIARTG + R Sbjct: 127 TGTRSKLDGFLQAVDCNLILEIARTGVSGLSR 158

PyMOL of 2pc6

>pdb|2F1F|A Chain A, Crystal Structure Of The Regulatory Subunit Of Acetohydroxyacid Synthase Isozyme Iii From E. Coli Length = 164

Back alignment and structure

>pdb|2FGC|A Chain A, Crystal Structure Of Acetolactate Synthase- Small Subunit From Thermotoga Maritima Length = 193

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		414
2pc6_A		165	Probable acetolactate synthase isozyme III (small;	2e-45
2f1f_A		164	Acetolactate synthase isozyme III small subunit; f	1e-43
2fgc_A		193	Acetolactate synthase, small subunit; regulatory s	4e-43
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
2ko1_A		88	CTR148A, GTP pyrophosphokinase; homodimer, alpha+b	5e-04

>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Length = 165	Back alignment and structure

 Score =  153 bits (389), Expect = 2e-45
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 25/152 (16%)

Query: 81  ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGL--FTIVVSGTDRVLQQVIEQL 138
           IS+ + +E+G +  +  +F+ RGYNIESL+V+  +D  L   T+V +G D +++Q+ +QL
Sbjct: 7   ISLLMENEAGALSRVAGLFSARGYNIESLSVAPTEDPTLSRMTLVTNGPDEIVEQITKQL 66

Query: 139 QKLVNVLKVEDFSNEPVIERELMLIKVNADPK-----------------------FCAEV 175
            KL+ V+K+ D S+E  +ERELML+KV A  K                       +  E+
Sbjct: 67  NKLIEVVKLIDLSSEGYVERELMLVKVRAVGKDREEMKRLADIFRGNIIDVTNELYTIEL 126

Query: 176 SGDPGKVAAVQRNSSTVGILEIARTGKTAFRR 207
           +G   K+    +      ILEIARTG +   R
Sbjct: 127 TGTRSKLDGFLQAVDCNLILEIARTGVSGLSR 158

PyMOL of 2pc6

>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Length = 164	Back alignment and structure

>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Length = 193	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		414
2fgc_A		193	Acetolactate synthase, small subunit; regulatory s	100.0
2pc6_A		165	Probable acetolactate synthase isozyme III (small;	100.0
3lp6_A		174	Phosphoribosylaminoimidazole carboxylase catalyti;	100.0
3ors_A		163	N5-carboxyaminoimidazole ribonucleotide mutase; is	100.0
3trh_A		169	Phosphoribosylaminoimidazole carboxylase carboxylt	100.0
1xmp_A		170	PURE, phosphoribosylaminoimidazole carboxylase; pu	100.0
3oow_A		166	Phosphoribosylaminoimidazole carboxylase,catalyic;	100.0
1o4v_A		183	Phosphoribosylaminoimidazole mutase PURE; structur	100.0
3kuu_A		174	Phosphoribosylaminoimidazole carboxylase catalyti	100.0
4b4k_A		181	N5-carboxyaminoimidazole ribonucleotide mutase; is	100.0
4grd_A		173	N5-CAIR mutase, phosphoribosylaminoimidazole carbo	100.0
2f1f_A		164	Acetolactate synthase isozyme III small subunit; f	100.0
1u11_A		182	PURE (N5-carboxyaminoimidazole ribonucleotide MUT;	100.0
3rg8_A		159	Phosphoribosylaminoimidazole carboxylase, PURE PR;	100.0
2ywx_A		157	Phosphoribosylaminoimidazole carboxylase catalyti;	100.0
2h31_A		425	Multifunctional protein ADE2; alpha-beta-alpha, li	100.0
2f06_A		144	Conserved hypothetical protein; structural genomic	98.81
2ko1_A		88	CTR148A, GTP pyrophosphokinase; homodimer, alpha+b	98.73
1u8s_A		192	Glycine cleavage system transcriptional repressor,	98.61
1zpv_A		91	ACT domain protein; structural genomics, PSI, prot	98.41
1y7p_A		223	Hypothetical protein AF1403; structural genomics,	97.69
2re1_A		167	Aspartokinase, alpha and beta subunits; structural	97.48
1sc6_A		404	PGDH, D-3-phosphoglycerate dehydrogenase; alloster	97.29
2jhe_A		190	Transcription regulator TYRR; aromatic hydrocarbon	97.28
1u8s_A		192	Glycine cleavage system transcriptional repressor,	97.05
3k5p_A		416	D-3-phosphoglycerate dehydrogenase; niaid, ssgcid,	97.02
2nyi_A		195	Unknown protein; protein structure initiative, PSI	96.72
2dt9_A		167	Aspartokinase; protein-ligand complex, regulatory	96.54
3o1l_A		302	Formyltetrahydrofolate deformylase; structural gen	96.48
3lou_A		292	Formyltetrahydrofolate deformylase; structural gen	96.43
2f06_A		144	Conserved hypothetical protein; structural genomic	96.4
3n0v_A		286	Formyltetrahydrofolate deformylase; formyl transfe	96.36
1ygy_A		529	PGDH, D-3-phosphoglycerate dehydrogenase; oxidored	96.29
2nyi_A		195	Unknown protein; protein structure initiative, PSI	96.28
3mtj_A		444	Homoserine dehydrogenase; rossmann-fold, PSI, MCSG	96.28
3obi_A		288	Formyltetrahydrofolate deformylase; structural gen	96.26
3nrb_A		287	Formyltetrahydrofolate deformylase; N-terminal ACT	96.17
3s1t_A		181	Aspartokinase; ACT domain, threonine binding, regu	96.15
2dtj_A		178	Aspartokinase; protein-ligand complex, regulatory	96.08
2qmx_A		283	Prephenate dehydratase; APC86053, L-Phe inhibition	95.15
3ab4_A		421	Aspartokinase; aspartate kinase, concerted inhibit	95.07
3mah_A		157	Aspartokinase; aspartate kinase, structural genomi	94.7
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	94.27
2qmw_A		267	PDT, prephenate dehydratase; APC85812, prephenate	94.06
3mwb_A		313	Prephenate dehydratase; L-Phe, PSI, MCSG, structur	93.27
4go7_X		200	Aspartokinase; transferase; 2.00A {Mycobacterium t	93.24
3luy_A		329	Probable chorismate mutase; structural genomics, A	92.04
1phz_A		429	Protein (phenylalanine hydroxylase); aromatic amin	90.55
3c1m_A		473	Probable aspartokinase; allosteric inhibition, thr	89.92
3tvi_A		446	Aspartokinase; structural genomics, ACT domains, r	88.73
2dtj_A		178	Aspartokinase; protein-ligand complex, regulatory	88.46
2nzc_A		86	Hypothetical protein; sturctural genomics, TM1266,	88.31
2dt9_A		167	Aspartokinase; protein-ligand complex, regulatory	87.36
3l76_A		600	Aspartokinase; allostery, ACT domains, kinase tran	86.85
2re1_A		167	Aspartokinase, alpha and beta subunits; structural	86.24
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	85.46
1jq5_A		370	Glycerol dehydrogenase; oxidoreductase, NAD, glyce	85.44
3uhj_A		387	Probable glycerol dehydrogenase; structural genomi	83.13
3l76_A		600	Aspartokinase; allostery, ACT domains, kinase tran	83.03
3bfj_A		387	1,3-propanediol oxidoreductase; opportunistic path	82.5
3okf_A		390	3-dehydroquinate synthase; structural genomics, ce	82.13
3s1t_A		181	Aspartokinase; ACT domain, threonine binding, regu	80.63

>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6	Back alignment and structure

Probab=100.00  E-value=7e-42  Score=317.48  Aligned_cols=134  Identities=37%  Similarity=0.543  Sum_probs=128.4

Q ss_pred             cccE-EEEEEeCchhHHHHHHHHHhccCcceeeEEeeecCCCcE--EEEEEeCchhHHHHHHHHHhcCccEEEEEecCC-
Q 015044           77 ELRR-ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGL--FTIVVSGTDRVLQQVIEQLQKLVNVLKVEDFSN-  152 (414)
Q Consensus        77 ~Mkr-LSVlVeN~pGVLsRItgLFsRRGyNIeSLtVg~Ted~~i--iTIVV~gde~~veQl~kQL~KLidVikV~dlt~-  152 (414)
                      .|+| |+++++|+||+|+||+++|+||||||+||++++++++++  |||+|+++++.++||.+||+||+||++|.++++ 
T Consensus        27 ~m~~~LsVlVeN~pGvLaRItglfsrRG~NI~SLtV~~ted~gisRitIvV~g~e~~ieqL~kQL~KLidVikV~dl~~~  106 (193)
T 2fgc_A           27 IREHLVSMLVHNKPGVMRKVANLFARRGFNISSITVGESETPGLSRLVIMVKGDDKTIEQIEKQAYKLVEVVKVTPIDPL  106 (193)
T ss_dssp             CEEEEEEEEEECCTTHHHHHHHHHHTTTCEEEEEEEEECSSTTEEEEEEEEEECTTHHHHHHHHHTTSTTEEEEEECCSS
T ss_pred             ceEEEEEEEECCCChHHHHHHHHHHHCCceEEEEEeeccCCCCEEEEEEEEECCHHHHHHHHHHhcCcCceEEEEEecCC
Confidence            5888 999999999999999999999999999999999999986  888999999999999999999999999999999 


Q ss_pred             -chhhheeeeEEEEecCccccc-----------------------cccCCHHHHHHHHHhhccCCcEEEecccceeeecc
Q 015044          153 -EPVIERELMLIKVNADPKFCA-----------------------EVSGDPGKVAAVQRNSSTVGILEIARTGKTAFRRE  208 (414)
Q Consensus       153 -~~~V~REL~LiKV~~~~~~r~-----------------------EvTG~~~KIdafi~~L~~fGIlEiaRTG~iAl~R~  208 (414)
                       .+.|+|||+||||+++++ |.                       |+||+++||++|+++|+||||+|++|||++||.||
T Consensus       107 ~~~~v~REl~LiKV~~~~~-r~ei~~i~~~fra~ivDv~~~s~~iE~tG~~~ki~a~i~~l~~~gi~E~~RtG~val~Rg  185 (193)
T 2fgc_A          107 PENRVEREMALIKVRFDED-KQEIFQLVEIFRGKIIDVSREGAIIEITGARSKVEAFINLLPQKQVEEIARTGIVAMNRW  185 (193)
T ss_dssp             GGGEEEEEEEEEEEECSSC-HHHHHHHHHHTTCEEEEECSSEEEEEEEECHHHHHHHHHHSCGGGEEEEEECCCEEEECC
T ss_pred             CCccceeEEEEEEEeCCcC-HHHHHHHHHHcCCEEEEEcCCEEEEEEcCCHHHHHHHHHHhhhhCCEEEEccChhheecC
Confidence             999999999999999887 75                       99999999999999999999999999999999999


Q ss_pred             cCC
Q 015044          209 KLG  211 (414)
Q Consensus       209 ~~~  211 (414)
                      +..
T Consensus       186 ~~~  188 (193)
T 2fgc_A          186 NVK  188 (193)
T ss_dssp             CC-
T ss_pred             Ccc
Confidence            854

PyMOL of 2fgc

>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6	Back alignment and structure

>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0	Back alignment and structure

>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp}	Back alignment and structure

>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii}	Back alignment and structure

>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1	Back alignment and structure

>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A*	Back alignment and structure

>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1	Back alignment and structure

>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A*	Back alignment and structure

>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis}	Back alignment and structure

>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia}	Back alignment and structure

>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6	Back alignment and structure

>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A	Back alignment and structure

>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A*	Back alignment and structure

>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii}	Back alignment and structure

>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}	Back alignment and structure

>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11	Back alignment and structure

>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A	Back alignment and structure

>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5	Back alignment and structure

>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7	Back alignment and structure

>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12	Back alignment and structure

>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58}	Back alignment and structure

>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A*	Back alignment and structure

>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli}	Back alignment and structure

>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5	Back alignment and structure

>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}	Back alignment and structure

>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria}	Back alignment and structure

>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A	Back alignment and structure

>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei}	Back alignment and structure

>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11	Back alignment and structure

>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida}	Back alignment and structure

>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A*	Back alignment and structure

>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria}	Back alignment and structure

>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans}	Back alignment and structure

>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris}	Back alignment and structure

>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida}	Back alignment and structure

>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis}	Back alignment and structure

>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B*	Back alignment and structure

>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls}	Back alignment and structure

>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A	Back alignment and structure

>3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis}	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3	Back alignment and structure

>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens}	Back alignment and structure

>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X	Back alignment and structure

>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis}	Back alignment and structure

>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A	Back alignment and structure

>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum}	Back alignment and structure

>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B*	Back alignment and structure

>2nzc_A Hypothetical protein; sturctural genomics, TM1266, structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.95A {Thermotoga maritima} SCOP: d.58.18.14	Back alignment and structure

>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A	Back alignment and structure

>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis}	Back alignment and structure

>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58}	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A*	Back alignment and structure

>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis}	Back alignment and structure

>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae}	Back alignment and structure

>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor}	Back alignment and structure

>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		414
d2pc6a2		77	d.58.18.6 (A:1-77) Acetolactate synthase small sub	2e-23
d2f1fa1		76	d.58.18.6 (A:2-77) Acetolactate synthase small sub	2e-22
d2fgca2		78	d.58.18.6 (A:27-104) Acetolactate synthase small s	3e-22
d1sc6a3		84	d.58.18.1 (A:327-410) Phosphoglycerate dehydrogena	3e-14
d2f06a2		70	d.58.18.11 (A:1-70) Hypothetical protein BT0572 {B	1e-12
d1ygya3		78	d.58.18.1 (A:452-529) Phosphoglycerate dehydrogena	3e-11
d2pc6a1		86	d.58.18.6 (A:78-163) Acetolactate synthase small s	7e-10
d2fgca1		83	d.58.18.6 (A:105-187) Acetolactate synthase small	1e-08
d2f1fa2		86	d.58.18.6 (A:78-163) Acetolactate synthase small s	9e-08
d1y7pa2		77	d.58.18.12 (A:2-78) Hypothetical protein AF1403, N	2e-06
d2f06a1		71	d.58.18.11 (A:71-141) Hypothetical protein BT0572	2e-04
d1u8sa1		86	d.58.18.5 (A:2-87) putative transcriptional repres	0.001

>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 77	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: IlvH-like
domain: Acetolactate synthase small subunit, IlvH
species: Nitrosomonas europaea [TaxId: 915]

 Score = 91.2 bits (227), Expect = 2e-23
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 2/75 (2%)

Query: 79  RRISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGL--FTIVVSGTDRVLQQVIE 136
             IS+ + +E+G +  +  +F+ RGYNIESL+V+  +D  L   T+V +G D +++Q+ +
Sbjct: 3   HIISLLMENEAGALSRVAGLFSARGYNIESLSVAPTEDPTLSRMTLVTNGPDEIVEQITK 62

Query: 137 QLQKLVNVLKVEDFS 151
           QL KL+ V+K+ D S
Sbjct: 63  QLNKLIEVVKLIDLS 77

PyMOL of d2pc6a2

>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 76	Back information, alignment and structure

>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 78	Back information, alignment and structure

>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84	Back information, alignment and structure

>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 70	Back information, alignment and structure

>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78	Back information, alignment and structure

>d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 86	Back information, alignment and structure

>d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 83	Back information, alignment and structure

>d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 86	Back information, alignment and structure

>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77	Back information, alignment and structure

>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 71	Back information, alignment and structure

>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		414
d1o4va_		169	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	100.0
d1xmpa_		155	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	100.0
d1qcza_		163	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	100.0
d1u11a_		159	N5-CAIR mutase (phosphoribosylaminoimidazole carbo	100.0
d2pc6a2		77	Acetolactate synthase small subunit, IlvH {Nitroso	99.96
d2fgca2		78	Acetolactate synthase small subunit, IlvH {Thermot	99.95
d2f1fa1		76	Acetolactate synthase small subunit, IlvH {Escheri	99.95
d2pc6a1		86	Acetolactate synthase small subunit, IlvH {Nitroso	99.62
d2f06a2		70	Hypothetical protein BT0572 {Bacteroides thetaiota	99.61
d2f1fa2		86	Acetolactate synthase small subunit, IlvH {Escheri	99.59
d2fgca1		83	Acetolactate synthase small subunit, IlvH {Thermot	99.58
d1sc6a3		84	Phosphoglycerate dehydrogenase, regulatory (C-term	99.13
d1ygya3		78	Phosphoglycerate dehydrogenase, regulatory (C-term	99.0
d1y7pa2		77	Hypothetical protein AF1403, N-terminal domain {Ar	98.59
d2f06a1		71	Hypothetical protein BT0572 {Bacteroides thetaiota	98.48
d1u8sa1		86	putative transcriptional repressor VC2159 {Vibrio	98.22
d1zpva1		83	UPF0237 protein SP0238 {Streptococcus pneumoniae [	98.06
d1u8sa2		93	putative transcriptional repressor VC2159 {Vibrio	97.53
d2qmwa2		80	Prephenate dehydratase C-terminal domain {Staphylo	97.06
d1phza1		97	Phenylalanine hydroxylase N-terminal domain {Rat (	96.19
d2hmfa2		67	Aspartokinase {Methanococcus jannaschii [TaxId: 21	94.6
d2hmfa3		100	Aspartokinase {Methanococcus jannaschii [TaxId: 21	93.59
d2cdqa2		91	Aspartokinase {Thale cress (Arabidopsis thaliana)	93.09
d2cdqa3		75	Aspartokinase {Thale cress (Arabidopsis thaliana)	92.38
d1jq5a_		366	Glycerol dehydrogenase {Bacillus stearothermophilu	88.1
d2nzca1		80	Hypothetical protein TM1266 {Thermotoga maritima [	85.61
d2j0wa2		91	Aspartokinase {Escherichia coli [TaxId: 562]}	84.95
d1t4aa_		80	PurS subunit of FGAM synthetase {Bacillus subtilis	82.67
d1vq3a_		86	PurS subunit of FGAM synthetase {Thermotoga mariti	80.29

>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=1.2e-40  Score=301.47  Aligned_cols=128  Identities=31%  Similarity=0.331  Sum_probs=121.3

Q ss_pred             CeEEecccCcCCHHHHHHHHHHHHHcCCcee-eEeecC-ch---HHHHHHHHhCCCeEEEEEeCCCCCCCCcCCccccCc
Q 015044          280 TDVIIVLQHPSDYNVMQDAIAILCENDNICC-QVMKSY-TK---KQLITKLSRSGRKVIIATDHGVGAFLDKIDLLASGS  354 (414)
Q Consensus       280 ~~V~IimGS~SD~~v~~~a~~~L~~~gi~~~-~V~SaH-~p---~~~~~~~~~~g~~ViIavA~G~sa~Lp~~gvvAg~T  354 (414)
                      ++|+|||||+||+++|+||.++|++|||+|+ +|.|+| +|   .++++.++++|++||||+| |++||||  ||+||+|
T Consensus         1 PkV~Ii~Gs~SD~~~~~~a~~~L~~~gi~~~~~v~saHr~p~rl~~~~~~~~~~~~~viIa~A-G~aa~Lp--gvvA~~t   77 (169)
T d1o4va_           1 PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVIIAGA-GGAAHLP--GMVASIT   77 (169)
T ss_dssp             CEEEEEESCGGGHHHHHHHHHHHHHTTCEEEEEECCTTTCHHHHHHHHHHTTTTTCCEEEEEE-ESSCCHH--HHHHHHC
T ss_pred             CeEEEEECcHhhHHHHHHHHHHHHHcCCcEEEEEeeeecCHHHHHHHHHHHHhcCCeEEEEee-cCCcCch--HHHHHhc
Confidence            4899999999999999999999999999999 999999 88   6666677778999999999 9999999  9999999


Q ss_pred             c--EEEecCcCCCCCCcceee--ccCCCCCeEEEEecCCcchHHHHHHHHHhccCCCccc
Q 015044          355 P--VIGVPVRASGVTGFPHQF--VEMCPKHAILLVPVNDAKGAARQAMIICDMVHPGGRT  410 (414)
Q Consensus       355 ~--VIgVP~~~~~l~G~daLl--vqMP~GvpVatV~Id~~~nAA~~A~~IL~~~~~~~~~  410 (414)
                      +  |||||++++.++|+|+||  +|||+|+||+||+|||++|||++|+|||+++|++++.
T Consensus        78 ~~PVIgvP~~~~~~~G~daLlS~lqmp~gvpVatV~Id~~~nAA~~A~~Il~l~d~~i~~  137 (169)
T d1o4va_          78 HLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKNAGILAASILGIKYPEIAR  137 (169)
T ss_dssp             SSCEEEEEECCTTTTTHHHHHHHHTCCTTCCCEECCTTCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             ceeEEecccccccCccHHHHHHhccCCccCCceeeecCchHHHHHHHHHHHhCCCHHHHH
Confidence            9  999999998999999999  9999999999999999999999999999999998764

PyMOL of d1o4va_

>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}	Back information, alignment and structure

>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2nzca1 d.58.18.14 (A:2-81) Hypothetical protein TM1266 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t4aa_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1vq3a_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure