Citrus Sinensis ID: 015110

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MENLNLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMGGNME
ccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEccEEEcccccEEEEEEEEccEEEEEccccccccccccccEEEccccEEcccccccccccccccccccccHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHccccEEEEEEEEEEEcccccccHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHcccccEEEccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccEEccccccHHHHHHHHHHHHcccccEEccccccccHHHHccccccccccccccccHHHHHHHHHHHHHccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEccEEEcccccEEEEEEEEccEEEEEcccccccccccccEEEEcccEEEEcccccccccccccccccccccccHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHccccEEEEEEEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccccEEEEcHHHcccccccEEcccccccHccHHHHHHHHHcccEEEEEcccccccHHHHHcccccccccccccccHHHcccEEEEcccccccccc
menlnlqwRLLPTLTLLAASLFLLVFKdsaklshsecsllpynqywltskrivtpkgvisgaveikegniisivseedwprnsktgqvvdygeavimpglidvhahlddpgrtewegfpsgtkaaaaggittlidmplnsdpstisteTLKLKVDAAEKRIYVdvgfwgglvpenaYNASALEALLNAGVLglksfmcpsgindfpmtnasHIKEGLSVLARYKRPLLVHaemekgserhvkleddtldtrsystylktrppsweEAAIRELLTVAKdtrtdgpaegaHLHIVHLSDASSSLDLLMEAktngdsitvetcphylafsaeeipdgdtrfkcappirdAANKEKLWEALMDGHIdmlssdhsptvpelklldegnflkawggiSSLQIFCSLFFLsrglmggnme
MENLNLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIIsivseedwprnsKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHaemekgserhvkleddtldtrsystylktrppsweeaAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSaeeipdgdtRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRglmggnme
MENlnlqwrllptltllaaslfllVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSgtkaaaaggittLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHlsdasssldllMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMGGNME
****NLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPL******ISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHA***********************TYL******WEEAAIRELLTVAK*********GAHLHIVHLSDA**SLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDML******TVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGL******
**NLNLQWRLLPTLTLLAASLFLLVFKD************PYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSER***********RSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMGG***
MENLNLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMGGNME
*ENLNLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENLNLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMGGNME
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query413 2.2.26 [Sep-21-2011]
P32375460 Allantoinase OS=Saccharom yes no 0.721 0.647 0.449 2e-73
Q9RKU5445 Allantoinase OS=Streptomy yes no 0.820 0.761 0.429 7e-72
P40757 484 Allantoinase, mitochondri N/A no 0.840 0.716 0.425 1e-71
Q82LL4445 Allantoinase OS=Streptomy yes no 0.835 0.775 0.421 1e-71
Q54SV3 649 Probable allantoinase 1 O yes no 0.815 0.519 0.404 2e-70
Q55C91510 Probable allantoinase 2 O no no 0.837 0.678 0.388 4e-63
Q9RV76448 Allantoinase OS=Deinococc yes no 0.789 0.727 0.383 1e-62
Q5WBJ6448 Allantoinase OS=Bacillus yes no 0.808 0.745 0.377 4e-60
Q9KAH8438 Allantoinase OS=Bacillus yes no 0.762 0.719 0.391 3e-58
Q57S43453 Allantoinase OS=Salmonell yes no 0.762 0.695 0.372 6e-58
>sp|P32375|ALN_YEAST Allantoinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL1 PE=3 SV=2 Back     alignment and function desciption
 Score =  276 bits (706), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 200/309 (64%), Gaps = 11/309 (3%)

Query: 94  AVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLK 153
             I+PGL+D H HL++PGRT WEGF +GT+AA +GG+TT++DMPLN+ P T + E  ++K
Sbjct: 60  CTILPGLVDSHVHLNEPGRTSWEGFETGTQAAISGGVTTVVDMPLNAIPPTTNVENFRIK 119

Query: 154 VDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHI 213
           ++AAE +++ DVGFWGGLVP   +N   L  L+ AGV G K F+  SG+ +FP     +I
Sbjct: 120 LEAAEGQMWCDVGFWGGLVP---HNLPDLIPLVKAGVRGFKGFLLDSGVEEFPPIGKEYI 176

Query: 214 KEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELL 273
           +E L VLA     ++ HAE+ K  E   + E      R YS++L +RP S+E  AI  +L
Sbjct: 177 EEALKVLAEEDTMMMFHAELPKAHEDQQQPEQ---SHREYSSFLSSRPDSFEIDAINLIL 233

Query: 274 TVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPD 333
              +    +GP     +HIVHL+ +  ++ L+ +A+ +G  +T ETC HYL  +AE+IPD
Sbjct: 234 ECLR--ARNGPV--PPVHIVHLA-SMKAIPLIRKARASGLPVTTETCFHYLCIAAEQIPD 288

Query: 334 GDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISS 393
           G T FKC PPIR  +N++ LW+AL +G I  + SDHSP  PELK L +G+F  +WGGI+S
Sbjct: 289 GATYFKCCPPIRSESNRQGLWDALREGVIGSVVSDHSPCTPELKNLQKGDFFDSWGGIAS 348

Query: 394 LQIFCSLFF 402
           + +   L F
Sbjct: 349 VGLGLPLMF 357
Utilization of purines as secondary nitrogen sources, when primary sources are limiting.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 5EC: .EC: 2EC: .EC: 5
>sp|Q9RKU5|ALLB_STRCO Allantoinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=allB PE=3 SV=1 Back     alignment and function description
>sp|P40757|ALN_LITCT Allantoinase, mitochondrial OS=Lithobates catesbeiana GN=ALN PE=1 SV=1 Back     alignment and function description
>sp|Q82LL4|ALLB_STRAW Allantoinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=allB PE=3 SV=1 Back     alignment and function description
>sp|Q54SV3|ALN1_DICDI Probable allantoinase 1 OS=Dictyostelium discoideum GN=allB1 PE=3 SV=1 Back     alignment and function description
>sp|Q55C91|ALN2_DICDI Probable allantoinase 2 OS=Dictyostelium discoideum GN=allB2 PE=3 SV=1 Back     alignment and function description
>sp|Q9RV76|ALLB_DEIRA Allantoinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=allB PE=3 SV=1 Back     alignment and function description
>sp|Q5WBJ6|ALLB_BACSK Allantoinase OS=Bacillus clausii (strain KSM-K16) GN=allB PE=3 SV=1 Back     alignment and function description
>sp|Q9KAH8|ALLB_BACHD Allantoinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=allB PE=1 SV=1 Back     alignment and function description
>sp|Q57S43|ALLB_SALCH Allantoinase OS=Salmonella choleraesuis (strain SC-B67) GN=allB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
255556025500 allantoinase, putative [Ricinus communis 0.937 0.774 0.767 1e-178
224079243504 predicted protein [Populus trichocarpa] 0.905 0.742 0.785 1e-174
21555036506 unknown [Arabidopsis thaliana] 0.910 0.743 0.736 1e-162
18412757506 allantoinase [Arabidopsis thaliana] gi|1 0.910 0.743 0.736 1e-162
449457721503 PREDICTED: allantoinase-like [Cucumis sa 0.949 0.779 0.709 1e-161
39653353512 allantoinase [Robinia pseudoacacia] 0.946 0.763 0.68 1e-161
449508894503 PREDICTED: LOW QUALITY PROTEIN: allantoi 0.949 0.779 0.707 1e-160
356549345512 PREDICTED: probable allantoinase 1-like 0.939 0.757 0.667 1e-160
356555194513 PREDICTED: probable allantoinase 1-like 0.949 0.764 0.667 1e-160
297813881505 hypothetical protein ARALYDRAFT_490140 [ 0.898 0.734 0.740 1e-160
>gi|255556025|ref|XP_002519047.1| allantoinase, putative [Ricinus communis] gi|223541710|gb|EEF43258.1| allantoinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  631 bits (1628), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 301/392 (76%), Positives = 345/392 (88%), Gaps = 5/392 (1%)

Query: 5   NLQWRLLPTLTLLAASLFLLVFKDSAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVE 64
           +L WR+LP L LLA+  +   F  S KL++++CSLLPY+ +W+ SK IVTP+GVISGAVE
Sbjct: 3   HLLWRMLPLLALLASFFY---FFQSQKLTYNDCSLLPYSHFWIISKNIVTPRGVISGAVE 59

Query: 65  IKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKA 124
           +KEGNI+S+V EEDW  N K G ++DYGE V+MPG IDVHAHLDDPGRTEWEGFPSGTKA
Sbjct: 60  VKEGNIVSVVKEEDWHVNFKRGHMIDYGEVVVMPGFIDVHAHLDDPGRTEWEGFPSGTKA 119

Query: 125 AAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEA 184
           AAAGGITTLIDMPLNSDPST+S ETL+LK++AAEK IYVDVGFWGGLVPENA+N S+LEA
Sbjct: 120 AAAGGITTLIDMPLNSDPSTVSVETLRLKLEAAEKNIYVDVGFWGGLVPENAFNGSSLEA 179

Query: 185 LLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLE 244
           LL+AGVLGLKSFMCPSGINDFPMT+A+HIKEGLSVLA+Y+RPLLVHAE+++ SE ++  E
Sbjct: 180 LLSAGVLGLKSFMCPSGINDFPMTDATHIKEGLSVLAKYRRPLLVHAEIQQDSESYI--E 237

Query: 245 DDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDL 304
           D   D R YSTYLKTRP SWEEAAIRELLTV+KDTR  GPAEG+HLHIVHLSD+ SSL L
Sbjct: 238 DGMDDPRHYSTYLKTRPASWEEAAIRELLTVSKDTRIGGPAEGSHLHIVHLSDSGSSLQL 297

Query: 305 LMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDM 364
           L +AK +GDS+TVETCPHYLAFSAEEI DGDTRFKCAPPIRDA NKE LW+AL+ G IDM
Sbjct: 298 LKQAKRSGDSVTVETCPHYLAFSAEEIQDGDTRFKCAPPIRDATNKEALWKALLKGDIDM 357

Query: 365 LSSDHSPTVPELKLLDEGNFLKAWGGISSLQI 396
           LSSDHSPTVPELKLL+EGNFL+AWGGISSLQ 
Sbjct: 358 LSSDHSPTVPELKLLNEGNFLRAWGGISSLQF 389

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224079243|ref|XP_002305806.1| predicted protein [Populus trichocarpa] gi|222848770|gb|EEE86317.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|21555036|gb|AAM63760.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18412757|ref|NP_567276.1| allantoinase [Arabidopsis thaliana] gi|15028089|gb|AAK76575.1| unknown protein [Arabidopsis thaliana] gi|21281139|gb|AAM44996.1| unknown protein [Arabidopsis thaliana] gi|332657048|gb|AEE82448.1| allantoinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449457721|ref|XP_004146596.1| PREDICTED: allantoinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|39653353|gb|AAR29343.1| allantoinase [Robinia pseudoacacia] Back     alignment and taxonomy information
>gi|449508894|ref|XP_004163437.1| PREDICTED: LOW QUALITY PROTEIN: allantoinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356549345|ref|XP_003543054.1| PREDICTED: probable allantoinase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356555194|ref|XP_003545920.1| PREDICTED: probable allantoinase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297813881|ref|XP_002874824.1| hypothetical protein ARALYDRAFT_490140 [Arabidopsis lyrata subsp. lyrata] gi|297320661|gb|EFH51083.1| hypothetical protein ARALYDRAFT_490140 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
TAIR|locus:505006432506 ALN "allantoinase" [Arabidopsi 0.866 0.707 0.700 4.4e-139
TIGR_CMR|CPS_4867473 CPS_4867 "putative allantoinas 0.815 0.712 0.403 4.8e-71
SGD|S000001466460 DAL1 "Allantoinase" [Saccharom 0.796 0.715 0.395 3e-62
ASPGD|ASPL0000076835 506 AN4603 [Emericella nidulans (t 0.709 0.579 0.396 6.1e-62
DICTYBASE|DDB_G0282199 649 allB1 "allantoinase" [Dictyost 0.818 0.520 0.363 6.4e-60
CGD|CAL0005274 586 DAL1 [Candida albicans (taxid: 0.481 0.339 0.360 2.6e-59
UNIPROTKB|Q5A7L5 586 DAL1 "Putative uncharacterized 0.481 0.339 0.360 2.6e-59
ZFIN|ZDB-GENE-041212-22459 zgc:103559 "zgc:103559" [Danio 0.745 0.671 0.404 4e-58
FB|FBgn0030914 492 CG6106 [Drosophila melanogaste 0.738 0.619 0.413 5.1e-58
UNIPROTKB|G4NGA5 550 MGG_10412 "Allantoinase" [Magn 0.728 0.547 0.385 2e-55
TAIR|locus:505006432 ALN "allantoinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1361 (484.2 bits), Expect = 4.4e-139, P = 4.4e-139
 Identities = 255/364 (70%), Positives = 302/364 (82%)

Query:    34 HSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTG-QVVDYG 92
             +++CSLLP++ YW++SKRIVTP G+ISG+VE+K G I+S+V E DW ++ ++  +V+DYG
Sbjct:    34 NNKCSLLPHDHYWISSKRIVTPNGLISGSVEVKGGIIVSVVKEVDWHKSQRSRVKVIDYG 93

Query:    93 EAVIMPGLIDVHAHLDDPGRTEWEGFPSXXXXXXXXXXXXLIDMPLNSDPSTISTETLKL 152
             EAV+MPGLIDVH HLDDPGR+EWEGFPS            L+DMPLNS PST+S ETLKL
Sbjct:    94 EAVLMPGLIDVHVHLDDPGRSEWEGFPSGTKAAAAGGITTLVDMPLNSFPSTVSPETLKL 153

Query:   153 KVDAAEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASH 212
             K++AA+ RI+VDVGFWGGLVP+NA N+SALE+LL+AGVLGLKSFMCPSGINDFPMTN +H
Sbjct:   154 KIEAAKNRIHVDVGFWGGLVPDNALNSSALESLLDAGVLGLKSFMCPSGINDFPMTNITH 213

Query:   213 IKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTL-DTRSYSTYLKTRPPSWEEAAIRE 271
             IKEGLSVLA+YKRPLLVHAE+E    R +++ED +  D RSY TYLKTRP SWEE AIR 
Sbjct:   214 IKEGLSVLAKYKRPLLVHAEIE----RDLEIEDGSENDPRSYLTYLKTRPTSWEEGAIRN 269

Query:   272 LLTVAKDTRTDGPAEGAHLHIVHXXXXXXXXXXXMEAKTNGDSITVETCPHYLAFSAEEI 331
             LL+V ++TR  G AEGAHLHIVH            EAK  GDS+TVETCPHYLAFSAEEI
Sbjct:   270 LLSVTENTRIGGSAEGAHLHIVHLSDASSSLDLIKEAKGKGDSVTVETCPHYLAFSAEEI 329

Query:   332 PDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGI 391
             P+GDTRFKC+PPIRDAAN+EKLWEALM+G IDMLSSDHSPT PELKL+ +GNFLKAWGGI
Sbjct:   330 PEGDTRFKCSPPIRDAANREKLWEALMEGDIDMLSSDHSPTKPELKLMSDGNFLKAWGGI 389

Query:   392 SSLQ 395
             SSLQ
Sbjct:   390 SSLQ 393
GO:0000256 "allantoin catabolic process" evidence=IEA
GO:0004038 "allantoinase activity" evidence=IEA;IGI;IMP
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0016810 "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds" evidence=IEA
GO:0050897 "cobalt ion binding" evidence=IEA
GO:0010136 "ureide catabolic process" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006995 "cellular response to nitrogen starvation" evidence=IEP
TIGR_CMR|CPS_4867 CPS_4867 "putative allantoinase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
SGD|S000001466 DAL1 "Allantoinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000076835 AN4603 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282199 allB1 "allantoinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0005274 DAL1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A7L5 DAL1 "Putative uncharacterized protein DAL1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041212-22 zgc:103559 "zgc:103559" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030914 CG6106 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G4NGA5 MGG_10412 "Allantoinase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.20.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
PLN02795505 PLN02795, PLN02795, allantoinase 0.0
cd01315447 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and A 1e-171
TIGR03178443 TIGR03178, allantoinase, allantoinase 1e-129
PRK06189451 PRK06189, PRK06189, allantoinase; Provisional 2e-97
COG0044430 COG0044, PyrC, Dihydroorotase and related cyclic a 2e-83
PRK08044449 PRK08044, PRK08044, allantoinase; Provisional 4e-80
cd01318361 cd01318, DHOase_IIb, Dihydroorotase (DHOase), subg 5e-54
TIGR00857411 TIGR00857, pyrC_multi, dihydroorotase, multifuncti 1e-50
cd01302337 cd01302, Cyclic_amidohydrolases, Cyclic amidohydro 7e-49
PRK09060444 PRK09060, PRK09060, dihydroorotase; Validated 2e-48
PRK09357423 PRK09357, pyrC, dihydroorotase; Validated 4e-47
PRK02382443 PRK02382, PRK02382, dihydroorotase; Provisional 4e-47
cd01317374 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subg 4e-46
cd01314447 cd01314, D-HYD, D-hydantoinases (D-HYD) also calle 6e-43
PRK07575438 PRK07575, PRK07575, dihydroorotase; Provisional 1e-36
PRK08323 459 PRK08323, PRK08323, phenylhydantoinase; Validated 1e-36
TIGR02033454 TIGR02033, D-hydantoinase, D-hydantoinase 4e-36
PRK09236444 PRK09236, PRK09236, dihydroorotase; Reviewed 4e-34
PRK04250398 PRK04250, PRK04250, dihydroorotase; Provisional 1e-33
PRK01211409 PRK01211, PRK01211, dihydroorotase; Provisional 1e-29
PRK13404 477 PRK13404, PRK13404, dihydropyrimidinase; Provision 1e-28
PRK00369392 PRK00369, pyrC, dihydroorotase; Provisional 4e-23
cd01316344 cd01316, CAD_DHOase, The eukaryotic CAD protein is 1e-22
PRK07369418 PRK07369, PRK07369, dihydroorotase; Provisional 5e-17
PRK07627425 PRK07627, PRK07627, dihydroorotase; Provisional 3e-16
PLN02942 486 PLN02942, PLN02942, dihydropyrimidinase 6e-15
pfam1359466 pfam13594, Amidohydro_5, Amidohydrolase 2e-12
PRK08417386 PRK08417, PRK08417, dihydroorotase; Provisional 6e-11
cd01292275 cd01292, metallo-dependent_hydrolases, Superfamily 9e-11
PRK09059429 PRK09059, PRK09059, dihydroorotase; Validated 1e-09
cd00854374 cd00854, NagA, N-acetylglucosamine-6-phosphate dea 2e-09
pfam01979307 pfam01979, Amidohydro_1, Amidohydrolase family 1e-07
COG1820380 COG1820, NagA, N-acetylglucosamine-6-phosphate dea 1e-07
PRK15446383 PRK15446, PRK15446, phosphonate metabolism protein 3e-07
pfam13147304 pfam13147, Amidohydro_4, Amidohydrolase 4e-07
PRK09059429 PRK09059, PRK09059, dihydroorotase; Validated 9e-07
COG1228406 COG1228, HutI, Imidazolonepropionase and related a 2e-06
COG0402421 COG0402, SsnA, Cytosine deaminase and related meta 3e-06
PRK09356406 PRK09356, PRK09356, imidazolonepropionase; Validat 4e-06
PRK13308 569 PRK13308, ureC, urease subunit alpha; Reviewed 1e-05
COG3454377 COG3454, COG3454, Metal-dependent hydrolase involv 1e-04
PRK09045443 PRK09045, PRK09045, N-ethylammeline chlorohydrolas 1e-04
TIGR00221380 TIGR00221, nagA, N-acetylglucosamine-6-phosphate d 1e-04
cd01303429 cd01303, GDEase, Guanine deaminase (GDEase) 1e-04
cd01296371 cd01296, Imidazolone-5PH, Imidazolonepropionase/im 2e-04
COG1574 535 COG1574, COG1574, Predicted metal-dependent hydrol 3e-04
COG1001 584 COG1001, AdeC, Adenine deaminase [Nucleotide trans 6e-04
cd01299342 cd01299, Met_dep_hydrolase_A, Metallo-dependent hy 6e-04
cd01298411 cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enz 6e-04
cd01307338 cd01307, Met_dep_hydrolase_B, Metallo-dependent hy 7e-04
COG3964386 COG3964, COG3964, Predicted amidohydrolase [Genera 7e-04
PRK09237380 PRK09237, PRK09237, dihydroorotase; Provisional 9e-04
cd01300 479 cd01300, YtcJ_like, YtcJ_like metal dependent amid 0.001
PRK09061 509 PRK09061, PRK09061, D-glutamate deacylase; Validat 0.001
TIGR02318376 TIGR02318, phosphono_phnM, phosphonate metabolism 0.002
cd01309359 cd01309, Met_dep_hydrolase_C, Metallo-dependent hy 0.002
cd01297415 cd01297, D-aminoacylase, D-aminoacylases (N-acyl-D 0.004
>gnl|CDD|178392 PLN02795, PLN02795, allantoinase Back     alignment and domain information 
 Score =  668 bits (1726), Expect = 0.0
 Identities = 276/396 (69%), Positives = 325/396 (82%), Gaps = 4/396 (1%)

Query: 1   MENLNLQWRLLPTLTLLAASLFLLVFKDSAKL-SHSECSLLPYNQYWLTSKRIVTPKGVI 59
           ME+  LQ R+LP L LLA  +F  +F  +  L     CSLLP+  + L SKR+VTP GVI
Sbjct: 1   MESALLQLRILPLLALLATLVFFFLFAPALPLQGRDRCSLLPWPHFVLYSKRVVTPAGVI 60

Query: 60  SGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFP 119
            GAVE++ G I+S+  EE+ P++ K   V+DYG AV+MPGLIDVH HL++PGRTEWEGFP
Sbjct: 61  PGAVEVEGGRIVSVTKEEEAPKSQKKPHVLDYGNAVVMPGLIDVHVHLNEPGRTEWEGFP 120

Query: 120 SGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNA 179
           +GTKAAAAGGITTL+DMPLNS PST S ETL+LK++AA+ ++YVDVGFWGGLVPENA+NA
Sbjct: 121 TGTKAAAAGGITTLVDMPLNSFPSTTSVETLELKIEAAKGKLYVDVGFWGGLVPENAHNA 180

Query: 180 SALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSER 239
           S LE LL+AG LGLKSFMCPSGINDFPMT A+HIK  L VLA+Y RPLLVHAE+    E 
Sbjct: 181 SVLEELLDAGALGLKSFMCPSGINDFPMTTATHIKAALPVLAKYGRPLLVHAEVVSPVES 240

Query: 240 HVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDAS 299
             +L+    D RSYSTYLK+RPPSWE+ AIR+LL VAKDTR  G AEGAH+HIVHLSDA 
Sbjct: 241 DSRLDA---DPRSYSTYLKSRPPSWEQEAIRQLLEVAKDTRPGGVAEGAHVHIVHLSDAE 297

Query: 300 SSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMD 359
           SSL+L+ EAK  GDS+TVETCPHYLAFSAEEIPDGDTR+KCAPPIRDAAN+E LW+AL+D
Sbjct: 298 SSLELIKEAKAKGDSVTVETCPHYLAFSAEEIPDGDTRYKCAPPIRDAANRELLWKALLD 357

Query: 360 GHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQ 395
           G IDMLSSDHSP+ P+LKLL+EGNFL+AWGGISSLQ
Sbjct: 358 GDIDMLSSDHSPSPPDLKLLEEGNFLRAWGGISSLQ 393

Length = 505
>gnl|CDD|238640 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>gnl|CDD|163175 TIGR03178, allantoinase, allantoinase Back     alignment and domain information
>gnl|CDD|235732 PRK06189, PRK06189, allantoinase; Provisional Back     alignment and domain information
>gnl|CDD|223122 COG0044, PyrC, Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|169193 PRK08044, PRK08044, allantoinase; Provisional Back     alignment and domain information
>gnl|CDD|238643 cd01318, DHOase_IIb, Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>gnl|CDD|233153 TIGR00857, pyrC_multi, dihydroorotase, multifunctional complex type Back     alignment and domain information
>gnl|CDD|238627 cd01302, Cyclic_amidohydrolases, Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>gnl|CDD|181632 PRK09060, PRK09060, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|236479 PRK09357, pyrC, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|179417 PRK02382, PRK02382, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|238642 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>gnl|CDD|238639 cd01314, D-HYD, D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>gnl|CDD|236055 PRK07575, PRK07575, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|236240 PRK08323, PRK08323, phenylhydantoinase; Validated Back     alignment and domain information
>gnl|CDD|233694 TIGR02033, D-hydantoinase, D-hydantoinase Back     alignment and domain information
>gnl|CDD|181716 PRK09236, PRK09236, dihydroorotase; Reviewed Back     alignment and domain information
>gnl|CDD|235265 PRK04250, PRK04250, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|179247 PRK01211, PRK01211, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|184033 PRK13404, PRK13404, dihydropyrimidinase; Provisional Back     alignment and domain information
>gnl|CDD|234738 PRK00369, pyrC, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|238641 cd01316, CAD_DHOase, The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|236002 PRK07369, PRK07369, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|181059 PRK07627, PRK07627, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|178530 PLN02942, PLN02942, dihydropyrimidinase Back     alignment and domain information
>gnl|CDD|222250 pfam13594, Amidohydro_5, Amidohydrolase Back     alignment and domain information
>gnl|CDD|236262 PRK08417, PRK08417, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|238617 cd01292, metallo-dependent_hydrolases, Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|181631 PRK09059, PRK09059, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|238434 cd00854, NagA, N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>gnl|CDD|216825 pfam01979, Amidohydro_1, Amidohydrolase family Back     alignment and domain information
>gnl|CDD|224733 COG1820, NagA, N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237967 PRK15446, PRK15446, phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>gnl|CDD|221936 pfam13147, Amidohydro_4, Amidohydrolase Back     alignment and domain information
>gnl|CDD|181631 PRK09059, PRK09059, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|224149 COG1228, HutI, Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223479 COG0402, SsnA, Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236478 PRK09356, PRK09356, imidazolonepropionase; Validated Back     alignment and domain information
>gnl|CDD|183965 PRK13308, ureC, urease subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|225985 COG3454, COG3454, Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236366 PRK09045, PRK09045, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|232881 TIGR00221, nagA, N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>gnl|CDD|238628 cd01303, GDEase, Guanine deaminase (GDEase) Back     alignment and domain information
>gnl|CDD|238621 cd01296, Imidazolone-5PH, Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>gnl|CDD|224490 COG1574, COG1574, Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|223933 COG1001, AdeC, Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238624 cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|238623 cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>gnl|CDD|238632 cd01307, Met_dep_hydrolase_B, Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|226473 COG3964, COG3964, Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236423 PRK09237, PRK09237, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|238625 cd01300, YtcJ_like, YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>gnl|CDD|236369 PRK09061, PRK09061, D-glutamate deacylase; Validated Back     alignment and domain information
>gnl|CDD|131371 TIGR02318, phosphono_phnM, phosphonate metabolism protein PhnM Back     alignment and domain information
>gnl|CDD|238634 cd01309, Met_dep_hydrolase_C, Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|238622 cd01297, D-aminoacylase, D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 413
PLN02795505 allantoinase 100.0
COG0044430 PyrC Dihydroorotase and related cyclic amidohydrol 100.0
PRK07369418 dihydroorotase; Provisional 100.0
PRK07627425 dihydroorotase; Provisional 100.0
PRK09059429 dihydroorotase; Validated 100.0
PRK08417386 dihydroorotase; Provisional 100.0
PRK13404 477 dihydropyrimidinase; Provisional 100.0
PRK06189451 allantoinase; Provisional 100.0
PRK08044449 allantoinase; Provisional 100.0
TIGR03178443 allantoinase allantoinase. This enzyme carries out 100.0
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas 100.0
PRK02382 443 dihydroorotase; Provisional 100.0
PRK01211409 dihydroorotase; Provisional 100.0
PLN02942 486 dihydropyrimidinase 100.0
PRK09060444 dihydroorotase; Validated 100.0
KOG2584 522 consensus Dihydroorotase and related enzymes [Nucl 100.0
TIGR00857411 pyrC_multi dihydroorotase, multifunctional complex 100.0
cd01314447 D-HYD D-hydantoinases (D-HYD) also called dihydrop 100.0
PRK08323 459 phenylhydantoinase; Validated 100.0
PRK07575438 dihydroorotase; Provisional 100.0
TIGR02033454 D-hydantoinase D-hydantoinase. This model represen 100.0
PRK09357423 pyrC dihydroorotase; Validated 100.0
PRK04250398 dihydroorotase; Provisional 100.0
PRK09236444 dihydroorotase; Reviewed 100.0
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; 100.0
PRK00369392 pyrC dihydroorotase; Provisional 100.0
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; 100.0
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 100.0
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunc 100.0
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the rever 100.0
PLN02599364 dihydroorotase 100.0
PRK09061509 D-glutamate deacylase; Validated 100.0
TIGR00856341 pyrC_dimer dihydroorotase, homodimeric type. This 100.0
PRK05451345 dihydroorotase; Provisional 100.0
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci 100.0
PRK15446383 phosphonate metabolism protein PhnM; Provisional 99.98
TIGR02318376 phosphono_phnM phosphonate metabolism protein PhnM 99.98
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 99.91
PRK10657388 isoaspartyl dipeptidase; Provisional 99.91
PRK12394379 putative metallo-dependent hydrolase; Provisional 99.91
PRK13308 569 ureC urease subunit alpha; Reviewed 99.91
PRK13985 568 ureB urease subunit beta; Provisional 99.91
PRK13206 573 ureC urease subunit alpha; Reviewed 99.9
PRK13207 568 ureC urease subunit alpha; Reviewed 99.9
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 99.9
cd00375 567 Urease_alpha Urease alpha-subunit; Urease is a nic 99.9
PRK13309 572 ureC urease subunit alpha; Reviewed 99.89
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from 99.88
TIGR01792 567 urease_alph urease, alpha subunit. This model desc 99.87
PRK06687419 chlorohydrolase; Validated 99.86
cd01293398 Bact_CD Bacterial cytosine deaminase and related m 99.86
PRK15493435 5-methylthioadenosine/S-adenosylhomocysteine deami 99.85
COG0418344 PyrC Dihydroorotase [Nucleotide transport and meta 99.85
TIGR01975389 isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i 99.85
PRK07583438 cytosine deaminase-like protein; Validated 99.85
PRK09045443 N-ethylammeline chlorohydrolase; Provisional 99.83
PRK14085382 imidazolonepropionase; Provisional 99.83
PRK05985391 cytosine deaminase; Provisional 99.83
TIGR01178 552 ade adenine deaminase. The family described by thi 99.83
PLN02303 837 urease 99.82
PRK08203451 hydroxydechloroatrazine ethylaminohydrolase; Revie 99.82
PRK07572426 cytosine deaminase; Validated 99.82
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 99.82
PRK06151488 N-ethylammeline chlorohydrolase; Provisional 99.81
PRK06380418 metal-dependent hydrolase; Provisional 99.81
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. 99.81
PRK08204 449 hypothetical protein; Provisional 99.81
PRK09237380 dihydroorotase; Provisional 99.8
COG3653 579 N-acyl-D-aspartate/D-glutamate deacylase [Secondar 99.8
PRK09230426 cytosine deaminase; Provisional 99.8
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, 99.8
PRK12393457 amidohydrolase; Provisional 99.79
COG3964386 Predicted amidohydrolase [General function predict 99.79
PRK09356406 imidazolonepropionase; Validated 99.79
PRK08393424 N-ethylammeline chlorohydrolase; Provisional 99.78
PRK07213375 chlorohydrolase; Provisional 99.78
TIGR02967401 guan_deamin guanine deaminase. This model describe 99.78
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 99.77
PRK06038430 N-ethylammeline chlorohydrolase; Provisional 99.77
KOG2902344 consensus Dihydroorotase [Nucleotide transport and 99.77
PRK09228433 guanine deaminase; Provisional 99.76
PRK06846410 putative deaminase; Validated 99.75
COG1228406 HutI Imidazolonepropionase and related amidohydrol 99.75
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deamina 99.74
PRK08418408 chlorohydrolase; Provisional 99.74
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 99.74
COG1574 535 Predicted metal-dependent hydrolase with the TIM-b 99.73
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone- 99.72
COG0402421 SsnA Cytosine deaminase and related metal-dependen 99.71
PRK10027 588 cryptic adenine deaminase; Provisional 99.71
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 99.71
TIGR01224377 hutI imidazolonepropionase. This enzyme catalyzes 99.71
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and m 99.67
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, 99.67
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 99.65
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, 99.64
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolase 99.64
PF1359468 Amidohydro_5: Amidohydrolase; PDB: 4F0R_A 4F0S_A 1 99.64
PRK09229456 N-formimino-L-glutamate deiminase; Validated 99.63
TIGR02022455 hutF formiminoglutamate deiminase. In some species 99.61
PRK11170382 nagA N-acetylglucosamine-6-phosphate deacetylase; 99.6
TIGR03121 556 one_C_dehyd_A formylmethanofuran dehydrogenase sub 99.57
cd01304 541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) sub 99.57
COG0804 568 UreC Urea amidohydrolase (urease) alpha subunit [A 99.56
COG3454377 Metal-dependent hydrolase involved in phosphonate 99.54
cd01292275 metallo-dependent_hydrolases Superfamily of metall 99.48
cd01295422 AdeC Adenine deaminase (AdeC) directly deaminates 99.45
KOG3968439 consensus Atrazine chlorohydrolase/guanine deamina 99.36
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [ 99.32
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, 99.32
PF13147304 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2 99.27
PF12890142 DHOase: Dihydro-orotase-like; InterPro: IPR024403 99.25
PRK06886329 hypothetical protein; Validated 99.08
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolase 99.0
COG1229 575 FwdA Formylmethanofuran dehydrogenase subunit A [E 98.99
cd01306325 PhnM PhnM is believed to be a subunit of the membr 98.95
PF01979333 Amidohydro_1: Amidohydrolase family; InterPro: IPR 98.45
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cy 98.3
KOG3892407 consensus N-acetyl-glucosamine-6-phosphate deacety 98.09
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 98.03
TIGR00010252 hydrolase, TatD family. Several genomes have multi 97.97
PRK10812265 putative DNAse; Provisional 97.93
PRK11449258 putative deoxyribonuclease YjjV; Provisional 97.92
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydroly 97.9
PRK10425258 DNase TatD; Provisional 97.83
COG1099254 Predicted metal-dependent hydrolases with the TIM- 97.66
PF01026255 TatD_DNase: TatD related DNase The Pfam entry find 97.66
cd01311263 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) 97.51
PRK09358340 adenosine deaminase; Provisional 97.3
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 97.14
PRK09875292 putative hydrolase; Provisional 97.11
PF04909273 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 96.9
TIGR01430324 aden_deam adenosine deaminase. This family include 96.88
PF00449121 Urease_alpha: Urease alpha-subunit, N-terminal dom 96.86
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 95.89
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 95.85
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 95.31
COG1735316 Php Predicted metal-dependent hydrolase with the T 95.23
PRK13352431 thiamine biosynthesis protein ThiC; Provisional 93.76
COG1831285 Predicted metal-dependent hydrolase (urease superf 93.75
TIGR00190423 thiC thiamine biosynthesis protein ThiC. The thiC 93.54
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 91.24
PTZ00124362 adenosine deaminase; Provisional 90.91
cd00443305 ADA_AMPD Adenosine/AMP deaminase. Adenosine deamin 90.52
cd01321345 ADGF Adenosine deaminase-related growth factors (A 90.24
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 89.76
PF00962331 A_deaminase: Adenosine/AMP deaminase immunodeficie 89.19
PRK01060281 endonuclease IV; Provisional 89.13
COG0422432 ThiC Thiamine biosynthesis protein ThiC [Coenzyme 88.98
COG0826347 Collagenase and related proteases [Posttranslation 88.47
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 87.74
COG3618279 Predicted metal-dependent hydrolase of the TIM-bar 87.68
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 87.34
TIGR01496257 DHPS dihydropteroate synthase. This model represen 87.03
PRK14042 596 pyruvate carboxylase subunit B; Provisional 85.88
PRK12330 499 oxaloacetate decarboxylase; Provisional 85.14
COG4464254 CapC Capsular polysaccharide biosynthesis protein 84.7
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 83.58
COG1816345 Add Adenosine deaminase [Nucleotide transport and 82.02
PRK09284607 thiamine biosynthesis protein ThiC; Provisional 81.6
PLN02444 642 HMP-P synthase 80.51
>PLN02795 allantoinase Back     alignment and domain information 
Probab=100.00  E-value=5.4e-65  Score=511.86  Aligned_cols=406  Identities=68%  Similarity=1.109  Sum_probs=336.8

Q ss_pred             CccchhhHHHhhHHHHHHHHHHHHHhhc-ccccccccccCCCCcceEEEccEEEcCCCceeeEEEEECCEEEEcccCCCC
Q 015110            1 MENLNLQWRLLPTLTLLAASLFLLVFKD-SAKLSHSECSLLPYNQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDW   79 (413)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~lli~n~~vi~~~~~~~~~V~I~dG~I~~Ig~~~~~   79 (413)
                      ||+-=.+-+.+|+...++++++.+.|-. ..-...+.+++.|+.+++|+|++|+++++...++|+|+||+|++|++....
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~~~~vv~~~~~~~~~v~i~dG~I~~I~~~~~~   80 (505)
T PLN02795          1 MESALLQLRILPLLALLATLVFFFLFAPALPLQGRDRCSLLPWPHFVLYSKRVVTPAGVIPGAVEVEGGRIVSVTKEEEA   80 (505)
T ss_pred             CchHhhhhhhHHHHHHHHHHHHHHHhccccccccccccccccccceEEECCEEEECCCeEEEEEEEECCEEEEecCcccc
Confidence            6666667788899999988888777655 222477788888889999999999998877789999999999999875322


Q ss_pred             CCCCCCCcEEecCCCEEeeeeeecccccCCCCCCCccchHHHHHHHHhCCceEEEeCCCCCCCCCCcHHHHHHHHHHHhc
Q 015110           80 PRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEK  159 (413)
Q Consensus        80 ~~~~~~~~vID~~G~~vlPGlID~H~H~~~~~~~~~e~~~~~~~~al~~GvTTv~d~~~~~~~~~~~~~~~~~~~~~~~~  159 (413)
                      +...++.++||++|++|+|||||+|+|+..++...++++...+++++.+||||++||+.++.|.....+.++..++....
T Consensus        81 ~~~~~~~~~ida~G~~v~PG~ID~H~H~~~~~~~~~e~~~~~~~aa~~gGvTtv~dmp~~~~P~~~~~~~~~~~~~~~~~  160 (505)
T PLN02795         81 PKSQKKPHVLDYGNAVVMPGLIDVHVHLNEPGRTEWEGFPTGTKAAAAGGITTLVDMPLNSFPSTTSVETLELKIEAAKG  160 (505)
T ss_pred             ccccCCCEEEECCCCEEecCEEecccCcCCCCccchhHHHHHHHHHHcCCcEEEECCCCCCCCCCChHHHHHHHHHHhcc
Confidence            11112568999999999999999999998877777889999999999999999999995566777778888888877766


Q ss_pred             CCeeeEEeeceecCCchhhHHHHHHHHHcCCcEEEEeecCCCCCCCCCCCHHHHHHHHHHHHhcCCCEEEecCChhhchh
Q 015110          160 RIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSER  239 (413)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~l~~l~~~G~~~ik~~~~~~~~~~~~~~~~~~l~~~~~~A~~~g~~v~~H~e~~~~~~~  239 (413)
                      ...++++++.+.........+++.++.+.|+.+||.|+.+++...++..+.+.+.++++.++++|+++++|+|+.+.+..
T Consensus       161 ~~~vd~~~~~~~~~~~~~~~~~l~~~~~~G~~g~k~f~~~~~~~~~~~~~~~~l~~~~~~a~~~g~~v~iH~E~~~l~~~  240 (505)
T PLN02795        161 KLYVDVGFWGGLVPENAHNASVLEELLDAGALGLKSFMCPSGINDFPMTTATHIKAALPVLAKYGRPLLVHAEVVSPVES  240 (505)
T ss_pred             CceeeeeceecccCcchhHHHHHHHHHHCCCcEEEEEecccCCCCcccCCHHHHHHHHHHHHHhCCEEEEecCChhHhhh
Confidence            77888887765544333456778888888999999998775443445678899999999999999999999999886542


Q ss_pred             hHhhccCcCCccccccCCCCCchHHHHHHHHHHHHHHhhcccCCCCCCceEEEEccCChhhHHHHHHHHHHCCCCEEEEc
Q 015110          240 HVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVET  319 (413)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~p~~~E~~~v~~~~~~a~~~~~~~~~~g~~vhi~H~s~~~~~~~~i~~ak~~G~~v~~e~  319 (413)
                      ....   ..+..++..++.+||+.+|..++.+++.+++.+++.+..+|+++|++|+|+..+++++|+++|++|++|+|||
T Consensus       241 ~~~~---~~~~~~~~~~~~~rP~~aE~~ai~~~~~la~~~~~~~~~~g~~lhi~HiSt~~~~~e~i~~ak~~G~~Vt~Ev  317 (505)
T PLN02795        241 DSRL---DADPRSYSTYLKSRPPSWEQEAIRQLLEVAKDTRPGGVAEGAHVHIVHLSDAESSLELIKEAKAKGDSVTVET  317 (505)
T ss_pred             hhhh---hcCCcChhHhcccCCHHHHHHHHHHHHHHHHHhhhcccCCCCCEEEEECCChHHHHHHHHHHHHCCCcEEEEe
Confidence            2111   1233455567889999999999999999999865554455999999999996579999999999999999999


Q ss_pred             cccccccccccCCCCCcceEEcCCCCChhcHHHHHHHHhcCCccEEcCCCCCCChhhhccCCCCccccCCCcchHhHHHH
Q 015110          320 CPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCS  399 (413)
Q Consensus       320 ~p~~l~l~~~~~~~~~~~~k~~Pplr~~~~~~~L~~~l~~G~i~~i~sDh~p~~~~~k~~~~~~~~~~~~G~~~~e~~l~  399 (413)
                      |||||+|+++++..+++.+||+||||++++|++||++|++|+||+|+|||+||+.++|..++.+|+.+++|++|+|+++|
T Consensus       318 ~ph~L~l~~~~~~~~~~~~k~~PPLR~~~d~~aL~~al~~G~Id~i~sDHap~~~~~K~~~~~~~~~a~~G~~gle~~l~  397 (505)
T PLN02795        318 CPHYLAFSAEEIPDGDTRYKCAPPIRDAANRELLWKALLDGDIDMLSSDHSPSPPDLKLLEEGNFLRAWGGISSLQFVLP  397 (505)
T ss_pred             ChhhhcccHHHccCCCCceEEcCCCCChHHHHHHHHHHhCCCceEEecCCCCCChHHhccCcCCHhhCCCCceeHHHHHH
Confidence            99999999998877789999999999999999999999999999999999999999987655679999999999999999


Q ss_pred             HHhhhccccCC
Q 015110          400 LFFLSRGLMGG  410 (413)
Q Consensus       400 ~~~~~~gv~~g  410 (413)
                      ++|+ ++++.|
T Consensus       398 ~~~~-~~~~~~  407 (505)
T PLN02795        398 ATWT-AGRAYG  407 (505)
T ss_pred             HHHH-HHHHcC
Confidence            9995 566433

>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>PLN02942 dihydropyrimidinase Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>KOG2584 consensus Dihydroorotase and related enzymes [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>PRK08323 phenylhydantoinase; Validated Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>TIGR02033 D-hydantoinase D-hydantoinase Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>PLN02599 dihydroorotase Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>PRK15446 phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13985 ureB urease subunit beta; Provisional Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
>COG0418 PyrC Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA Back     alignment and domain information
>PRK07583 cytosine deaminase-like protein; Validated Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK14085 imidazolonepropionase; Provisional Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>TIGR01178 ade adenine deaminase Back     alignment and domain information
>PLN02303 urease Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>KOG2902 consensus Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>PRK06846 putative deaminase; Validated Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>PF13594 Amidohydro_5: Amidohydrolase; PDB: 4F0R_A 4F0S_A 1NFG_C 2FVM_A 2FVK_A 2FTY_D 1YBQ_B 1POJ_B 1ONW_A 2AQO_B Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>TIGR02022 hutF formiminoglutamate deiminase Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>KOG3968 consensus Atrazine chlorohydrolase/guanine deaminase [Nucleotide transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PF13147 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2PUZ_B 2GOK_B 3HM7_E 3D6N_A 1XRT_A 1XRF_A 1YNY_B 1K1D_F Back     alignment and domain information
>PF12890 DHOase: Dihydro-orotase-like; InterPro: IPR024403 This entry represents a small family of dihydro-orotase-like proteins from bacteria Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>COG1229 FwdA Formylmethanofuran dehydrogenase subunit A [Energy production and conversion] Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>PF01979 Amidohydro_1: Amidohydrolase family; InterPro: IPR006680 This group of enzymes represents a large metal dependent hydrolase superfamily [] Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>KOG3892 consensus N-acetyl-glucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00010 hydrolase, TatD family Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition Back     alignment and domain information
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) Back     alignment and domain information
>PRK09358 adenosine deaminase; Provisional Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>PF04909 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 These proteins are related to the metal-dependent hydrolase superfamily [] Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>PF00449 Urease_alpha: Urease alpha-subunit, N-terminal domain; InterPro: IPR011612 Urease (urea amidohydrolase, 3 Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK13352 thiamine biosynthesis protein ThiC; Provisional Back     alignment and domain information
>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00190 thiC thiamine biosynthesis protein ThiC Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>cd00443 ADA_AMPD Adenosine/AMP deaminase Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PF00962 A_deaminase: Adenosine/AMP deaminase immunodeficiency disease (SCID); InterPro: IPR001365 Adenosine deaminase (3 Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>COG0422 ThiC Thiamine biosynthesis protein ThiC [Coenzyme metabolism] Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG4464 CapC Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>COG1816 Add Adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09284 thiamine biosynthesis protein ThiC; Provisional Back     alignment and domain information
>PLN02444 HMP-P synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
3hm7_A448 Crystal Structure Of Allantoinase From Bacillus Hal 2e-51
3e74_A473 Crystal Structure Of E. Coli Allantoinase With Iron 8e-46
1gkr_A 458 L-Hydantoinase (Dihydropyrimidinase) From Arthrobac 2e-22
3mpg_A428 Dihydroorotase From Bacillus Anthracis Length = 428 3e-18
2z00_A426 Crystal Structure Of Dihydroorotase From Thermus Th 1e-16
1xrf_A467 The Crystal Structure Of A Novel, Latent Dihydrooro 1e-14
3d6n_A422 Crystal Structure Of Aquifex Dihydroorotase Activat 1e-14
1yny_A461 Molecular Structure Of D-Hydantoinase From A Bacill 8e-14
3sfw_A 461 Crystal Structure Of Dihydropyrimidinase From Brevi 1e-13
3gri_A424 The Crystal Structure Of A Dihydroorotase From Stap 2e-13
1k1d_A460 Crystal Structure Of D-Hydantoinase Length = 460 4e-11
2gwn_A452 The Structure Of Putative Dihydroorotase From Porph 4e-09
1nfg_A457 Structure Of D-Hydantoinase Length = 457 9e-09
1gkp_A458 D-Hydantoinase (Dihydropyrimidinase) From Thermus S 2e-07
2fty_A 559 Crystal Structure Of Dihydropyrimidinase From Sacch 3e-07
3dc8_A 490 Crystal Structure Of Dihydropyrimidinase From Sinor 4e-07
>pdb|3HM7|A Chain A, Crystal Structure Of Allantoinase From Bacillus Halodurans C-125 Length = 448 Back     alignment and structure 
Iteration: 1

 Score =  199 bits (506), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 175/335 (52%), Gaps = 20/335 (5%)
Query: 63  VEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGRTEWEGFPSXX 122
           V I+ G I+S ++E     +S  G  +D     + PG++DVH H ++PGRTEWEGF S  
Sbjct: 26  VAIRNG-IVSAITEPG-SISSDDGPAIDGTGLHLFPGMVDVHVHFNEPGRTEWEGFASGS 83
Query: 123 XXXXXXXXXXLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASAL 182
                       DMPLNS+P TI+ E L  K   A ++  VD  FWGGLVP    N   L
Sbjct: 84  KSLAAGGVTTYFDMPLNSNPPTITREELDKKRQLANEKSLVDYRFWGGLVPG---NIDHL 140
Query: 183 EALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEK--GSERH 240
           + L + GV+G K+FM   G +DF  ++   + +G+  +A     L VHAE  +   +   
Sbjct: 141 QDLHDGGVIGFKAFMSECGTDDFQFSHDETLLKGMKKIAALGSILAVHAESNEMVNALTT 200
Query: 241 VKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHXXXXXX 300
           + +E+  L  + YS   + RP   E  A+  +L  A+ T          +HI H      
Sbjct: 201 IAIEEQRLTVKDYS---EARPIVSELEAVERILRFAQLT-------CCPIHICHVSSRKV 250
Query: 301 XXXXXMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPPIRDAANKEKLWEALMDG 360
                 +AK  G +++VETCPHYL FS +E  +     KCAPP+R+    E LW+ LM G
Sbjct: 251 LKRIK-QAKGEGVNVSVETCPHYLLFSLDEFAEIGYLAKCAPPLRERQEVEDLWDGLMAG 309
Query: 361 HIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQ 395
            ID++SSDHSP++P++K        + WGGI+  Q
Sbjct: 310 EIDLISSDHSPSLPQMK--TGKTIFEVWGGIAGCQ 342
>pdb|3E74|A Chain A, Crystal Structure Of E. Coli Allantoinase With Iron Ions At The Metal Center Length = 473 Back     alignment and structure
>pdb|1GKR|A Chain A, L-Hydantoinase (Dihydropyrimidinase) From Arthrobacter Aurescens Length = 458 Back     alignment and structure
>pdb|3MPG|A Chain A, Dihydroorotase From Bacillus Anthracis Length = 428 Back     alignment and structure
>pdb|2Z00|A Chain A, Crystal Structure Of Dihydroorotase From Thermus Thermophilus Length = 426 Back     alignment and structure
>pdb|1XRF|A Chain A, The Crystal Structure Of A Novel, Latent Dihydroorotase From Aquifex Aeolicus At 1.7 A Resolution Length = 467 Back     alignment and structure
>pdb|3D6N|A Chain A, Crystal Structure Of Aquifex Dihydroorotase Activated By Aspartate Transcarbamoylase Length = 422 Back     alignment and structure
>pdb|1YNY|A Chain A, Molecular Structure Of D-Hydantoinase From A Bacillus Sp. Ar9: Evidence For Mercury Inhibition Length = 461 Back     alignment and structure
>pdb|3SFW|A Chain A, Crystal Structure Of Dihydropyrimidinase From Brevibacillus Agri Nchu1002 Length = 461 Back     alignment and structure
>pdb|3GRI|A Chain A, The Crystal Structure Of A Dihydroorotase From Staphylococcus Aureus Length = 424 Back     alignment and structure
>pdb|1K1D|A Chain A, Crystal Structure Of D-Hydantoinase Length = 460 Back     alignment and structure
>pdb|2GWN|A Chain A, The Structure Of Putative Dihydroorotase From Porphyromonas Gingivalis Length = 452 Back     alignment and structure
>pdb|1NFG|A Chain A, Structure Of D-Hydantoinase Length = 457 Back     alignment and structure
>pdb|1GKP|A Chain A, D-Hydantoinase (Dihydropyrimidinase) From Thermus Sp. In Space Group C2221 Length = 458 Back     alignment and structure
>pdb|2FTY|A Chain A, Crystal Structure Of Dihydropyrimidinase From Saccharomyces Kluyveri Length = 559 Back     alignment and structure
>pdb|3DC8|A Chain A, Crystal Structure Of Dihydropyrimidinase From Sinorhizobium Meliloti Length = 490 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 1e-139
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 1e-134
1gkr_A 458 Hydantoinase, non-ATP dependent L-selective hydant 1e-117
1nfg_A457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 1e-106
3sfw_A 461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 1e-101
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 1e-101
1gkp_A458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 1e-100
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 1e-100
3dc8_A 490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 7e-99
2vm8_A 501 Dihydropyrimidinase-related protein 2; neurogenesi 3e-96
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 2e-95
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 2e-86
3gri_A424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 2e-53
3mpg_A428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 4e-53
2z00_A426 Dihydroorotase; zinc binding protein, hydrolase, m 1e-52
1xrt_A467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 3e-51
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 4e-22
4ubp_C 570 Protein (urease (chain C)); bacillus pasteurii, ni 1e-18
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 1e-17
1e9y_B 569 Urease subunit beta; hydrolase, dodecamer; HET: KC 3e-15
1ejx_C 567 Urease alpha subunit; alpha-beta barrel, nickel me 7e-15
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 6e-14
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 1e-12
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 2e-10
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 5e-10
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 1e-08
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 1e-08
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
3v7p_A427 Amidohydrolase family protein; iron binding site, 5e-08
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 6e-08
3feq_A423 Putative amidohydrolase; unknown source, sargasso 7e-08
4dzh_A472 Amidohydrolase; adenosine deaminase, nysgrc, struc 1e-07
2ood_A475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 2e-07
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 2e-07
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 3e-07
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 6e-07
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 8e-07
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 1e-06
3ggm_A81 Uncharacterized protein BT9727_2919; bacillus cere 2e-06
2p9b_A458 Possible prolidase; protein structure initiative I 2e-06
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 2e-06
4dyk_A451 Amidohydrolase; adenosine deaminase, nysgrc, struc 2e-06
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 3e-06
4f0r_A447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 3e-06
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 3e-06
2i9u_A439 Cytosine/guanine deaminase related protein; protei 4e-06
3ooq_A396 Amidohydrolase; structural genomics, protein struc 1e-05
3lnp_A468 Amidohydrolase family protein OLEI01672_1_465; TIM 1e-05
1p1m_A406 Hypothetical protein TM0936; putative metal depend 2e-05
3ls9_A456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 2e-05
3h4u_A479 Amidohydrolase; signature of Zn ligands, structura 3e-05
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 4e-05
3icj_A 534 Uncharacterized metal-dependent hydrolase; structu 5e-05
2paj_A492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 1e-04
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 1e-04
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Length = 448 Back     alignment and structure
 Score =  404 bits (1041), Expect = e-139
 Identities = 128/352 (36%), Positives = 183/352 (51%), Gaps = 22/352 (6%)

Query: 47  LTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAH 106
           + S  +VT        V I+ G + +I        +      +D     + PG++DVH H
Sbjct: 10  IRSSTVVTETTTYRADVAIRNGIVSAITEPGSISSDDG--PAIDGTGLHLFPGMVDVHVH 67

Query: 107 LDDPGRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVG 166
            ++PGRTEWEGF SG+K+ AAGG+TT  DMPLNS+P TI+ E L  K   A ++  VD  
Sbjct: 68  FNEPGRTEWEGFASGSKSLAAGGVTTYFDMPLNSNPPTITREELDKKRQLANEKSLVDYR 127

Query: 167 FWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRP 226
           FWGGLVP    N   L+ L + GV+G K+FM   G +DF  ++   + +G+  +A     
Sbjct: 128 FWGGLVPG---NIDHLQDLHDGGVIGFKAFMSECGTDDFQFSHDETLLKGMKKIAALGSI 184

Query: 227 LLVHAEME---KGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVAKDTRTDG 283
           L VHAE              E       +   Y + RP   E  A+  +L  A+ T    
Sbjct: 185 LAVHAESNEMVNALTTIAIEEQRL----TVKDYSEARPIVSELEAVERILRFAQLT---- 236

Query: 284 PAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDGDTRFKCAPP 343
                 +HI H+S     L  + +AK  G +++VETCPHYL FS +E  +     KCAPP
Sbjct: 237 ---CCPIHICHVSSR-KVLKRIKQAKGEGVNVSVETCPHYLLFSLDEFAEIGYLAKCAPP 292

Query: 344 IRDAANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQ 395
           +R+    E LW+ LM G ID++SSDHSP++P++K        + WGGI+  Q
Sbjct: 293 LRERQEVEDLWDGLMAGEIDLISSDHSPSLPQMK--TGKTIFEVWGGIAGCQ 342
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Length = 473 Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Length = 458 Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Length = 457 Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Length = 461 Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Length = 452 Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Length = 458 Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Length = 541 Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Length = 490 Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Length = 501 Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Length = 521 Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Length = 559 Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Length = 424 Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Length = 428 Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Length = 426 Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Length = 467 Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Length = 386 Back     alignment and structure
>4ubp_C Protein (urease (chain C)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.92.1.1 c.1.9.2 PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 1ie7_C* Length = 570 Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Length = 390 Back     alignment and structure
>1e9y_B Urease subunit beta; hydrolase, dodecamer; HET: KCX; 3.00A {Helicobacter pylori} SCOP: b.92.1.1 c.1.9.2 PDB: 1e9z_B* 3qga_C* 3qgk_C* Length = 569 Back     alignment and structure
>1ejx_C Urease alpha subunit; alpha-beta barrel, nickel metalloenzyme, temperature depende structural changes, hydrolase; HET: KCX; 1.60A {Klebsiella aerogenes} SCOP: b.92.1.1 c.1.9.2 PDB: 1ejw_C* 1fwj_C* 1kra_C 2kau_C* 1ef2_A* 1ejv_C* 1ejt_C* 1eju_C* 1ejs_C* 1ejr_C* 1krc_C 1krb_C* 1fwi_C* 1fwa_C* 1fwb_C* 1fwc_C* 1fwd_C* 1fwe_C* 1fwg_C* 1a5k_C ... Length = 567 Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Length = 379 Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Length = 382 Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Length = 381 Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Length = 396 Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Length = 347 Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Length = 408 Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3mkv_A* Length = 426 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Length = 427 Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Length = 420 Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Length = 423 Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Length = 472 Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Length = 475 Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Length = 418 Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Length = 416 Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Length = 417 Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Length = 419 Back     alignment and structure
>3ggm_A Uncharacterized protein BT9727_2919; bacillus cereus group., structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus thuringiensis serovarkonkukian} Length = 81 Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Length = 458 Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Length = 421 Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Length = 451 Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Length = 376 Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Length = 447 Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Length = 608 Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Length = 439 Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Length = 396 Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Length = 468 Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Length = 406 Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Length = 456 Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Length = 403 Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Length = 534 Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Length = 492 Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
3dc8_A 490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 100.0
3sfw_A 461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 100.0
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 100.0
3gri_A424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 100.0
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 100.0
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 100.0
3mpg_A428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 100.0
3pnu_A359 Dihydroorotase; TIM barrel, zinc binding, hydrolas 100.0
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 100.0
1gkp_A458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 100.0
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 100.0
1gkr_A 458 Hydantoinase, non-ATP dependent L-selective hydant 100.0
2z00_A426 Dihydroorotase; zinc binding protein, hydrolase, m 100.0
2vm8_A 501 Dihydropyrimidinase-related protein 2; neurogenesi 100.0
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 100.0
1nfg_A457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 100.0
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 100.0
1xrt_A467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 100.0
3gip_A480 N-acyl-D-glutamate deacylase; amidohydrolase famil 100.0
1rk6_A496 D-aminoacylase; TIM barrel, beta barrel, insertion 99.97
1e9y_B 569 Urease subunit beta; hydrolase, dodecamer; HET: KC 99.96
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 99.92
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 99.92
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 99.91
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 99.91
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 99.91
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 99.91
3feq_A423 Putative amidohydrolase; unknown source, sargasso 99.91
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 99.9
2p9b_A458 Possible prolidase; protein structure initiative I 99.9
4ubp_C 570 Protein (urease (chain C)); bacillus pasteurii, ni 99.9
4ac7_C 570 Urease subunit alpha; hydrolase, bacillus pasteuri 99.9
3h4u_A479 Amidohydrolase; signature of Zn ligands, structura 99.89
2paj_A492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 99.89
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 99.89
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 99.88
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 99.88
3lnp_A468 Amidohydrolase family protein OLEI01672_1_465; TIM 99.88
4gy7_A 840 Urease; JACK bean, hydrolase, ME binding, nickel; 99.88
2i9u_A439 Cytosine/guanine deaminase related protein; protei 99.87
4f0r_A447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 99.87
4dyk_A451 Amidohydrolase; adenosine deaminase, nysgrc, struc 99.87
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 99.86
4dzh_A 472 Amidohydrolase; adenosine deaminase, nysgrc, struc 99.86
3ls9_A456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 99.86
2ood_A 475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 99.86
1p1m_A406 Hypothetical protein TM0936; putative metal depend 99.85
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 99.84
4ep8_C 566 Urease subunit alpha; alpha-beta barrel, nickel me 99.83
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 99.83
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 99.82
4aql_A476 Guanine deaminase; hydrolase, purine metabolism; H 99.79
3v7p_A427 Amidohydrolase family protein; iron binding site, 99.78
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 99.77
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 99.76
3ooq_A396 Amidohydrolase; structural genomics, protein struc 99.75
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 99.74
3hpa_A479 Amidohydrolase; signature of Zn ligands, structura 99.73
4f0l_A458 Amidohydrolase; ssgcid, structural genomics, seatt 99.72
3mdu_A453 N-formimino-L-glutamate iminohydrolase; amonohydra 99.7
3icj_A 534 Uncharacterized metal-dependent hydrolase; structu 99.67
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 99.64
3ggm_A81 Uncharacterized protein BT9727_2919; bacillus cere 99.62
3mtw_A403 L-arginine carboxypeptidase CC2672; hydrolase; HET 99.59
3mkv_A426 Putative amidohydrolase; sargasso SEA, structural 99.5
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 99.47
1bf6_A291 Phosphotriesterase homology protein; hypothetical 98.88
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 98.4
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 98.23
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 98.21
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 98.19
4i6k_A294 Amidohydrolase family protein; enzyme function ini 98.02
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 98.01
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 97.94
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 97.89
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 97.87
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 97.86
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protei 97.77
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 97.55
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 97.54
3gg7_A254 Uncharacterized metalloprotein; structural genomic 97.42
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 97.41
4d9a_A303 2-pyrone-4,6-dicarbaxylate hydrolase; structural g 97.4
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 97.32
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 97.29
4do7_A303 Amidohydrolase 2; enzyme function initiative, EFI, 97.26
3tn4_A360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 97.2
3pnz_A330 Phosphotriesterase family protein; amidohydrolase 97.12
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 96.9
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 96.75
3rhg_A365 Putative phophotriesterase; hydrolase, amidohydrol 96.73
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 96.42
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, 96.23
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 96.11
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 95.87
3irs_A291 Uncharacterized protein BB4693; structural genomic 95.86
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- relat 95.7
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, 95.69
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 95.34
3iar_A367 Adenosine deaminase; purine metabolism structural 95.02
3nur_A357 Amidohydrolase; TIM barrel; 1.75A {Staphylococcus 94.38
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 93.96
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 92.81
3qy7_A262 Tyrosine-protein phosphatase YWQE; TIM barrel, pol 91.8
2wje_A247 CPS4B, tyrosine-protein phosphatase CPSB; capsule 91.5
4gxw_A380 Adenosine deaminase; amidohydrolase, COG1816, EFI, 91.22
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 89.81
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 88.31
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 87.72
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 85.88
4inf_A373 Metal-dependent hydrolase; amidohydrolase, metal b 84.34
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 83.65
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like prote 81.42
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Back     alignment and structure
Probab=100.00  E-value=2.3e-58  Score=464.76  Aligned_cols=347  Identities=24%  Similarity=0.331  Sum_probs=301.8

Q ss_pred             cceEEEccEEEcCCCceeeEEEEECCEEEEcccCCCCCCCCCCCcEEecCCCEEeeeeeecccccCCCCC--CCccchHH
Q 015110           43 NQYWLTSKRIVTPKGVISGAVEIKEGNIISIVSEEDWPRNSKTGQVVDYGEAVIMPGLIDVHAHLDDPGR--TEWEGFPS  120 (413)
Q Consensus        43 ~~lli~n~~vi~~~~~~~~~V~I~dG~I~~Ig~~~~~~~~~~~~~vID~~G~~vlPGlID~H~H~~~~~~--~~~e~~~~  120 (413)
                      ++++|+|++|+++++..+++|+|+||+|++|++...      +.++||++|++|+|||||+|+|+..++.  ..++++..
T Consensus         1 m~~~i~~~~v~~~~~~~~~~v~I~~G~I~~i~~~~~------~~~viD~~g~~v~PG~ID~H~H~~~~~~~~~~~e~~~~   74 (490)
T 3dc8_A            1 MSTVIKGGTIVTADLTYKADVKVEGGRIVEIGPNLS------GAETLDATGCYVMPGGIDPHTHLEMPFMGTYSSDDFES   74 (490)
T ss_dssp             -CEEEESCEEECSSCEEECEEEEETTEEEEEESSCC------CSEEEECTTCEEEECEEEEEECTTCEETTEECSCCHHH
T ss_pred             CcEEEEccEEECCCCceeeeEEEECCEEEEeccCCC------CCeEEECCCCEEecCEEeeccccCCCCCCCCCHHHHHH
Confidence            368999999999988788999999999999987532      4689999999999999999999988765  57889999


Q ss_pred             HHHHHHhCCceEEEeCCCCCCCCCCcHHHHHHHHHHHhcCCeeeEEeeceecCCchhhHHHHHHHH-HcCCcEEEEeecC
Q 015110          121 GTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPENAYNASALEALL-NAGVLGLKSFMCP  199 (413)
Q Consensus       121 ~~~~al~~GvTTv~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~-~~G~~~ik~~~~~  199 (413)
                      .++.++++||||+++|+ ++.|.....+.++.+.+.+. ...+++.+++.+.....+.++++.++. +.|+.++|.|+.+
T Consensus        75 ~~~aa~~~GvTtv~~~~-~~~p~~~~~~~~~~~~~~a~-~~~~d~~~~~~~~~~~~~~l~el~~l~~~~G~~~~k~~~~~  152 (490)
T 3dc8_A           75 GTRAALAGGTTMVVDFA-LPSPGQSLLEALTMWDNKST-RANCDYSFHMAITWWGEQVFNEMETIVKDKGINTFKHFMAY  152 (490)
T ss_dssp             HHHHHHHTTEEEEEEEE-CCC-CCCHHHHHHHHHHHTT-TCSSEEEEEEECCSCSHHHHHHHHHHHHHSCCCEEEEESCS
T ss_pred             HHHHHHHcCEEeecccC-CCCCCcCHHHHHHHHHHHhh-cccceeeeEEEEecCcHHHHHHHHHHHHhCCCCEEEEEecC
Confidence            99999999999999998 66676666777877776665 677899888777665555678888888 8999999999876


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhcCCCEEEecCChhhch---hhHhhccCcCCccccccCCCCCchHHHHHHHHHHHHHH
Q 015110          200 SGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSE---RHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVA  276 (413)
Q Consensus       200 ~~~~~~~~~~~~~l~~~~~~A~~~g~~v~~H~e~~~~~~---~~~~~~~~~~~~~~~~~~~~~~p~~~E~~~v~~~~~~a  276 (413)
                      .+   .+.+++++++++++.|+++|+++++|+|+.+.+.   ..++..    +..+...|+.++|+.+|..++.+.+.++
T Consensus       153 ~~---~~~~~~~~l~~~~~~a~~~g~~v~~HaE~~~~i~~~~~~~~~~----g~~~~~~~~~~rP~~~E~~av~r~i~la  225 (490)
T 3dc8_A          153 KG---ALMVDDDEMFSSFQRCAALGALPLVHAENGDVVAQLQAKLLAE----GNSGPEAHAYSRPAEVEGEAANRAIMIA  225 (490)
T ss_dssp             TT---TTBCCHHHHHHHHHHHHHHTCEEEEECSCHHHHHHHHHHHHHT----TCCSHHHHHHTSCHHHHHHHHHHHHHHH
T ss_pred             CC---CccCCHHHHHHHHHHHHhcCCEEEEecCChHHHHHHHHHHHhc----CCCCccccccCCCHHHHHHHHHHHHHHH
Confidence            42   3456999999999999999999999999987654   333332    3445566788999999999999999999


Q ss_pred             hhcccCCCCCCceEEEEccCChhhHHHHHHHHHHCCCCEEEEccccccccccccCCCC----CcceEEcCCCCChhcHHH
Q 015110          277 KDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDG----DTRFKCAPPIRDAANKEK  352 (413)
Q Consensus       277 ~~~~~~~~~~g~~vhi~H~s~~~~~~~~i~~ak~~G~~v~~e~~p~~l~l~~~~~~~~----~~~~k~~Pplr~~~~~~~  352 (413)
                      +.+       |+++|++|+|+. +++++|+.+|++|+.|++|+|||||+++++++...    ++.+||+||||+++++++
T Consensus       226 ~~~-------g~~lhi~HvSt~-~~~~li~~ak~~G~~Vt~e~~ph~l~l~~~~~~~~~~~~~~~~~~~Pplr~~~d~~a  297 (490)
T 3dc8_A          226 DMA-------GCPVYIVHTSCE-QAHEAIRRARAKGMRVFGEPLIQHLTLDETEYFDKDWDHAARRVMSPPFRNKLHQDS  297 (490)
T ss_dssp             HHH-------TCCEEESSCCSH-HHHHHHHHHHHTTCCEEECCBHHHHHCCGGGGGCSCHHHHHHTCCSSCCCCGGGHHH
T ss_pred             HHh-------CCcEEEEeCCCH-HHHHHHHHHHHCCCeEEEEEchHHheeCHHHhcCcCcccCCceEECCCCCChHHHHH
Confidence            986       899999999999 99999999999999999999999999999988766    688999999999999999


Q ss_pred             HHHHHhcCCccEEcCCCCCCChhhhccCCCCccccCCCcchHhHHHHHHhhhccccCCCCC
Q 015110          353 LWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMGGNME  413 (413)
Q Consensus       353 L~~~l~~G~i~~i~sDh~p~~~~~k~~~~~~~~~~~~G~~~~e~~l~~~~~~~gv~~g~~~  413 (413)
                      ||++|++|.+|+|+|||+||+.++|..+.++|..+++|++|+|+.+|++| ++||++|+|+
T Consensus       298 L~~~l~~G~id~i~sDh~p~~~~~K~~g~~~f~~~~~G~~gle~~l~~~~-~~~v~~~~l~  357 (490)
T 3dc8_A          298 LWAGLASGSLQVVATDHCAFTTEQKRFGVGDFTRIPNGTGGLEDRMPMLW-TYGVATGRIT  357 (490)
T ss_dssp             HHHHHHHTSSCCCBCCBCCCCHHHHGGGTTCGGGSCCCBCCTTTHHHHHH-HHHTTTTSSC
T ss_pred             HHHHHhcCCceEEECCCCCCCHHHhhccCCChhhCCCChHHHHHHHHHHH-HHHHHcCCCC
Confidence            99999999999999999999999997666789999999999999999999 5789988874
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Back     alignment and structure
>3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Back     alignment and structure
>3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Back     alignment and structure
>1e9y_B Urease subunit beta; hydrolase, dodecamer; HET: KCX; 3.00A {Helicobacter pylori} SCOP: b.92.1.1 c.1.9.2 PDB: 1e9z_B* 3qga_C* 3qgk_C* Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Back     alignment and structure
>4ubp_C Protein (urease (chain C)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.92.1.1 c.1.9.2 PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 1ie7_C* Back     alignment and structure
>4ac7_C Urease subunit alpha; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 4ubp_C* 1ie7_C* Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Back     alignment and structure
>4gy7_A Urease; JACK bean, hydrolase, ME binding, nickel; HET: CME KCX; 1.49A {Canavalia ensiformis} PDB: 3la4_A* 4h9m_A* Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Back     alignment and structure
>4ep8_C Urease subunit alpha; alpha-beta barrel, nickel metalloenzyme, hydrolase, radiatio; HET: KCX; 1.55A {Enterobacter aerogenes} PDB: 1ef2_A* 4epb_C* 4epd_C* 4epe_C* 1ejx_C* 1ejw_C* 1fwj_C* 1kra_C 2kau_C* 1a5k_C 1ejv_C* 1ejt_C* 1eju_C* 1ejs_C* 1a5m_C 1a5n_C 1ejr_C* 1a5l_C 1a5o_C 1fwa_C* ... Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Back     alignment and structure
>3hpa_A Amidohydrolase; signature of Zn ligands, structural genomics, NYSGXRC, target 9236E, PSI-2, protein structure initiative; 2.20A {Unidentified} Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
>3ggm_A Uncharacterized protein BT9727_2919; bacillus cereus group., structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3mtw_A L-arginine carboxypeptidase CC2672; hydrolase; HET: KCX M3R; 1.70A {Caulobacter vibrioides} Back     alignment and structure
>3mkv_A Putative amidohydrolase; sargasso SEA, structural genomics, protein structure initiat NEW YORK structural genomix research consortium, nysgxrc; HET: KCX; 2.40A {Undefined} Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0 Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure
>3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Back     alignment and structure
>3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} Back     alignment and structure
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>3qy7_A Tyrosine-protein phosphatase YWQE; TIM barrel, polymerase and histindinol phosphatase(PHP)-like phosphatase, hydrolase; 1.62A {Bacillus subtilis} PDB: 3qy6_A Back     alignment and structure
>2wje_A CPS4B, tyrosine-protein phosphatase CPSB; capsule biogenesis/degradation, manganese, hydrolase, exopolysaccharide synthesis; 1.90A {Streptococcus pneumoniae} PDB: 2wjd_A 2wjf_A 3qy8_A Back     alignment and structure
>4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 413
d1nfga2330 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pi 2e-50
d2ftwa2334 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolas 8e-50
d2fvka2384 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolas 3e-48
d1kcxa2334 c.1.9.6 (A:67-400) Dihydropyrimidinase related pro 7e-48
d1gkpa2335 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [Ta 3e-45
d1ynya2332 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR 6e-44
d1xrta2310 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aqui 1e-41
d1gkra2325 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter au 6e-37
d2eg6a1343 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli 1e-21
d2vhla2301 c.1.9.10 (A:58-358) N-acetylglucosamine-6-phosphat 4e-16
d1onwa2284 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catal 2e-14
d1i0da_331 c.1.9.3 (A:) Phosphotriesterase (parathion hydrola 7e-14
d1onwa1105 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidas 1e-08
d1ejxc1181 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit o 2e-08
d1yrra185 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6- 9e-07
d1o12a2288 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphat 6e-06
d2icsa2267 c.1.9.14 (A:55-321) Putative adenine deaminase EF0 7e-06
d2p9ba1118 b.92.1.10 (A:9-70,A:395-450) Uncharacterized prote 4e-05
d2vhla191 b.92.1.5 (A:3-57,A:359-394) N-acetylglucosamine-6- 4e-04
d4ubpc2390 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of ure 6e-04
d1yrra2297 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphat 0.002
d2fvka1156 b.92.1.3 (A:2-56,A:441-541) Dihydropyrimidine amid 0.002
d1e9yb2389 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of ure 0.004
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Length = 330 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: Hydantoinase (dihydropyrimidinase), catalytic domain
domain: D-hydantoinase
species: Burkholderia pickettii [TaxId: 329]

 Score =  170 bits (432), Expect = 2e-50
 Identities = 72/310 (23%), Positives = 121/310 (39%), Gaps = 19/310 (6%)

Query: 99  GLIDVHAHLDDP--GRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDA 156
           G IDVH H++         + F + T AAA GG TT++D     D      E +      
Sbjct: 1   GGIDVHTHVETVSFNTQSADTFATATVAAACGGTTTIVDFC-QQDRGHSLAEAVAKWDGM 59

Query: 157 AEKRIYVDVGFWGGLVPENAYNASALEALLNAGVLGLKSFMCPSGINDFPMTNASHIKEG 216
           A  +  +D G+   ++         LE L + G+   K FM         M +   + + 
Sbjct: 60  AGGKSAIDYGYHIIVLDPTDSVIEELEVLPDLGITSFKVFM---AYRGMNMIDDVTLLKT 116

Query: 217 LSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYSTYLKTRPPSWEEAAIRELLTVA 276
           L    +    ++VHAE    +  +++ +       +   +  +RPP  E  A    L +A
Sbjct: 117 LDKAVKTGSLVMVHAENGDAA-DYLRDKFVAEGKTAPIYHALSRPPRVEAEATARALALA 175

Query: 277 KDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAF---SAEEIPD 333
           +          A ++IVH++   S  + +M AK+ G     ETC HYL       E    
Sbjct: 176 EIV-------NAPIYIVHVTCEESL-EEVMRAKSRGVRALAETCTHYLYLTKEDLERPDF 227

Query: 334 GDTRFKCAPPIRDAANKEKLWEALMDGHIDMLSSDHSP-TVPELKLLDEGNFLKAWGGIS 392
              ++   PP R   + + LW AL +G  + +SSDH        K     +F     G  
Sbjct: 228 EGAKYVFTPPARAKKDHDVLWNALRNGVFETVSSDHCSWLFKGHKDRGRNDFRAIPNGAP 287

Query: 393 SLQIFCSLFF 402
            ++    + +
Sbjct: 288 GVEERLMMVY 297
>d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Length = 334 Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Length = 384 Back     information, alignment and structure
>d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 334 Back     information, alignment and structure
>d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} Length = 335 Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Length = 332 Back     information, alignment and structure
>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Length = 310 Back     information, alignment and structure
>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Length = 325 Back     information, alignment and structure
>d2eg6a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} Length = 343 Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Length = 331 Back     information, alignment and structure
>d1onwa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure
>d1ejxc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]} Length = 181 Back     information, alignment and structure
>d1yrra1 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 288 Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Length = 267 Back     information, alignment and structure
>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Length = 118 Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Length = 390 Back     information, alignment and structure
>d1yrra2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]} Length = 297 Back     information, alignment and structure
>d2fvka1 b.92.1.3 (A:2-56,A:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Length = 156 Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Length = 389 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
d2ftwa2334 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 100.0
d1gkra2325 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 100.0
d1nfga2330 D-hydantoinase {Burkholderia pickettii [TaxId: 329 100.0
d1kcxa2334 Dihydropyrimidinase related protein-1 {Mouse (Mus 100.0
d1ynya2332 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 100.0
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 100.0
d1gkpa2335 D-hydantoinase {Thermus sp. [TaxId: 275]} 100.0
d1xrta2310 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 100.0
d2eg6a1343 Dihydroorotase {Escherichia coli [TaxId: 562]} 100.0
d1i0da_331 Phosphotriesterase (parathion hydrolase, PTE) {Pse 99.79
d1ejxc1181 alpha-Subunit of urease {Klebsiella aerogenes [Tax 99.65
d1onwa1105 Isoaspartyl dipeptidase {Escherichia coli [TaxId: 99.58
d1yrra185 N-acetylglucosamine-6-phosphate deacetylase, NagA 99.57
d2p9ba1118 Uncharacterized protein BL1453 {Bifidobacterium lo 99.53
d1nfga1127 D-hydantoinase {Burkholderia pickettii [TaxId: 329 99.48
d2fvka1156 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 99.48
d1ynya1127 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 99.45
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 99.44
d2r8ca1102 Uncharacterized protein EAJ56179 {Unidentified org 99.44
d1k1da1128 D-hydantoinase {Bacillus stearothermophilus [TaxId 99.42
d1gkra1126 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 99.38
d2qs8a196 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 99.37
d1gkpa1123 D-hydantoinase {Thermus sp. [TaxId: 275]} 99.32
d1onwa2284 Isoaspartyl dipeptidase, catalytic domain {Escheri 99.26
d1m7ja155 N-acyl-D-aminoacid amidohydrolase {Alcaligenes fae 99.22
d2vhla191 N-acetylglucosamine-6-phosphate deacetylase, NagA 99.17
d1kcxa1142 Dihydropyrimidinase related protein-1 {Mouse (Mus 99.16
d2i9ua2310 Guanine deaminase {Clostridium acetobutylicum [Tax 99.08
d2ftwa1150 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 99.01
d2uz9a2313 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 99.0
d1p1ma2281 Hypothetical protein TM0936, probable catalytic do 98.92
d2vhla2301 N-acetylglucosamine-6-phosphate deacetylase, NagA, 98.86
d4ubpc1180 alpha-Subunit of urease {Bacillus pasteurii [TaxId 98.78
d1xrta1112 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 98.66
d2paja2336 Hypothetical protein GOS_1943094 {Environmental sa 98.65
d1e9yb1180 alpha-Subunit of urease {Helicobacter pylori [TaxI 98.56
d2imra2308 Hypothetical protein DR0824 {Deinococcus radiodura 98.56
d4ubpc2390 alpha-subunit of urease, catalytic domain {Bacillu 98.44
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 98.39
d1e9yb2389 alpha-subunit of urease, catalytic domain {Helicob 98.36
d1ejxc2385 alpha-subunit of urease, catalytic domain {Klebsie 98.36
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 98.35
d2bb0a2300 Imidazolonepropionase {Bacillus subtilis [TaxId: 1 98.19
d2icsa2267 Putative adenine deaminase EF0837 {Enterococcus fa 98.18
d2puza2301 Imidazolonepropionase {Agrobacterium tumefaciens [ 98.05
d2puza1103 Imidazolonepropionase {Agrobacterium tumefaciens [ 98.03
d1o12a2288 N-acetylglucosamine-6-phosphate deacetylase, NagA, 97.97
d2r8ca2311 Uncharacterized protein EAJ56179 {Unidentified org 97.89
d2q09a2301 Probable 4-imidazolone-5-propanoate amidohydrolase 97.88
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 97.76
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 97.71
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 97.68
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 97.55
d2ooda2325 Guanine deaminase {Bradyrhizobium japonicum [TaxId 97.42
d2p9ba2324 Uncharacterized protein BL1453 {Bifidobacterium lo 97.33
d1o12a176 N-acetylglucosamine-6-phosphate deacetylase, NagA 97.32
d1yrra2297 N-acetylglucosamine-6-phosphate deacetylase, NagA, 97.3
d2qs8a2310 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 97.28
d2q09a1103 Probable 4-imidazolone-5-propanoate amidohydrolase 97.1
d3be7a2303 Zn-dependent arginine carboxypeptidase {Unidentifi 96.99
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 96.61
d1ra0a1103 Cytosine deaminase {Escherichia coli [TaxId: 562]} 96.57
d2icsa1101 Putative adenine deaminase EF0837 {Enterococcus fa 96.41
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 95.35
d2hbva1331 2-amino-3-carboxymuconate 6-semialdehyde decarboxy 94.78
d1a4ma_349 Adenosine deaminase (ADA) {Mouse (Mus musculus) [T 91.75
d2gwga1342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas 88.68
d2ooda1140 Guanine deaminase {Bradyrhizobium japonicum [TaxId 88.4
d3be7a195 Zn-dependent arginine carboxypeptidase {Unidentifi 86.46
d2ffia1271 Putative 2-pyrone-4,6-dicarboxylic acid hydrolase 85.07
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 83.29
d1xp3a1297 Endonuclease IV {Bacillus anthracis [TaxId: 1392]} 82.5
>d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: Hydantoinase (dihydropyrimidinase), catalytic domain
domain: Dihydropyrimidine amidohydrolase Pyd2
species: Dictyostelium discoideum [TaxId: 44689]

Probab=100.00  E-value=1e-56  Score=428.18  Aligned_cols=302  Identities=22%  Similarity=0.280  Sum_probs=263.4

Q ss_pred             eeeeecccccCCC--CCCCccchHHHHHHHHhCCceEEEeCCCCCCCCCCcHHHHHHHHHHHhcCCeeeEEeeceecCCc
Q 015110           98 PGLIDVHAHLDDP--GRTEWEGFPSGTKAAAAGGITTLIDMPLNSDPSTISTETLKLKVDAAEKRIYVDVGFWGGLVPEN  175 (413)
Q Consensus        98 PGlID~H~H~~~~--~~~~~e~~~~~~~~al~~GvTTv~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  175 (413)
                      ||+||+|||++++  +..++|++.+++++|+++||||+++|| |+.|+....+.++.+.+.+...+.++|.++.++...+
T Consensus         1 PG~ID~HvH~reP~~G~~~kEd~~tgs~AAa~GGvTtv~~mp-n~~p~~~~~~~~~~~~~~a~~~~~~d~~~~~~~~~~~   79 (334)
T d2ftwa2           1 PGGIDTHTHFQLPFMGTVSVDDFDIGTQAAVAGGTTFIIDFV-IPTRGQSLLEAYDQWKKWADEKVNCDYSLHVAITWWS   79 (334)
T ss_dssp             ECEEEEEECTTCEETTEECSSCHHHHHHHHHHTTEEEEEEEE-CCCTTCCHHHHHHHHHHHHHTTCSSEEEEEEECCSCC
T ss_pred             CCeEcceecCCCCCCCCcccccHHHHHHHHHhCCCeEEEECC-CCCCCCCcHHHHHHHHHHHhcCCcceeeEEEeecCcc
Confidence            9999999999988  778899999999999999999999999 7778888889999888888888889999998877666


Q ss_pred             hhhHHHHHHHHH-cCCcEEEEeecCCCCCCCCCCCHHHHHHHHHHHHhcCCCEEEecCChhhchhhHhhccCcCCccccc
Q 015110          176 AYNASALEALLN-AGVLGLKSFMCPSGINDFPMTNASHIKEGLSVLARYKRPLLVHAEMEKGSERHVKLEDDTLDTRSYS  254 (413)
Q Consensus       176 ~~~~~~l~~l~~-~G~~~ik~~~~~~~~~~~~~~~~~~l~~~~~~A~~~g~~v~~H~e~~~~~~~~~~~~~~~~~~~~~~  254 (413)
                      .+...++..+.+ .|+.++|.|+....   ....+++.+.++++.++++|.++.+|+|+...+..+..... +.+..+..
T Consensus        80 ~~~~~e~~~l~~~~g~~~~k~~~~~~~---~~~~~~~~l~~~~~~~~~~~~~~~~H~E~~~~~~~~~~~~~-~~g~~~~~  155 (334)
T d2ftwa2          80 EQVSREMEILVKERGVNSFKCFMAYKN---SFMVTDQEMYHIFKRCKELGAIAQVHAENGDMVFEGQKKML-EMGITGPE  155 (334)
T ss_dssp             HHHHHHHHHHHHHSCCCEEEEESSCTT---TTBCCHHHHHHHHHHHHHHTCEEEEECSCHHHHHHHHHHHH-HTTCCSTH
T ss_pred             hhhhHhHHHHHHhcCccccceeecccc---ccccccHHHHHHHHHHhhcCCceeecchhHHHHhhcchhhh-ccCCCCcc
Confidence            666677777764 68999999986542   23468889999999999999999999999988754432211 22345566


Q ss_pred             cCCCCCchHHHHHHHHHHHHHHhhcccCCCCCCceEEEEccCChhhHHHHHHHHHHCCCCEEEEccccccccccccCCCC
Q 015110          255 TYLKTRPPSWEEAAIRELLTVAKDTRTDGPAEGAHLHIVHLSDASSSLDLLMEAKTNGDSITVETCPHYLAFSAEEIPDG  334 (413)
Q Consensus       255 ~~~~~~p~~~E~~~v~~~~~~a~~~~~~~~~~g~~vhi~H~s~~~~~~~~i~~ak~~G~~v~~e~~p~~l~l~~~~~~~~  334 (413)
                      .|..+||+.+|..++.+++.+++.+       |+|+||+|+|+. +++++|+++|++|.+|+||+|||||+|+++++...
T Consensus       156 ~~~~~rp~~aE~~~v~r~~~la~~~-------~~~lhi~HiSt~-~~~~~i~~ak~~G~~vt~e~~ph~L~l~~~~~~~~  227 (334)
T d2ftwa2         156 GHELSRPEALEAEATNRAIVIADSV-------CTPVYIVHVQSI-GAADVICKHRKEGVRVYGEPIAAGLGVDGSHMWNH  227 (334)
T ss_dssp             HHHHHSCTHHHHHHHHHHHHHHHHH-------TCCEEECSCCCH-HHHHHHHHHHHTTCCEEECCBHHHHHCCGGGGGCS
T ss_pred             cccccCcHHHHHHHHHHHHHHHHhh-------ccceeeccccch-hhhhhHHHhcccCCceeeccccceeeccHHHHhcc
Confidence            7788999999999999999999986       899999999999 99999999999999999999999999999877544


Q ss_pred             C----cceEEcCCCCCh-hcHHHHHHHHhcCCccEEcCCCCCCChhhhccCCCCccccCCCcchHhHHHHHHhhhccccC
Q 015110          335 D----TRFKCAPPIRDA-ANKEKLWEALMDGHIDMLSSDHSPTVPELKLLDEGNFLKAWGGISSLQIFCSLFFLSRGLMG  409 (413)
Q Consensus       335 ~----~~~k~~Pplr~~-~~~~~L~~~l~~G~i~~i~sDh~p~~~~~k~~~~~~~~~~~~G~~~~e~~l~~~~~~~gv~~  409 (413)
                      +    ..+|++||||++ ++|++||++|++|+||+|+|||+||+.++|..++++|+.+|+|++|+|++||+|| +++|++
T Consensus       228 d~~~~~~~~~~PPlR~~~~d~~~L~~~l~~G~Id~iaSDHaPh~~e~K~~~~~~f~~a~~Gi~glet~lpll~-~~~v~~  306 (334)
T d2ftwa2         228 DWRHAAAFVMGPPIRPDPRTKGVLMDYLARGDLDCVGTDNCTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVW-ENGVNT  306 (334)
T ss_dssp             SHHHHHTTCCSSCCCCCTTHHHHHHHHHHHTSSCCCBCCBCCCCHHHHGGGTTCGGGSCCCBCCTTTHHHHHH-HHHTTT
T ss_pred             chhhccceEeeccccccHhhhhhHHHHhhCCCccceecCCCCCCHHHHhcCCCChhhCCCCccCHHHHHHHHH-HHHHHc
Confidence            3    468999999976 5899999999999999999999999999998767789999999999999999999 579999


Q ss_pred             CCCC
Q 015110          410 GNME  413 (413)
Q Consensus       410 g~~~  413 (413)
                      |+|.
T Consensus       307 g~ls  310 (334)
T d2ftwa2         307 GKLT  310 (334)
T ss_dssp             TSSC
T ss_pred             CCCC
Confidence            9874
>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eg6a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d1ejxc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1onwa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrra1 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d1nfga1 b.92.1.3 (A:1-51,A:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d2fvka1 b.92.1.3 (A:2-56,A:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1ynya1 b.92.1.3 (A:2-52,A:385-460) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2r8ca1 b.92.1.9 (A:2-57,A:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d1k1da1 b.92.1.3 (A:1-52,A:385-460) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkra1 b.92.1.3 (A:1-54,A:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2qs8a1 b.92.1.9 (A:7-63,A:374-412) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d1gkpa1 b.92.1.3 (A:2-54,A:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ja1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ftwa1 b.92.1.3 (A:7-59,A:394-490) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1xrta1 b.92.1.3 (A:1-55,A:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d1e9yb1 b.92.1.1 (B:1-131,B:432-480) alpha-Subunit of urease {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2puza1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r8ca2 c.1.9.18 (A:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ooda2 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d1o12a1 b.92.1.5 (A:1-43,A:332-364) N-acetylglucosamine-6-phosphate deacetylase, NagA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrra2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qs8a2 c.1.9.18 (A:64-373) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d3be7a2 c.1.9.18 (A:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ra0a1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2icsa1 b.92.1.8 (A:4-54,A:322-371) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2ooda1 b.92.1.4 (A:3-72,A:398-467) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d3be7a1 b.92.1.9 (A:3-56,A:360-400) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xp3a1 c.1.15.1 (A:2-298) Endonuclease IV {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure