Citrus Sinensis ID: 015084
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| 255552313 | 577 | kinase associated protein phosphatase, p | 0.917 | 0.656 | 0.704 | 1e-155 | |
| 225432578 | 584 | PREDICTED: protein phosphatase 2C 70 [Vi | 0.973 | 0.688 | 0.677 | 1e-151 | |
| 147790066 | 574 | hypothetical protein VITISV_012193 [Viti | 0.973 | 0.700 | 0.679 | 1e-151 | |
| 224111242 | 582 | predicted protein [Populus trichocarpa] | 0.920 | 0.652 | 0.680 | 1e-144 | |
| 169409940 | 576 | kinase-associated protein phosphatase 1 | 0.900 | 0.645 | 0.658 | 1e-139 | |
| 351722787 | 576 | kinase-associated protein phosphatase 1 | 0.900 | 0.645 | 0.655 | 1e-138 | |
| 148923087 | 597 | kinase-associated protein phosphatase 1 | 0.920 | 0.636 | 0.606 | 1e-134 | |
| 169409938 | 591 | kinase-associated protein phosphatase [L | 0.903 | 0.631 | 0.608 | 1e-129 | |
| 351723269 | 578 | kinase-associated protein phosphatase 2 | 0.905 | 0.647 | 0.628 | 1e-129 | |
| 449481064 | 580 | PREDICTED: protein phosphatase 2C 70-lik | 0.905 | 0.644 | 0.617 | 1e-129 |
| >gi|255552313|ref|XP_002517201.1| kinase associated protein phosphatase, putative [Ricinus communis] gi|223543836|gb|EEF45364.1| kinase associated protein phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 553 bits (1426), Expect = e-155, Method: Compositional matrix adjust.
Identities = 272/386 (70%), Positives = 319/386 (82%), Gaps = 7/386 (1%)
Query: 25 IACKPWRFFFPSYRSRSIIKSGELERPLVSDDEALVRDQSNDLTRNYDLEGACYQNEGLW 84
+ACKPWRFFF S SR + K GELERPL+SDD +SNDLTRNYDLEGACYQNEG
Sbjct: 23 VACKPWRFFFSSSPSRPL-KVGELERPLISDDV-----ESNDLTRNYDLEGACYQNEGPL 76
Query: 85 RSPRAQGLVHKQRLSSASPHATHGDSVVLDVISDASEDLSVGQTLKRPLMKDHLAEVQKY 144
R R GLVHKQRL SASPH GDS++LDV+S+ +ED+SVGQTLKR + +HLAEVQ++
Sbjct: 77 RLFRPHGLVHKQRLPSASPHLNQGDSLILDVVSEPAEDISVGQTLKRTSLTNHLAEVQQH 136
Query: 145 GGQEDQSPNLKLGLGIDRFPEFLPKAIADQRSCLSLEVVSGPSRGIRCSVQSANASRLPL 204
GQ DQSP L+ L D EF+P IADQRSCLSLEV+SGPSRG+RCS++S +ASRLPL
Sbjct: 137 AGQTDQSPVLRSDLENDVVREFVPCVIADQRSCLSLEVISGPSRGLRCSIKSTSASRLPL 196
Query: 205 TLGRVSPSDVLLKDSEVSGKHALINWNPNKLKWELVDMGSLNGTLLNSQPINHPDSGSRH 264
TLGRVS SD+LLKDSEVSGKHA+INWN +K KWELVDMGSLNGTLLNSQPINH DSGSR
Sbjct: 197 TLGRVS-SDLLLKDSEVSGKHAMINWNMDKKKWELVDMGSLNGTLLNSQPINHHDSGSRQ 255
Query: 265 WGKPMELTSGDIITLGTTSSIHVQITSETVSQIPFGVGVASDPMALRRGAKKLPMEDVCY 324
WG ++L++GDIITLGTTS+I V +T + ++ PFGVG+ASDPMALRRG KKL MEDVCY
Sbjct: 256 WGDAVDLSNGDIITLGTTSNIRVHVTLKAENETPFGVGMASDPMALRRGGKKLAMEDVCY 315
Query: 325 YHWPLPGVDKFGLFGICDGHGGSAAAKSASEILPKMVAAILSDSLKRERLLSQCDASDVL 384
YHWPLPG+D+FG+FGICDGHGG AAA SAS++LP+ VA ILSDSL RER+LSQCDAS+VL
Sbjct: 316 YHWPLPGIDQFGVFGICDGHGGVAAANSASKMLPEKVARILSDSLTRERVLSQCDASEVL 375
Query: 385 RDAFFQTEASMNHHYEVLFHTRFLLF 410
+ AF QTEASMN++YE T L++
Sbjct: 376 KVAFSQTEASMNNYYEGCTATVLLVW 401
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225432578|ref|XP_002281192.1| PREDICTED: protein phosphatase 2C 70 [Vitis vinifera] gi|297737010|emb|CBI26211.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147790066|emb|CAN75988.1| hypothetical protein VITISV_012193 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224111242|ref|XP_002315790.1| predicted protein [Populus trichocarpa] gi|222864830|gb|EEF01961.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|169409940|gb|ACA57836.1| kinase-associated protein phosphatase 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351722787|ref|NP_001237000.1| kinase-associated protein phosphatase 1 [Glycine max] gi|169409934|gb|ACA57833.1| kinase-associated protein phosphatase 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|148923087|gb|ABR18801.1| kinase-associated protein phosphatase 1 [Solanum peruvianum] | Back alignment and taxonomy information |
|---|
| >gi|169409938|gb|ACA57835.1| kinase-associated protein phosphatase [Lotus japonicus] gi|169409944|gb|ACA57838.1| kinase-associated protein phosphatase [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|351723269|ref|NP_001237017.1| kinase-associated protein phosphatase 2 [Glycine max] gi|169409936|gb|ACA57834.1| kinase-associated protein phosphatase 2 [Glycine max] gi|169409942|gb|ACA57837.1| kinase-associated protein phosphatase 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449481064|ref|XP_004156071.1| PREDICTED: protein phosphatase 2C 70-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| TAIR|locus:2150220 | 591 | KAPP "kinase associated protei | 0.907 | 0.634 | 0.572 | 1.5e-113 | |
| UNIPROTKB|O49973 | 583 | KAPP "FHA transcription factor | 0.866 | 0.614 | 0.445 | 3.2e-72 | |
| TAIR|locus:2074557 | 585 | AT3G02400 [Arabidopsis thalian | 0.302 | 0.213 | 0.328 | 5.2e-05 | |
| TAIR|locus:2129785 | 386 | AT4G14490 [Arabidopsis thalian | 0.232 | 0.248 | 0.333 | 0.00075 | |
| UNIPROTKB|P64897 | 162 | garA "Glycogen accumulation re | 0.169 | 0.432 | 0.376 | 0.00075 |
| TAIR|locus:2150220 KAPP "kinase associated protein phosphatase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1120 (399.3 bits), Expect = 1.5e-113, P = 1.5e-113
Identities = 217/379 (57%), Positives = 281/379 (74%)
Query: 26 ACKPWRFF--F-PSYRSRSIIKSGELERPLVSDDEALVRDQSNDLTRNYDLEGACYQNEG 82
ACKPWR+F F S R S K G+L+RPL+SDD L++ Q++++TR YDLEGACYQN+G
Sbjct: 27 ACKPWRYFSRFRSSSRFSSTFKVGDLQRPLISDDGNLIQGQTSEVTREYDLEGACYQNDG 86
Query: 83 LWRSPRAQGLVHKQRLSSASPHATHGDSVVLDVISDASEDLSVGQTLKRPLMKDHLAEVQ 142
L S +G +KQRL S+SPH + G+S VL+VIS+ S++ VGQTLK P K LAEVQ
Sbjct: 87 LLHSSLTEGRFYKQRLPSSSPHFSQGESFVLEVISEPSDNALVGQTLKLPAEKGSLAEVQ 146
Query: 143 KYGGQEDQSPNLKLGLGIDRFPEFLPKAIADQRSCLSLEVVSGPSRGIRCSVQSANASRL 202
Y Q +++ NL+ L DR P+ + DQRS L LEV++GP+ G++ +V S ++S+L
Sbjct: 147 TYDWQNNRNENLQYNLEKDRLINLSPRLVEDQRSWLFLEVIAGPAIGLQHAVNSTSSSKL 206
Query: 203 PLTLGRVSPSDVLLKDSEVSGKHALINWNPNKLKWELVDMGSLNGTLLNSQPINHPDSGS 262
P+ LGRVSPSD+ LKDSEVSGKHA I WN K KWELVDMGSLNGTL+NS I+HPD GS
Sbjct: 207 PVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGS 266
Query: 263 RHWGKPMELTSGDIITLGTTSSIHVQITSETVSQIPFGVGVASDPMALRRGAKKLPMEDV 322
R WG P+EL S DIITLGTT+ ++V+I+S+ QIPF +GVASDPMA+RRG +KLPMEDV
Sbjct: 267 RKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMAMRRGGRKLPMEDV 326
Query: 323 CYYHWPLPGVDKFGLFGICDXXXXXXXXXXXXEILPKMVAAILSDSLKRERLLSQCDASD 382
C+Y WPLPG +KFGLF +CD +I+P+++A ILSDSL++E++LS+ DASD
Sbjct: 327 CHYKWPLPGANKFGLFCVCDGHGGSGAAQSAIKIIPEVLANILSDSLRKEKVLSKRDASD 386
Query: 383 VLRDAFFQTEASMNHH-YE 400
VLRD F +TEA + H YE
Sbjct: 387 VLRDMFAKTEARLEEHQYE 405
|
|
| UNIPROTKB|O49973 KAPP "FHA transcription factor" [Zea mays (taxid:4577)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074557 AT3G02400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129785 AT4G14490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P64897 garA "Glycogen accumulation regulator GarA" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| pfam00498 | 67 | pfam00498, FHA, FHA domain | 7e-16 | |
| cd00060 | 102 | cd00060, FHA, Forkhead associated domain (FHA); fo | 5e-15 | |
| cd00143 | 254 | cd00143, PP2Cc, Serine/threonine phosphatases, fam | 1e-12 | |
| COG1716 | 191 | COG1716, COG1716, FOG: FHA domain [Signal transduc | 2e-10 | |
| smart00332 | 252 | smart00332, PP2Cc, Serine/threonine phosphatases, | 4e-10 | |
| smart00240 | 52 | smart00240, FHA, Forkhead associated domain | 4e-08 | |
| pfam00481 | 252 | pfam00481, PP2C, Protein phosphatase 2C | 7e-07 | |
| COG0631 | 262 | COG0631, PTC1, Serine/threonine protein phosphatas | 5e-05 |
| >gnl|CDD|215951 pfam00498, FHA, FHA domain | Back alignment and domain information |
|---|
Score = 71.5 bits (176), Expect = 7e-16
Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 10/77 (12%)
Query: 204 LTLGRVSPSDVLLKDSEVSGKHALINWNPNKLKWELVDMGSLNGTLLNSQPINHPDSGSR 263
+T+GR D++L D VS +HA I ++ ++ L D+GS NGT +N Q +
Sbjct: 1 VTIGRSPDCDIVLDDPSVSRRHAEIRYDGG-GRFYLEDLGSTNGTFVNGQRLGP------ 53
Query: 264 HWGKPMELTSGDIITLG 280
+P+ L GD+I LG
Sbjct: 54 ---EPVRLRDGDVIRLG 67
|
The FHA (Forkhead-associated) domain is a phosphopeptide binding motif. Length = 67 |
| >gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238083 cd00143, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity | Back alignment and domain information |
|---|
| >gnl|CDD|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214625 smart00332, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214578 smart00240, FHA, Forkhead associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|215938 pfam00481, PP2C, Protein phosphatase 2C | Back alignment and domain information |
|---|
| >gnl|CDD|223704 COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 99.7 | |
| KOG0697 | 379 | consensus Protein phosphatase 1B (formerly 2C) [Si | 99.67 | |
| KOG0698 | 330 | consensus Serine/threonine protein phosphatase [Si | 99.54 | |
| PLN03145 | 365 | Protein phosphatase 2c; Provisional | 99.52 | |
| cd00060 | 102 | FHA Forkhead associated domain (FHA); found in euk | 99.5 | |
| PF00481 | 254 | PP2C: Protein phosphatase 2C; InterPro: IPR001932 | 99.44 | |
| TIGR03354 | 396 | VI_FHA type VI secretion system FHA domain protein | 99.43 | |
| KOG0699 | 542 | consensus Serine/threonine protein phosphatase [Si | 99.41 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 99.4 | |
| PTZ00224 | 381 | protein phosphatase 2C; Provisional | 99.31 | |
| COG1716 | 191 | FOG: FHA domain [Signal transduction mechanisms] | 99.29 | |
| KOG1881 | 793 | consensus Anion exchanger adaptor protein Kanadapt | 99.29 | |
| smart00240 | 52 | FHA Forkhead associated domain. Found in eukaryoti | 99.21 | |
| KOG0700 | 390 | consensus Protein phosphatase 2C/pyruvate dehydrog | 99.06 | |
| COG3456 | 430 | Predicted component of the type VI protein secreti | 99.05 | |
| KOG1882 | 293 | consensus Transcriptional regulator SNIP1, contain | 98.92 | |
| COG0631 | 262 | PTC1 Serine/threonine protein phosphatase [Signal | 98.88 | |
| KOG1323 | 493 | consensus Serine/threonine phosphatase [Signal tra | 98.84 | |
| cd00143 | 254 | PP2Cc Serine/threonine phosphatases, family 2C, ca | 98.77 | |
| smart00332 | 255 | PP2Cc Serine/threonine phosphatases, family 2C, ca | 98.65 | |
| KOG1880 | 337 | consensus Nuclear inhibitor of phosphatase-1 [Gene | 98.56 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 98.54 | |
| TIGR02500 | 410 | type_III_yscD type III secretion apparatus protein | 98.21 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 97.78 | |
| KOG2293 | 547 | consensus Daxx-interacting protein MSP58/p78, cont | 96.81 | |
| KOG0245 | 1221 | consensus Kinesin-like protein [Cytoskeleton] | 96.54 | |
| smart00331 | 193 | PP2C_SIG Sigma factor PP2C-like phosphatases. | 96.18 | |
| PF13672 | 212 | PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A | 96.14 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 94.87 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 94.51 | |
| KOG1379 | 330 | consensus Serine/threonine protein phosphatase [Si | 89.81 | |
| PRK15367 | 395 | type III secretion system protein SsaD; Provisiona | 88.78 | |
| PF15102 | 146 | TMEM154: TMEM154 protein family | 85.05 | |
| KOG0241 | 1714 | consensus Kinesin-like protein [Cytoskeleton] | 83.44 |
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
Probab=99.70 E-value=6e-17 Score=125.59 Aligned_cols=68 Identities=38% Similarity=0.728 Sum_probs=62.5
Q ss_pred EEeCCCCCCCeEeCCcccccceeEEEEeCCcceEEEEEcCCCCceeeCCeecCCCCCCCCCCCCceecCCCCEEEEc
Q 015084 204 LTLGRVSPSDVLLKDSEVSGKHALINWNPNKLKWELVDMGSLNGTLLNSQPINHPDSGSRHWGKPMELTSGDIITLG 280 (413)
Q Consensus 204 ~~IGR~~~~divl~d~~VSr~HA~I~~~~~~~~~~L~DlgStNGT~VNg~~i~~~~~~~r~~g~~~~L~~GD~I~lG 280 (413)
++|||++.||++++++.||+.||.|.++.+ +.|+|+|++|+|||||||+++.+ ++++.|++||+|+||
T Consensus 1 ~~iGR~~~~di~l~~~~iSr~Ha~i~~~~~-~~~~i~d~~s~ngt~vng~~l~~--------~~~~~L~~gd~i~~G 68 (68)
T PF00498_consen 1 VTIGRSPDCDIVLPDPSISRRHARISFDDD-GQFYIEDLGSTNGTFVNGQRLGP--------GEPVPLKDGDIIRFG 68 (68)
T ss_dssp EEEESSTTSSEEETSTTSSTTSEEEEEETT-EEEEEEESSSSS-EEETTEEESS--------TSEEEE-TTEEEEET
T ss_pred CEEcCCCCCCEEECCHheeeeeeEEEEece-eeEEEEeCCCCCcEEECCEEcCC--------CCEEECCCCCEEEcC
Confidence 589999999999999999999999999997 57999999999999999999997 678999999999998
|
It displays specificity for phosphothreonine-containing epitopes but will also recognise phosphotyrosine with relatively high affinity. It spans approximately 80-100 amino acid residues folded into an 11-stranded beta sandwich, which sometimes contain small helical insertions between the loops connecting the strands []. To date, genes encoding FHA-containing proteins have been identified in eubacterial and eukaryotic but not archaeal genomes. The domain is present in a diverse range of proteins, such as kinases, phosphatases, kinesins, transcription factors, RNA-binding proteins and metabolic enzymes which partake in many different cellular processes - DNA repair, signal transduction, vesicular transport and protein degradation are just a few examples.; GO: 0005515 protein binding; PDB: 1LGQ_B 1LGP_A 2CSW_A 2PIE_A 3FM8_A 3MDB_B 3GQS_B 1UHT_A 1WLN_A 3POA_A .... |
| >KOG0697 consensus Protein phosphatase 1B (formerly 2C) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0698 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03145 Protein phosphatase 2c; Provisional | Back alignment and domain information |
|---|
| >cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF00481 PP2C: Protein phosphatase 2C; InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg | Back alignment and domain information |
|---|
| >TIGR03354 VI_FHA type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >KOG0699 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PTZ00224 protein phosphatase 2C; Provisional | Back alignment and domain information |
|---|
| >COG1716 FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00240 FHA Forkhead associated domain | Back alignment and domain information |
|---|
| >KOG0700 consensus Protein phosphatase 2C/pyruvate dehydrogenase (lipoamide) phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0631 PTC1 Serine/threonine protein phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1323 consensus Serine/threonine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00143 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity | Back alignment and domain information |
|---|
| >smart00332 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain | Back alignment and domain information |
|---|
| >KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0245 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00331 PP2C_SIG Sigma factor PP2C-like phosphatases | Back alignment and domain information |
|---|
| >PF13672 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 2V06_A 2JFR_A 2J86_A 2J82_A 2Y09_A 2XZV_A 2CM1_A 1TXO_B | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1379 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15367 type III secretion system protein SsaD; Provisional | Back alignment and domain information |
|---|
| >PF15102 TMEM154: TMEM154 protein family | Back alignment and domain information |
|---|
| >KOG0241 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 413 | ||||
| 1mzk_A | 139 | Nmr Structure Of Kinase-Interacting Fha Domain Of K | 2e-46 | ||
| 2kb3_A | 143 | Nmr Structure Of The Phosphorylated Form Of Odhi, P | 2e-05 | ||
| 2kb4_A | 143 | Nmr Structure Of The Unphosphorylated Form Of Odhi, | 2e-05 | ||
| 2kkl_A | 140 | Solution Nmr Structure Of Fha Domain Of Mb1858 From | 1e-04 | ||
| 1uht_A | 118 | Solution Structure Of The Fha Domain Of Arabidopsis | 1e-04 | ||
| 2kfu_A | 162 | Pknb-Phosphorylated Rv1827 Length = 162 | 2e-04 |
| >pdb|2KB3|A Chain A, Nmr Structure Of The Phosphorylated Form Of Odhi, Podhi Length = 143 | Back alignment and structure |
| >pdb|2KB4|A Chain A, Nmr Structure Of The Unphosphorylated Form Of Odhi, Odhi Length = 143 | Back alignment and structure |
| >pdb|2KKL|A Chain A, Solution Nmr Structure Of Fha Domain Of Mb1858 From Mycobacterium Bovis. Northeast Structural Genomics Consortium Target Mbr243c (24-155) Length = 140 | Back alignment and structure |
| >pdb|1UHT|A Chain A, Solution Structure Of The Fha Domain Of Arabidopsis Thaliana Hypothetical Protein Length = 118 | Back alignment and structure |
| >pdb|2KFU|A Chain A, Pknb-Phosphorylated Rv1827 Length = 162 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 2e-46 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 2e-23 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 5e-17 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 9e-17 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 1e-16 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 1e-16 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 7e-16 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 2e-15 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 4e-15 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 9e-15 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 1e-14 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 1e-12 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 3e-12 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 3e-12 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 3e-12 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 3e-12 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 6e-12 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 3e-11 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 4e-10 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 1e-09 | |
| 2i44_A | 324 | Serine-threonine phosphatase 2C; PSI-2, 8817Z, str | 3e-09 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 7e-09 | |
| 1a6q_A | 382 | Phosphatase 2C; catalytic mechanism, metalloenzyme | 8e-09 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 1e-08 | |
| 2iq1_A | 274 | Protein phosphatase 2C kappa, PPM1K; structural ge | 1e-08 | |
| 2j4o_A | 401 | Mitogen-activated protein kinase kinase kinase 7-i | 4e-08 | |
| 2p8e_A | 307 | PPM1B beta isoform variant 6; structural genomics, | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 2e-07 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 3e-07 | |
| 2i0o_A | 304 | Ser/Thr phosphatase; beta sandwich, structural gen | 4e-07 | |
| 2irm_A | 358 | Mitogen-activated protein kinase kinase kinase 7 i | 7e-07 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 1e-06 | |
| 3kdj_B | 316 | Protein phosphatase 2C 56; ABA, PYL1, abscisic aci | 3e-06 | |
| 3qn1_B | 337 | Protein phosphatase 2C 16; start domain, BET V dom | 7e-06 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 1e-05 | |
| 2isn_A | 364 | NYSGXRC-8828Z, phosphatase; pathogenic strain, pra | 2e-05 | |
| 3d8k_A | 377 | PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR | 1e-04 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 2e-04 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-04 | |
| 2g1l_A | 104 | Kinesin-like protein KIF1C; transport, FHA domain, | 6e-04 |
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145 | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 | Back alignment and structure |
|---|
| >2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Length = 324 | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 | Back alignment and structure |
|---|
| >1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Length = 382 | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Length = 389 | Back alignment and structure |
|---|
| >2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Length = 401 | Back alignment and structure |
|---|
| >2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Length = 158 | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182 | Back alignment and structure |
|---|
| >2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Length = 304 | Back alignment and structure |
|---|
| >2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Length = 358 | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 | Back alignment and structure |
|---|
| >3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Length = 316 | Back alignment and structure |
|---|
| >3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3ujg_B 3nmt_B* 3rt0_A 3kb3_B* Length = 337 | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 | Back alignment and structure |
|---|
| >2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Length = 364 | Back alignment and structure |
|---|
| >3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Length = 377 | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Length = 325 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >2g1l_A Kinesin-like protein KIF1C; transport, FHA domain, structural genomics consortium, kines transport protein; 2.60A {Homo sapiens} SCOP: b.26.1.2 Length = 104 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 99.92 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 99.88 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 99.85 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 99.83 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 99.83 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 99.82 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 99.81 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 99.81 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 99.8 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 99.79 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 99.79 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 99.77 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 99.75 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 99.74 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.74 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 99.73 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 99.73 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 99.73 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.71 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 99.71 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 99.71 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 99.7 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 99.69 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 99.69 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 99.68 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 99.61 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 99.52 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 99.51 | |
| 4a0e_A | 123 | YSCD, type III secretion protein; transport protei | 99.46 | |
| 2isn_A | 364 | NYSGXRC-8828Z, phosphatase; pathogenic strain, pra | 99.44 | |
| 3qn1_B | 337 | Protein phosphatase 2C 16; start domain, BET V dom | 99.42 | |
| 3kdj_B | 316 | Protein phosphatase 2C 56; ABA, PYL1, abscisic aci | 99.41 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 99.36 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 99.36 | |
| 2i0o_A | 304 | Ser/Thr phosphatase; beta sandwich, structural gen | 99.34 | |
| 2irm_A | 358 | Mitogen-activated protein kinase kinase kinase 7 i | 99.33 | |
| 2pnq_A | 467 | [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 | 99.31 | |
| 2p8e_A | 307 | PPM1B beta isoform variant 6; structural genomics, | 99.3 | |
| 3d8k_A | 377 | PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR | 99.3 | |
| 2i44_A | 324 | Serine-threonine phosphatase 2C; PSI-2, 8817Z, str | 99.29 | |
| 2j4o_A | 401 | Mitogen-activated protein kinase kinase kinase 7-i | 99.27 | |
| 2iq1_A | 274 | Protein phosphatase 2C kappa, PPM1K; structural ge | 99.26 | |
| 1a6q_A | 382 | Phosphatase 2C; catalytic mechanism, metalloenzyme | 99.25 | |
| 3kt9_A | 102 | Aprataxin; FHA domain, beta sandwich, beta sheet, | 99.19 | |
| 3uv0_A | 102 | Mutator 2, isoform B; FHA, protein binding, dimeri | 99.19 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.12 | |
| 2brf_A | 110 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.06 | |
| 1txo_A | 237 | Putative bacterial enzyme; serine/threonine protei | 99.04 | |
| 2pk0_A | 250 | Serine/threonine protein phosphatase STP1; SI moti | 98.97 | |
| 2j82_A | 240 | TPPHA, protein serine-threonine phosphatase; PP2C | 98.92 | |
| 1yj5_C | 143 | 5' polynucleotide kinase-3' phosphatase FHA domai; | 98.87 | |
| 1ujx_A | 119 | Polynucleotide kinase 3'-phosphatase; DNA repair, | 98.82 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 98.81 | |
| 2jfr_A | 234 | Ser-Thr phosphatase MSPP; hydrolase, PPM phosphata | 98.72 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 98.69 | |
| 3rnr_A | 211 | Stage II sporulation E family protein; structural | 98.13 |
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A | Back alignment and structure |
|---|
| >2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3zvu_B* 3ujg_B 3nmt_B* 4ds8_B* 3rt0_A 3kb3_B* | Back alignment and structure |
|---|
| >3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A | Back alignment and structure |
|---|
| >2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A | Back alignment and structure |
|---|
| >2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A | Back alignment and structure |
|---|
| >3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 | Back alignment and structure |
|---|
| >3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* | Back alignment and structure |
|---|
| >1txo_A Putative bacterial enzyme; serine/threonine protein phosphatases, PSTP/PPP, structural genomics, PSI, protein structure initiative; 1.95A {Mycobacterium tuberculosis} SCOP: d.219.1.1 PDB: 2cm1_A | Back alignment and structure |
|---|
| >2pk0_A Serine/threonine protein phosphatase STP1; SI motif, signaling protein; 2.65A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2j82_A TPPHA, protein serine-threonine phosphatase; PP2C family phosphatase, hydrolase; 1.28A {Synechococcus elongatus} PDB: 2j86_A 2y09_A 2xzv_A | Back alignment and structure |
|---|
| >1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2jfr_A Ser-Thr phosphatase MSPP; hydrolase, PPM phosphatase, manganese, phosphate; 0.83A {Mycobacterium smegmatis} PDB: 2jfs_A 2jft_A 2v06_A | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
| >3rnr_A Stage II sporulation E family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.00A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 413 | ||||
| d1mzka_ | 122 | b.26.1.2 (A:) Kinase associated protein phosphatas | 1e-32 | |
| d1uhta_ | 118 | b.26.1.2 (A:) FHA domain containing protein At4G14 | 9e-16 | |
| d2ff4a3 | 99 | b.26.1.2 (A:284-382) Probable regulatory protein E | 2e-09 | |
| d1dmza_ | 158 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 5e-09 | |
| d1a6qa2 | 295 | d.219.1.1 (A:2-296) Protein serine/threonine phosp | 1e-08 | |
| d2affa1 | 98 | b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi | 4e-08 | |
| d1g6ga_ | 127 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 1e-06 | |
| d2g1la1 | 102 | b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H | 1e-06 | |
| d1gxca_ | 116 | b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T | 3e-06 | |
| d1wlna1 | 107 | b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T | 4e-06 | |
| d1txoa_ | 235 | d.219.1.1 (A:) putative serine/threonine phosphata | 2e-05 | |
| d1lgpa_ | 113 | b.26.1.2 (A:) Cell cycle checkpoint protein Chfr { | 0.004 |
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: Kinase associated protein phosphatase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 117 bits (294), Expect = 1e-32
Identities = 76/118 (64%), Positives = 96/118 (81%)
Query: 176 SCLSLEVVSGPSRGIRCSVQSANASRLPLTLGRVSPSDVLLKDSEVSGKHALINWNPNKL 235
S L LEV++GP+ G++ +V S ++S+LP+ LGRVSPSD+ LKDSEVSGKHA I WN K
Sbjct: 4 SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKF 63
Query: 236 KWELVDMGSLNGTLLNSQPINHPDSGSRHWGKPMELTSGDIITLGTTSSIHVQITSET 293
KWELVDMGSLNGTL+NS I+HPD GSR WG P+EL S DIITLGTT+ ++V+I+S+
Sbjct: 64 KWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQN 121
|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 | Back information, alignment and structure |
|---|
| >d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 295 | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Length = 235 | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| d1mzka_ | 122 | Kinase associated protein phosphatase {Thale cress | 99.9 | |
| d1uhta_ | 118 | FHA domain containing protein At4G14490 {Thale cre | 99.85 | |
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 99.8 | |
| d2affa1 | 98 | Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 99.68 | |
| d1dmza_ | 158 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.67 | |
| d2piea1 | 127 | Ubiquitin ligase protein RNF8 {Human (Homo sapiens | 99.65 | |
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d2brfa1 | 101 | Polynucleotide kinase 3'-phosphatase {Human (Homo | 99.64 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.62 | |
| d1a6qa2 | 295 | Protein serine/threonine phosphatase 2C, catalytic | 99.6 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 99.53 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 99.52 | |
| d1txoa_ | 235 | putative serine/threonine phosphatase pstp/ppp {My | 99.12 |
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: Kinase associated protein phosphatase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.90 E-value=9.3e-24 Score=180.21 Aligned_cols=118 Identities=64% Similarity=1.056 Sum_probs=106.5
Q ss_pred ceEEEEEEeCCCCCeEEEeccCCCCCCcEEeCCCCCCCeEeCCcccccceeEEEEeCCcceEEEEEcCCCCceeeCCeec
Q 015084 176 SCLSLEVVSGPSRGIRCSVQSANASRLPLTLGRVSPSDVLLKDSEVSGKHALINWNPNKLKWELVDMGSLNGTLLNSQPI 255 (413)
Q Consensus 176 ~~~~L~vi~G~~~g~~~~L~~~~~~~~~~~IGR~~~~divl~d~~VSr~HA~I~~~~~~~~~~L~DlgStNGT~VNg~~i 255 (413)
+++.|+|++||..|..+.+......+.+++|||.+.||++|+|+.||+.||+|.++.+++.|+|+|++|+|||||||+++
T Consensus 4 ~~l~L~vi~Gp~~g~~~~l~~~~~~~~~~~IGR~~~~di~l~d~~vSr~Ha~i~~~~~~~~~~v~DlgS~nGT~vNg~~i 83 (122)
T d1mzka_ 4 SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSI 83 (122)
T ss_dssp EEEEEEECSSTTCSCEEEECTTCSTTCSEEEESSSSCSEECCCTTSSSEEEEEEEETTTTEEEEEETTCSSCCEETTEES
T ss_pred ceEEEEEEECCCCCcEEEecCCCCCcCCEEecCCCCCCEEECCCCcCccceEEEEeCCCCEEEEeeCCCCCceEECCEEC
Confidence 58999999999999999998877777789999999999999999999999999998766799999999999999999999
Q ss_pred CCCCCCCCCCCCceecCCCCEEEEcceeEEEEeeeccc
Q 015084 256 NHPDSGSRHWGKPMELTSGDIITLGTTSSIHVQITSET 293 (413)
Q Consensus 256 ~~~~~~~r~~g~~~~L~~GD~I~lG~~~~~~~~~~~~~ 293 (413)
.........+|++++|++||+|+||.+++.++.+..++
T Consensus 84 ~~~~~~~~~~g~~~~L~~gd~i~iG~~~~~~v~~~~~~ 121 (122)
T d1mzka_ 84 SHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQN 121 (122)
T ss_dssp SCCCTTTCCCCCCEECCTTEEEECSSSCEEEEEEEECC
T ss_pred cccccccccCCceEEcCCCCEEEECCeEEEEEEEecCC
Confidence 86544555668899999999999999999999887643
|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|