Citrus Sinensis ID: 015165

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTSSNPPPERQEQTPNTQVTANLLSRDGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGLNSGRSGESSTRLASVSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARLDAEERRNNMRLREEQDAAYRAALEADQARERQRREEQERLEREAAEAERKHKEEVEAREREAREAAEREAALAKMRQEKALSLGAEPEKGPNVTQVIFFLIFFPLSSMIFPLTFLQT
cccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHccccHHHHHHHHccEEEEEcccccHHHHHHHHHcccccccEEEEEEEccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccccccccccccc
cccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHEHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHHHcEEEEEEccccccccHHHHHHHcccHHHHHHHHccEEEEEcccccHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccccEEEccc
MVDVADKLAYFQAitgledpdlCTEILQAHDWDLELAIssftssnppperqeqtpntqVTANLlsrdgqnrvdrsdslgnavagpglawrIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGmlglnsgrsgesstRLASVSAAALEAMEFVAVFERdygnvkpnfvseGFMDALQRSRSVFKLLFVYLhspdhpdtpafcegtLCNEVLAAFVNENFVSwggsirasegfkmsnslkasrypfcavvMPAANQRIALLQqvegpkspEEMLMILQKVIEESNPALLQARLDAEERRNNMRLREEQDAAYRAALEADQARERQRREEQERLEREAAEAERKHKEEVEAREREAREAAEREAALAKMRQEKAlslgaepekgpnvTQVIFFLIFFplssmifpltflqt
MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTSsnppperqeqtpnTQVTANLLSRDGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGLNSGRSGESSTRLASVSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARLDAEERRNNMRLREEQDAAYRAALEADQARERQRREEQERLEREaaeaerkhkeevearEREAREAAEREAALAKMRQEKALslgaepekgpnVTQVIFFLIFFPLSSMIFPLTFLQT
MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTSSNPPPERQEQTPNTQVTANLLSRDGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISAsiglvsgavglglwaaggvlsYSLGMLGLNSGRSGESSTRLASVSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARLDAeerrnnmrlreeQDAAYraaleadqarerqrreeqerlereaaeaerkhkeevearereareaaereaalakMRQEKALSLGAEPEKGPNVTQVIFFLIFFPLSSMIFPLTFLQT
****ADKLAYFQAITGLEDPDLCTEILQAHDWDLELAIS****************************************NAVAGPGLAWRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGLN*************VSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQ**********LMILQKV*********************************************************************************************************VTQVIFFLIFFPLSSMIFPLTFL**
**DVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISS************************************************WRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGL***********************EFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPA*****************************************************************************************************VIFFLIFFPLSSMIFPLTFL**
MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFT***************QVTANLLSRDGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGLNS*************SAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARLDAEERRNNMRLREEQDAAYRAALE************************************************AKMRQEKALSLGAEPEKGPNVTQVIFFLIFFPLSSMIFPLTFLQT
*VDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTSS************************************AVAGPGLAWRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGLNS**********ASVSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARLDAEERRNNMRLREEQDAAYRAALEADQARERQR******************************************R*EKALSLGAEPEKGPNVTQVIFFLIFFPLSSMIFPLTFLQT
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTSSNPPPERQEQTPNTQVTANLLSRDGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISASIGLVSGAVGLGLWAAGGVLSYSLGMLGLNSGRSGESSTRLASVSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARLDAEERRNNMRLREEQDAAYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKALSLGAEPEKGPNVTQVIFFLIFFPLSSMIFPLTFLQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query412 2.2.26 [Sep-21-2011]
Q6GQ69445 FAS-associated factor 2-B N/A no 0.842 0.779 0.288 2e-39
Q28BP9445 FAS-associated factor 2 O yes no 0.837 0.775 0.292 2e-33
Q96CS3445 FAS-associated factor 2 O yes no 0.684 0.633 0.268 1e-31
Q6AZH6445 FAS-associated factor 2-A N/A no 0.830 0.768 0.287 3e-31
Q2HJD0445 FAS-associated factor 2 O yes no 0.684 0.633 0.268 3e-31
Q3TDN2445 FAS-associated factor 2 O yes no 0.684 0.633 0.262 9e-30
Q5BK32346 FAS-associated factor 2 O yes no 0.434 0.517 0.311 2e-24
Q924K2649 FAS-associated factor 1 O no no 0.478 0.303 0.270 3e-14
Q9UNN5650 FAS-associated factor 1 O no no 0.478 0.303 0.270 3e-14
P54731649 FAS-associated factor 1 O no no 0.478 0.303 0.270 4e-14
>sp|Q6GQ69|FAF2B_XENLA FAS-associated factor 2-B OS=Xenopus laevis GN=faf2-b PE=2 SV=1 Back     alignment and function desciption
 Score =  163 bits (413), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 115/399 (28%), Positives = 188/399 (47%), Gaps = 52/399 (13%)

Query: 3   DVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISS-FTSSNPPPERQEQTPNTQVTA 61
           D  +KL  FQ +TG+E  D C + LQ H+W++E A+          P     TPN  +  
Sbjct: 12  DQTEKLLQFQDLTGIESIDQCRQTLQQHNWNIETAVQDRLNEQEGVPRVFNTTPNRPLQV 71

Query: 62  NLLSRDGQNRVDRSDSLGNAVAGP------GLAWRIITLPYSVISASIGLVSGAVGLGLW 115
           N       +RV         V+ P      G  + +I LP+ +                +
Sbjct: 72  NT----ADHRV-----YSYVVSRPQPRGLLGWGYYLIMLPFRIT--------------YY 108

Query: 116 AAGGVLSYSLGMLGLNSGRSGESSTRLASVSAAALEAMEFVAVFERDYGNVKPNFVSEGF 175
               +  ++L  +  +           + V+    + + F+ +FE  YG+  P F    +
Sbjct: 109 TVLDIFRFALRFIRPDPR---------SRVTDPVGDVVSFIHLFEEKYGSTHPVFYQGTY 159

Query: 176 MDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGF 235
             AL  ++   + L VYLH  DH D+  FC  TLC   +  F+N   + W  S    EGF
Sbjct: 160 SQALNDAKQELRFLLVYLHGEDHQDSDDFCRNTLCTSEVTHFINSRMLFWACSSNKPEGF 219

Query: 236 KMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQARL 295
           ++S +L  S YPF A++M   ++R+ ++ ++EG   P++++  L  +IE +   L+  RL
Sbjct: 220 RVSQALHESTYPFLAMIM-LKDRRMTVVGRLEGLIQPQDLINQLTFIIEANQTYLVSERL 278

Query: 296 DAEERRNNMRLREEQDAAYRAALEADQARERQRREEQERLEREAAEAERKHKEEVEARER 355
           + EER     LR++QD AY  +L ADQ +ER+++E+Q++  RE  EA+RK   E E ++R
Sbjct: 279 EREERNQTQVLRQQQDEAYLVSLRADQEKERKKKEKQDQKRREEEEAQRKQMLE-ERKKR 337

Query: 356 EAREAAEREAALAKMRQEKALSLGAEP-EKGPNVTQVIF 393
              E  ER          K+  L AEP    P+  ++IF
Sbjct: 338 NLEEEKER----------KSECLPAEPVPDHPDNVKIIF 366

Xenopus laevis (taxid: 8355)
>sp|Q28BP9|FAF2_XENTR FAS-associated factor 2 OS=Xenopus tropicalis GN=faf2 PE=2 SV=1 Back     alignment and function description
>sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens GN=FAF2 PE=1 SV=2 Back     alignment and function description
>sp|Q6AZH6|FAF2A_XENLA FAS-associated factor 2-A OS=Xenopus laevis GN=faf2-a PE=2 SV=1 Back     alignment and function description
>sp|Q2HJD0|FAF2_BOVIN FAS-associated factor 2 OS=Bos taurus GN=FAF2 PE=2 SV=1 Back     alignment and function description
>sp|Q3TDN2|FAF2_MOUSE FAS-associated factor 2 OS=Mus musculus GN=Faf2 PE=2 SV=2 Back     alignment and function description
>sp|Q5BK32|FAF2_RAT FAS-associated factor 2 OS=Rattus norvegicus GN=Faf2 PE=2 SV=1 Back     alignment and function description
>sp|Q924K2|FAF1_RAT FAS-associated factor 1 OS=Rattus norvegicus GN=Faf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UNN5|FAF1_HUMAN FAS-associated factor 1 OS=Homo sapiens GN=FAF1 PE=1 SV=2 Back     alignment and function description
>sp|P54731|FAF1_MOUSE FAS-associated factor 1 OS=Mus musculus GN=Faf1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query412
15236931480 UBX domain-containing protein [Arabidops 0.956 0.820 0.723 1e-149
225426641470 PREDICTED: FAS-associated factor 2-B-lik 0.956 0.838 0.748 1e-149
3600032466 contains similarity to tropomyosin (Pfam 0.922 0.815 0.694 1e-144
255555707471 UBX domain-containing protein, putative 0.961 0.840 0.745 1e-143
224058028473 predicted protein [Populus trichocarpa] 0.961 0.837 0.737 1e-140
224072270474 predicted protein [Populus trichocarpa] 0.961 0.835 0.725 1e-140
449452198467 PREDICTED: FAS-associated factor 2-B-lik 0.953 0.841 0.744 1e-138
356576614430 PREDICTED: FAS-associated factor 2-B-lik 0.873 0.837 0.714 1e-138
356535284465 PREDICTED: FAS-associated factor 2-B-lik 0.944 0.836 0.723 1e-133
297813531478 hypothetical protein ARALYDRAFT_489923 [ 0.939 0.809 0.674 1e-131
>gi|15236931|ref|NP_192817.1| UBX domain-containing protein [Arabidopsis thaliana] gi|7267777|emb|CAB81180.1| predicted protein of unknown function [Arabidopsis thaliana] gi|332657529|gb|AEE82929.1| UBX domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 301/416 (72%), Positives = 333/416 (80%), Gaps = 22/416 (5%)

Query: 1   MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTS----------SNPPPER 50
           MVD  DKL YFQAITGLED DLCTEILQAH WDLELAISSFTS                R
Sbjct: 1   MVDTVDKLGYFQAITGLEDADLCTEILQAHGWDLELAISSFTSSDQDASSSAVDGGGNNR 60

Query: 51  QEQTPNTQVTANLLSR---DGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISASIGLVS 107
                N  VT +   R   D    V R D  GN   GPG+AWRIITLP S++S S+GLVS
Sbjct: 61  DHDHNNATVTPDYPPRGIVDDTELVMRDDGGGNR--GPGVAWRIITLPISIVSGSLGLVS 118

Query: 108 GAVGLGLWAAGGVLSYSLGMLGLNSGRSGES-STRLASVSAAALEAMEFVAVFERDYGN- 165
           GA+GLG+WAAGGVLSYSLGMLG  SGR G S S RL SVS+A  EAMEFVA+F+RDYG+ 
Sbjct: 119 GAIGLGIWAAGGVLSYSLGMLGFRSGRGGGSESARLVSVSSAVGEAMEFVALFDRDYGSN 178

Query: 166 --VKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFV 223
              K +FV EGFMDALQRSRS FKLLFVYLHSPDHPDTP FC GTLCNE + AFVNENFV
Sbjct: 179 NAFKIDFVVEGFMDALQRSRSSFKLLFVYLHSPDHPDTPVFCGGTLCNEAVVAFVNENFV 238

Query: 224 SWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVI 283
           SWGGSIR+SEGFKMSNSLKASR+PFCAVVMPAANQRIALLQQVEGPKSPEEML ILQ+++
Sbjct: 239 SWGGSIRSSEGFKMSNSLKASRFPFCAVVMPAANQRIALLQQVEGPKSPEEMLAILQRIV 298

Query: 284 EESNPALLQARLDAEERRNNMRLREEQDAAYRAALEADQARERQRREEQERLEREAAEAE 343
           E+S+P L+ AR++AEERR N+RLREEQDAAYRAALEADQARE+QR+EE+ERLEREAAEAE
Sbjct: 299 EDSSPTLVTARVEAEERRTNLRLREEQDAAYRAALEADQAREQQRQEEKERLEREAAEAE 358

Query: 344 RKHKEEVEAREREAREAAEREAALAKMRQEKALSLGAEPEKGPNVTQVIFFLIFFP 399
           RK KEE EARER AREA ER+AA  +MRQEKAL+LG EPEKGP+VTQV   L+ FP
Sbjct: 359 RKLKEEEEARERAAREAEERQAARVRMRQEKALALGEEPEKGPDVTQV---LVRFP 411

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225426641|ref|XP_002281109.1| PREDICTED: FAS-associated factor 2-B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|3600032|gb|AAC35520.1| contains similarity to tropomyosin (Pfam: Tropomyosin.hmm, score: 14.57) and ATP synthase (Pfam: ATP-synt_B.hmm, score: 10.89) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255555707|ref|XP_002518889.1| UBX domain-containing protein, putative [Ricinus communis] gi|223541876|gb|EEF43422.1| UBX domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224058028|ref|XP_002299437.1| predicted protein [Populus trichocarpa] gi|222846695|gb|EEE84242.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072270|ref|XP_002303682.1| predicted protein [Populus trichocarpa] gi|222841114|gb|EEE78661.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449452198|ref|XP_004143847.1| PREDICTED: FAS-associated factor 2-B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356576614|ref|XP_003556425.1| PREDICTED: FAS-associated factor 2-B-like [Glycine max] Back     alignment and taxonomy information
>gi|356535284|ref|XP_003536178.1| PREDICTED: FAS-associated factor 2-B-like [Glycine max] Back     alignment and taxonomy information
>gi|297813531|ref|XP_002874649.1| hypothetical protein ARALYDRAFT_489923 [Arabidopsis lyrata subsp. lyrata] gi|297320486|gb|EFH50908.1| hypothetical protein ARALYDRAFT_489923 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query412
TAIR|locus:2132751480 AT4G10790 [Arabidopsis thalian 0.757 0.65 0.628 8.2e-106
ZFIN|ZDB-GENE-050208-312445 faf2 "Fas associated factor fa 0.395 0.366 0.310 5.3e-30
UNIPROTKB|F1NUY5452 FAF2 "Uncharacterized protein" 0.395 0.360 0.292 3e-28
UNIPROTKB|E2R2I4445 FAF2 "Uncharacterized protein" 0.395 0.366 0.280 4.5e-25
UNIPROTKB|Q96CS3445 FAF2 "FAS-associated factor 2" 0.395 0.366 0.280 4.5e-25
UNIPROTKB|F1S399445 FAF2 "Uncharacterized protein" 0.395 0.366 0.280 7.3e-25
UNIPROTKB|Q2HJD0445 FAF2 "FAS-associated factor 2" 0.395 0.366 0.280 1.3e-24
MGI|MGI:1923827445 Faf2 "Fas associated factor fa 0.395 0.366 0.274 2.2e-23
FB|FBgn0025608464 Faf "Fas-associated factor" [D 0.393 0.349 0.289 8.2e-19
ASPGD|ASPL0000057654512 AN0770 [Emericella nidulans (t 0.432 0.347 0.265 4.5e-18
TAIR|locus:2132751 AT4G10790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 966 (345.1 bits), Expect = 8.2e-106, Sum P(2) = 8.2e-106
 Identities = 208/331 (62%), Positives = 229/331 (69%)

Query:     1 MVDVADKLAYFQAITGLEDPDLCTEILQAHDWDLELAISSFTSSNPPPE----------R 50
             MVD  DKL YFQAITGLED DLCTEILQAH WDLELAISSFTSS+              R
Sbjct:     1 MVDTVDKLGYFQAITGLEDADLCTEILQAHGWDLELAISSFTSSDQDASSSAVDGGGNNR 60

Query:    51 QEQTPNTQVTANLLSR---DGQNRVDRSDSLGNAVAGPGLAWRIITLPYSVISAXXXXXX 107
                  N  VT +   R   D    V R D  GN   GPG+AWRIITLP S++S       
Sbjct:    61 DHDHNNATVTPDYPPRGIVDDTELVMRDDGGGNR--GPGVAWRIITLPISIVSGSLGLVS 118

Query:   108 XXXXXXXXXXXXXXXYSLGMLGLNSGRSGES-STRLASVSAAALEAMEFVAVFERDYGN- 165
                            YSLGMLG  SGR G S S RL SVS+A  EAMEFVA+F+RDYG+ 
Sbjct:   119 GAIGLGIWAAGGVLSYSLGMLGFRSGRGGGSESARLVSVSSAVGEAMEFVALFDRDYGSN 178

Query:   166 --VKPNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFV 223
                K +FV EGFMDALQRSRS FKLLFVYLHSPDHPDTP FC GTLCNE + AFVNENFV
Sbjct:   179 NAFKIDFVVEGFMDALQRSRSSFKLLFVYLHSPDHPDTPVFCGGTLCNEAVVAFVNENFV 238

Query:   224 SWGGSIRASEGFKMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVI 283
             SWGGSIR+SEGFKMSNSLKASR+PFCAVVMPAANQRIALLQQVEGPKSPEEML ILQ+++
Sbjct:   239 SWGGSIRSSEGFKMSNSLKASRFPFCAVVMPAANQRIALLQQVEGPKSPEEMLAILQRIV 298

Query:   284 EESNPALLQARLDAXXXXXXXXXXXXQDAAY 314
             E+S+P L+ AR++A            QDAAY
Sbjct:   299 EDSSPTLVTARVEAEERRTNLRLREEQDAAY 329
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0005886 "plasma membrane" evidence=IDA
ZFIN|ZDB-GENE-050208-312 faf2 "Fas associated factor family member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUY5 FAF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2I4 FAF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96CS3 FAF2 "FAS-associated factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S399 FAF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJD0 FAF2 "FAS-associated factor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1923827 Faf2 "Fas associated factor family member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0025608 Faf "Fas-associated factor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000057654 AN0770 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT4G10790
UBX domain-containing protein; UBX domain-containing protein; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- UAS (InterPro-IPR006577), UBX (InterPro-IPR001012); BEST Arabidopsis thaliana protein match is- SAY1 (TAIR-AT4G11740.1); Has 16384 Blast hits to 7928 proteins in 781 species- Archae - 7; Bacteria - 2234; Metazoa - 5947; Fungi - 1696; Plants - 733; Viruses - 184; Other Eukaryotes - 5583 (source- NCBI BLink). (480 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT2G04870
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (72 aa)
      • 0.966
AT1G26330
DNA binding; DNA binding; FUNCTIONS IN- DNA binding; INVOLVED IN- biological_process unknown; L [...] (1189 aa)
      • 0.966
AT1G25570
leucine-rich repeat protein-related; leucine-rich repeat protein-related; FUNCTIONS IN- protein [...] (628 aa)
      • 0.966
AtGRF6
AtGRF6 (GROWTH-REGULATING FACTOR 6); transcription activator; Growth regulating factor encoding [...] (244 aa)
      • 0.927
AT1G42980
formin homology 2 domain-containing protein / FH2 domain-containing protein; formin homology 2 [...] (299 aa)
      • 0.921
AT5G56000
heat shock protein 81-4 (HSP81-4); heat shock protein 81-4 (HSP81-4); FUNCTIONS IN- unfolded pr [...] (699 aa)
      • 0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
smart00594122 smart00594, UAS, UAS domain 3e-39
cd02958114 cd02958, UAS, UAS family; UAS is a domain of unkno 2e-36
cd02991116 cd02991, UAS_ETEA, UAS family, ETEA subfamily; com 1e-20
TIGR02794 346 TIGR02794, tolA_full, TolA protein 7e-07
PLN03086 567 PLN03086, PLN03086, PRLI-interacting factor K; Pro 2e-06
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 5e-06
TIGR02794 346 TIGR02794, tolA_full, TolA protein 2e-05
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 2e-05
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-05
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 3e-05
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 3e-05
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 3e-05
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 5e-05
PRK05035 695 PRK05035, PRK05035, electron transport complex pro 6e-05
pfam09756189 pfam09756, DDRGK, DDRGK domain 7e-05
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 1e-04
COG3064 387 COG3064, TolA, Membrane protein involved in colici 2e-04
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 3e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 6e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 6e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 7e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 8e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
cd02990136 cd02990, UAS_FAF1, UAS family, FAS-associated fact 0.001
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 0.001
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 0.002
pfam09660478 pfam09660, DUF2397, Protein of unknown function (D 0.002
PRK05035 695 PRK05035, PRK05035, electron transport complex pro 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
pfam1284885 pfam12848, ABC_tran_2, ABC transporter 0.003
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 0.003
PRK11637 428 PRK11637, PRK11637, AmiB activator; Provisional 0.004
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
pfam05262 489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.004
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI su 0.004
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisi 0.004
>gnl|CDD|214737 smart00594, UAS, UAS domain Back     alignment and domain information 
 Score =  136 bits (344), Expect = 3e-39
 Identities = 42/114 (36%), Positives = 61/114 (53%), Gaps = 1/114 (0%)

Query: 168 PNFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGG 227
           P F       A Q +    +LL++YLHS D PD+  F    LCNE + + + ENF+ W  
Sbjct: 9   PLFYQGSLEAAKQEASRQRRLLWLYLHSQDSPDSQVFNRDVLCNEAVKSLIRENFIFWQV 68

Query: 228 SIRASEGFKMSNSLKASRYPFCAVVMPAANQR-IALLQQVEGPKSPEEMLMILQ 280
            +  SEG ++S   K   +P+ A+V P   QR I  +  VEG  SPEE++  L+
Sbjct: 69  DVDTSEGQRVSQFYKLDSFPYVAIVDPRTGQRVIEWVGVVEGEISPEELMTFLE 122

Length = 122
>gnl|CDD|239256 cd02958, UAS, UAS family; UAS is a domain of unknown function Back     alignment and domain information
>gnl|CDD|239289 cd02991, UAS_ETEA, UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|239288 cd02990, UAS_FAF1, UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|220331 pfam09660, DUF2397, Protein of unknown function (DUF2397) Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221805 pfam12848, ABC_tran_2, ABC transporter Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 412
KOG1363460 consensus Predicted regulator of the ubiquitin pat 100.0
cd02990136 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 100.0
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 99.98
smart00594122 UAS UAS domain. 99.94
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.9
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 99.38
KOG1364356 consensus Predicted ubiquitin regulatory protein, 99.28
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 99.17
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 99.17
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 98.95
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 98.88
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.81
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 98.68
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.43
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.32
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.23
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.21
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.13
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 98.01
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 97.61
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 97.59
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.52
PRK10996139 thioredoxin 2; Provisional 97.52
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 97.51
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 97.4
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 97.3
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.29
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.2
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 97.14
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 97.12
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 97.11
cd0294793 TRX_family TRX family; composed of two groups: Gro 97.1
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 97.05
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 96.94
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 96.9
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 96.87
PRK09381109 trxA thioredoxin; Provisional 96.86
KOG1363460 consensus Predicted regulator of the ubiquitin pat 96.78
COG4232569 Thiol:disulfide interchange protein [Posttranslati 96.75
PHA02278103 thioredoxin-like protein 96.75
TIGR02739256 TraF type-F conjugative transfer system pilin asse 96.72
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 96.71
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 96.64
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 96.63
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 96.53
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 96.5
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 96.46
PTZ0005198 thioredoxin; Provisional 96.43
PRK13703248 conjugal pilus assembly protein TraF; Provisional 96.39
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 96.39
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.32
PRK03147173 thiol-disulfide oxidoreductase; Provisional 96.27
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 96.24
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 96.21
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 96.19
TIGR02740271 TraF-like TraF-like protein. This protein is relat 96.18
PTZ00443224 Thioredoxin domain-containing protein; Provisional 96.18
PF13728215 TraF: F plasmid transfer operon protein 96.17
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 96.13
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 96.06
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 96.03
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 95.99
KOG0907106 consensus Thioredoxin [Posttranslational modificat 95.98
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 95.96
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 95.96
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 95.92
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 95.87
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 95.82
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 95.74
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 95.73
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 95.68
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 95.64
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 95.56
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 95.52
COG1331 667 Highly conserved protein containing a thioredoxin 95.45
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 95.13
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 94.97
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 94.94
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 94.88
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 94.76
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 94.71
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 94.6
PTZ00102 477 disulphide isomerase; Provisional 94.44
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 94.42
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 94.39
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 94.18
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 94.0
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 93.94
cd02962152 TMX2 TMX2 family; composed of proteins similar to 93.83
PTZ00062204 glutaredoxin; Provisional 93.79
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 93.6
PRK13728181 conjugal transfer protein TrbB; Provisional 93.11
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 93.1
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 92.59
PLN02309457 5'-adenylylsulfate reductase 92.58
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 92.49
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 92.4
KOG4351244 consensus Uncharacterized conserved protein [Funct 92.27
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 92.21
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 92.17
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 91.89
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 91.67
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 91.58
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 91.53
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 91.41
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 91.36
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 91.14
PTZ00102477 disulphide isomerase; Provisional 90.8
KOG4364 811 consensus Chromatin assembly factor-I [Chromatin s 90.42
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 90.39
PF07946321 DUF1682: Protein of unknown function (DUF1682); In 90.3
KOG3878 469 consensus Protein involved in maintenance of Golgi 90.22
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 89.76
PTZ00121 2084 MAEBL; Provisional 89.68
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 89.62
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 89.37
COG3118304 Thioredoxin domain-containing protein [Posttransla 89.24
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 89.2
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 88.9
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 88.76
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 88.19
KOG2072 988 consensus Translation initiation factor 3, subunit 88.09
smart0054643 CUE Domain that may be involved in binding ubiquit 87.56
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 87.15
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 86.76
PHA0212575 thioredoxin-like protein 86.75
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 86.73
PF15236157 CCDC66: Coiled-coil domain-containing protein 66 86.18
PRK00247429 putative inner membrane protein translocase compon 86.09
PF15236157 CCDC66: Coiled-coil domain-containing protein 66 86.02
KOG4691227 consensus Uncharacterized conserved protein [Funct 85.44
KOG4364 811 consensus Chromatin assembly factor-I [Chromatin s 85.0
COG4942 420 Membrane-bound metallopeptidase [Cell division and 84.8
cd02967114 mauD Methylamine utilization (mau) D family; mauD 84.78
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 84.74
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 83.89
PRK15000200 peroxidase; Provisional 82.94
PRK13190202 putative peroxiredoxin; Provisional 82.85
PTZ00056199 glutathione peroxidase; Provisional 81.76
PRK13189222 peroxiredoxin; Provisional 80.58
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-39  Score=332.00  Aligned_cols=242  Identities=32%  Similarity=0.508  Sum_probs=198.9

Q ss_pred             hhHHHHH-HHHHHHHHhCCCCCCCccCCHHHHHHHHH----hcCcEEEEEEeCCCCCChhHHHhhcCCChHHHHHHhcCe
Q 015165          148 AALEAME-FVAVFERDYGNVKPNFVSEGFMDALQRSR----SVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENF  222 (412)
Q Consensus       148 ~~~~~~~-F~~~f~~~yg~~~p~F~~gs~~eAl~~Ak----~e~K~LlVyLh~~~~~~s~~F~r~vL~~~~v~~~l~~nf  222 (412)
                      +.+++.+ |++.|.++||..||.||.|++..|...|.    ..+|+|++|+|++.++++..||.++|||+.|++||+++|
T Consensus       139 p~~~~~~~f~~~f~~ry~~~~p~F~~d~l~~a~~~A~~~~~~~~~~l~~~~~~~~~~~~~~F~~~iL~~e~v~~~l~~~~  218 (460)
T KOG1363|consen  139 PQGDSRETFVDNFGDRYGSELPSFYTDVLRNAFLEAFDRESEARKLLAIYLHDDKSDDTNVFCGQILCNEAVVDYLRENF  218 (460)
T ss_pred             CcchHHHHHHHHHHHhcCCCCCccchhHHHHHHHHHHhhhhhhheeeEEecCCCCcccHHHHHHhhhhhHHHHHHHhhce
Confidence            3456656 99999999999999999999888888775    347999999999999999999999999999999999999


Q ss_pred             EEEecccCChhHHHHHhhCCCC----------------CCceEEEEeCCCCccceeeeeeecCCCHHHHHHHHHHHHHhh
Q 015165          223 VSWGGSIRASEGFKMSNSLKAS----------------RYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEES  286 (412)
Q Consensus       223 V~w~~dv~~~Eg~~va~~l~~~----------------~~P~l~lI~~~~~~~~~vl~ri~G~~s~~~ll~~L~~~ie~~  286 (412)
                      |+|+|||++++++.+++.+++.                +||.+.+|.... +..+++..++|..+.++.+..+..+++.+
T Consensus       219 llw~~dvt~~e~~~~~~~~~~r~~~~~~~~~~~~~~~~~fP~~~iv~~~~-~~~Ell~~l~g~~~~~e~~~~~~~~~~~~  297 (460)
T KOG1363|consen  219 LLWGWDVTESENLLVFNSLLNRSISSPAAVTNKASKSERFPLVRIVIGSR-SPEELLRYLQGVTGVDEEMTLLLVAFEEE  297 (460)
T ss_pred             eeecccccCchhhHHHHHHhhcccchhhhhhcchhhcccCchhhhhhcCC-CHHHHHHHHHhcCCchHHHHHHHhhhhhh
Confidence            9999999999999999998888                799999998765 46889999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 015165          287 NPALLQARLDAEERRNNMRLREEQDAAYRAALEADQARERQRREEQERLEREAAEAERKHKEEVEAREREAREAAEREAA  366 (412)
Q Consensus       287 ~~~L~~~r~er~er~~~R~lreeQD~aY~~SL~~D~ek~~~r~ee~er~~~~~~e~e~~~~e~ee~~~~~~~e~~~~~~~  366 (412)
                      .+.+...+.++.+++.+..+++|||.+|+.||++|+.|+.++    ++ +.+++..+.+++++          ++++  .
T Consensus       298 ~~~~q~~~~~~~er~~r~~~~~eQd~eyq~sle~Dr~r~~e~----e~-~~e~~r~e~er~~~----------~ee~--e  360 (460)
T KOG1363|consen  298 ERRLQMRRSEQDEREARLALEQEQDDEYQASLEADRVREAEA----EQ-AAEEFRLEKERKEE----------EEER--E  360 (460)
T ss_pred             hHHHhhcccchhHHHHHHHHHHhhHHHHHHHHHHHHHHHHHH----HH-hhHHHHHhhhhhhH----------HHHH--H
Confidence            999998888888998888999999999999999999982111    11 11111111111111          1122  2


Q ss_pred             HHHHHHHHHhhCCCCCC-CCCCceeEeecceecCCCCcccccccCC
Q 015165          367 LAKMRQEKALSLGAEPE-KGPNVTQVIFFLIFFPLSSMIFPLTFLQ  411 (412)
Q Consensus       367 ~~~~r~~~~~~lp~EP~-~~~~~~~v~~~~~RlP~G~ri~~~~~~~  411 (412)
                      ..+++.++.+.||+||+ .+.++++|+   ||+|+|+|. .|||++
T Consensus       361 ~~R~~l~~es~lp~EP~a~~~~~~~l~---iR~P~G~r~-~RrF~~  402 (460)
T KOG1363|consen  361 TARQLLALESSLPPEPSASEEEAITVA---IRLPSGTRL-ERRFLK  402 (460)
T ss_pred             HHHHHHhhhccCCCCCCcCcccceeeE---EECCCCCee-eeeeec
Confidence            23457788999999994 468899999   999999999 667765

>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG4351 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3878 consensus Protein involved in maintenance of Golgi structure and ER-Golgi transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PF15236 CCDC66: Coiled-coil domain-containing protein 66 Back     alignment and domain information
>PRK00247 putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>PF15236 CCDC66: Coiled-coil domain-containing protein 66 Back     alignment and domain information
>KOG4691 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
2ec4_A178 Solution Structure Of The Uas Domain From Human Fas 8e-08
>pdb|2EC4|A Chain A, Solution Structure Of The Uas Domain From Human Fas- Associated Factor 1 Length = 178 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 27/174 (15%)
Query: 131 NSGRSGESSTRLASVSAAALEAMEFVAVFERDYGNVKPNF----VSEGFMDALQRSRSVF 186
           +SG SGE+    A     AL  ++F A F   YG+  P F    +   F +A        
Sbjct: 2   SSGSSGEN----AENEGDAL--LQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDR 55
Query: 187 KLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEG----FKMSN--- 239
           KLL +YLH  +   T  FC   LC E + +++++NF++W   +           M N   
Sbjct: 56  KLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHF 115
Query: 240 ---------SLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIE 284
                    + K  ++P   ++M   +    +L  ++G  + +E++M L   +E
Sbjct: 116 GSVVAQTIRTQKTDQFPLFLIIMGKRSSN-EVLNVIQGNTTVDELMMRLMAAME 168

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 3e-40
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 4e-19
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 2e-11
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-10
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-07
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-05
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-05
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 1e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 4e-04
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 178 Back     alignment and structure
 Score =  140 bits (354), Expect = 3e-40
 Identities = 35/177 (19%), Positives = 69/177 (38%), Gaps = 21/177 (11%)

Query: 136 GESSTRLASVSAAALEAMEFVAVFERDYGNVKPNF----VSEGFMDALQRSRSVFKLLFV 191
           G S +   +        ++F A F   YG+  P F    +   F +A        KLL +
Sbjct: 1   GSSGSSGENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAI 60

Query: 192 YLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGF---------------- 235
           YLH  +   T  FC   LC E + +++++NF++W   +                      
Sbjct: 61  YLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVA 120

Query: 236 KMSNSLKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESNPALLQ 292
           +   + K  ++P   ++M   +    +L  ++G  + +E++M L   +E       +
Sbjct: 121 QTIRTQKTDQFPLFLIIMGKRS-SNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQE 176
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Length = 45 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query412
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 100.0
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.79
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 99.42
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 99.25
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 99.19
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 98.95
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 98.93
2kuc_A130 Putative disulphide-isomerase; structural genomics 98.91
3f9u_A172 Putative exported cytochrome C biogenesis-related; 98.86
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 98.84
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 98.28
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 98.74
3ira_A173 Conserved protein; methanosarcina mazei,structural 98.52
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 98.49
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 98.39
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.02
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 97.93
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 97.89
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 97.89
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.88
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 97.87
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 97.86
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 97.84
2l57_A126 Uncharacterized protein; structural genomics, unkn 97.84
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.83
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 97.81
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 97.81
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 97.8
2yzu_A109 Thioredoxin; redox protein, electron transport, st 97.79
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.79
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 97.79
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 97.77
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 97.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.75
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.73
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.72
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 97.72
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 97.71
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.7
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 97.7
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 97.7
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 97.7
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 97.69
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 97.68
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 97.66
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 97.66
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 97.64
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 97.63
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 97.63
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 97.62
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 97.62
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.59
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 97.59
4euy_A105 Uncharacterized protein; structural genomics, PSI- 97.57
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 97.57
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 97.57
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 97.56
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 97.55
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.54
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 97.47
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 97.47
1zma_A118 Bacterocin transport accessory protein; alpha-beta 97.47
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 97.45
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 97.45
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 97.43
2l5o_A153 Putative thioredoxin; structural genomics, unknown 97.4
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 97.4
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.39
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 97.39
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.39
2l5l_A136 Thioredoxin; structural genomics, electron transpo 97.36
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.35
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 97.34
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 97.31
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 97.3
1wmj_A130 Thioredoxin H-type; structural genomics, program f 97.29
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 97.28
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 97.28
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 97.27
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.26
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 97.25
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 97.25
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 97.24
3raz_A151 Thioredoxin-related protein; structural genomics, 97.23
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.23
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 97.23
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 97.22
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 97.18
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 97.17
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 97.17
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 97.17
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 97.17
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 97.17
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 97.14
1mek_A120 Protein disulfide isomerase; electron transport, r 97.11
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 97.1
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 97.07
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.07
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.06
4evm_A138 Thioredoxin family protein; structural genomics, n 97.05
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 97.05
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 96.11
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.02
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 96.99
2qsi_A137 Putative hydrogenase expression/formation protein; 96.93
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 96.89
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 96.89
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 96.88
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 96.87
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 96.86
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 96.81
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 96.8
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 96.78
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 96.7
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 96.68
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 96.64
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 96.58
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 96.57
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 96.56
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 96.56
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 96.53
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 96.51
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 96.5
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 96.46
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 96.46
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 96.46
2lrn_A152 Thiol:disulfide interchange protein; structural ge 96.44
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 96.42
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 96.39
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.3
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 96.3
2lrt_A152 Uncharacterized protein; structural genomics, thio 96.29
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 96.16
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 96.15
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 96.15
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 96.11
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 96.09
1wji_A63 Tudor domain containing protein 3; UBA domain, str 95.98
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 95.94
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 95.92
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 95.91
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 95.91
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 95.89
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 95.88
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 95.83
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 95.77
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 95.75
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 95.69
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 95.63
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 95.61
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 95.61
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 95.6
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 95.6
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 95.55
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 95.44
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 95.32
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 95.26
2l2d_A73 OTU domain-containing protein 7A; UBA fold, struct 95.24
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.22
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 95.21
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 95.18
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.16
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 95.15
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 95.1
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 95.09
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 95.08
2ywi_A196 Hypothetical conserved protein; uncharacterized co 95.05
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 94.97
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 94.89
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 94.85
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 94.79
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 94.79
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 94.79
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 94.77
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 94.71
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 94.7
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 94.59
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 94.56
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 94.52
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 94.47
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 94.25
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 94.23
2cwb_A108 Chimera of immunoglobulin G binding protein G and 94.22
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 93.97
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 93.9
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 93.84
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 93.76
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 93.76
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 93.74
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 93.67
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 93.66
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 93.36
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 93.32
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 92.97
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 92.95
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 92.93
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 92.79
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 92.79
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 92.76
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 92.74
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 92.73
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 92.67
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 92.62
2ls5_A159 Uncharacterized protein; structural genomics, unkn 91.8
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 92.55
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 92.37
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 92.26
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 92.23
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 92.09
2lva_A129 Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi 91.21
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 91.83
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 91.79
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 91.53
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 91.5
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 91.39
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 91.39
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 90.7
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 90.47
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 90.32
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 89.33
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 89.31
2dna_A67 Unnamed protein product; ubiquitin associated doma 89.31
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 89.25
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 88.75
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 88.85
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 88.81
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 88.73
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 88.47
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 87.51
2jsy_A167 Probable thiol peroxidase; solution structure, ant 87.37
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 87.02
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 87.01
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 86.57
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 86.56
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 86.16
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 86.11
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 86.04
3keb_A224 Probable thiol peroxidase; structural genomics, AP 85.43
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 85.17
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 85.05
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 84.62
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 84.39
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 83.98
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 83.52
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 82.73
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 82.69
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 82.54
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 82.49
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 81.93
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 81.17
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 80.34
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=6.1e-37  Score=279.12  Aligned_cols=146  Identities=23%  Similarity=0.475  Sum_probs=138.1

Q ss_pred             cchhhHHHHHHHHHHHHHhCCCCCCCccCCHHHHHHHH----HhcCcEEEEEEeCCCCCChhHHHhhcCCChHHHHHHhc
Q 015165          145 VSAAALEAMEFVAVFERDYGNVKPNFVSEGFMDALQRS----RSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNE  220 (412)
Q Consensus       145 ~~~~~~~~~~F~~~f~~~yg~~~p~F~~gs~~eAl~~A----k~e~K~LlVyLh~~~~~~s~~F~r~vL~~~~v~~~l~~  220 (412)
                      +.||.+++.+|+++|+++||..||.||.|+|++|++.|    |++.|||+||||+++|++|+.||++||||++|++||++
T Consensus        10 ~~dp~~~~~~F~~~f~~~yg~~~p~F~~gs~~~Al~~A~~~~k~e~K~LlVyLhs~~~~~~~~f~~~~L~~~~V~~~l~~   89 (178)
T 2ec4_A           10 AENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQ   89 (178)
T ss_dssp             CCCHHHHHHHHHHHHHHHHCSCCCCCCCSCHHHHHHTTTSSCTTTCCEEEEEEECSSCSHHHHHHHHTTTCHHHHHHHHH
T ss_pred             CCChHHHHHHHHHHHHHHhCCCCCCeeeCCHHHHHHHHHhhhhhhCcEEEEEEeCCCCccHHHHHHHhcCCHHHHHHHHc
Confidence            45677889999999999999999999999999999999    99999999999999999999999999999999999999


Q ss_pred             CeEEEecccCChh-------------HHHHHhh---CCCCCCceEEEEeCCCCccceeeeeeecCCCHHHHHHHHHHHHH
Q 015165          221 NFVSWGGSIRASE-------------GFKMSNS---LKASRYPFCAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIE  284 (412)
Q Consensus       221 nfV~w~~dv~~~E-------------g~~va~~---l~~~~~P~l~lI~~~~~~~~~vl~ri~G~~s~~~ll~~L~~~ie  284 (412)
                      |||+|+||++++|             |+++++.   |++++||++++|+++ +++|+++++++|.+++++|++.|+.+++
T Consensus        90 nfV~w~~dv~~~e~~~~~~~~~~~~~g~~~a~~~~~~~~~~~P~l~ii~~~-~~~~~vl~~~~G~~~~~~ll~~L~~~~e  168 (178)
T 2ec4_A           90 NFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGK-RSSNEVLNVIQGNTTVDELMMRLMAAME  168 (178)
T ss_dssp             TEEEEEEECCSHHHHHHHHHHHHHHTCHHHHHHHHHSCSTTCSEEEEECCC-SSCCCEEEEECSCCCHHHHHHHHHHHHH
T ss_pred             CEEEEEEeCCCchhhhhhhhhhhhhhHHHHHHHHhhcCCCCCCeEEEEEcC-CCceEEEEEEeCCCCHHHHHHHHHHHHH
Confidence            9999999999999             7788866   899999999999986 5579999999999999999999999999


Q ss_pred             hhhHHHH
Q 015165          285 ESNPALL  291 (412)
Q Consensus       285 ~~~~~L~  291 (412)
                      +|+++|.
T Consensus       169 ~~~~~l~  175 (178)
T 2ec4_A          169 IFTAQQQ  175 (178)
T ss_dssp             HHHHHSC
T ss_pred             HhhHhhh
Confidence            9998764
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 412
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 6e-06
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 7e-05
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 5e-04
d1v92a_46 a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- 8e-06
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 1e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 4e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 0.002
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.5 bits (107), Expect = 6e-06
 Identities = 11/109 (10%), Positives = 43/109 (39%), Gaps = 1/109 (0%)

Query: 267 EGPKSPEEMLMILQKVIEESNPALLQARLDAEE-RRNNMRLREEQDAAYRAALEADQARE 325
           +  +S  + ++   + + E    +   R+ AE  + +   L E Q    +   + +++ +
Sbjct: 183 KSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQ 242

Query: 326 RQRREEQERLEREAAEAERKHKEEVEAREREAREAAEREAALAKMRQEK 374
              ++  E++E +  +  ++ +  +  + +E  +  +          + 
Sbjct: 243 EHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKN 291
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query412
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.86
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 99.34
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 98.71
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.69
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.1
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 98.1
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 97.92
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.84
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.8
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.74
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.73
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 97.72
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.71
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.66
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.63
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.51
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.51
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 97.44
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.4
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 97.37
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 97.23
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 97.22
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.16
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 96.94
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 96.9
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.84
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.76
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 96.57
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 96.47
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 96.38
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 96.37
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 96.29
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 96.07
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 96.01
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 95.93
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 95.92
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 95.89
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 95.73
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.66
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 95.62
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 95.57
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 95.48
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 95.29
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 94.97
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 94.88
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 94.64
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.46
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 93.55
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 93.35
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 93.17
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 92.87
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 92.31
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 92.26
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 91.37
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.8
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 90.75
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 90.56
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 90.53
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 89.28
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 89.14
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 89.08
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 87.61
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 86.41
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 85.61
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 85.06
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 84.72
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 84.66
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 84.65
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 84.6
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 83.9
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 83.89
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 82.61
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 81.16
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 80.72
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 80.02
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: UAS domain
domain: UBX domain-containing protein 7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=1.7e-21  Score=169.71  Aligned_cols=115  Identities=15%  Similarity=0.236  Sum_probs=106.5

Q ss_pred             CCccCCHHHHHHHHHhcCcEEEEEEeCCCCCChhHHHhhcCCChHHHHHHhcCeEEEecccCChhHHHHHhhCCCCCCce
Q 015165          169 NFVSEGFMDALQRSRSVFKLLFVYLHSPDHPDTPAFCEGTLCNEVLAAFVNENFVSWGGSIRASEGFKMSNSLKASRYPF  248 (412)
Q Consensus       169 ~F~~gs~~eAl~~Ak~e~K~LlVyLh~~~~~~s~~F~r~vL~~~~v~~~l~~nfV~w~~dv~~~Eg~~va~~l~~~~~P~  248 (412)
                      .+|.|+|++|++.|+++.||||||+|+++|..|+.|+++||+|++|.++++++||+|..|+.++|+..+++.|++..||+
T Consensus        25 i~~~~~~~~A~~~Ak~~~K~llV~~~~~~C~~C~~m~~~v~~d~~V~~~l~~~fV~~~v~~~~~e~~~~~~~y~v~~~Pt  104 (147)
T d2dlxa1          25 LMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPY  104 (147)
T ss_dssp             TSCCSCHHHHHHHHHHHTCEEEEEEECSCTTTHHHHHHHTTTCHHHHHHHHHTEEEEEEESSSHHHHHHHHHHTCCSSSE
T ss_pred             ccccCCHHHHHHHHHHcCCcEEEEEecCCCCchHHHHHhccCCHHHHHHHhhheeEeeecccchhhhhhhhheecCceeE
Confidence            34899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCCCccceeeeeeecCCCHHHHHHHHHHHHHhhh
Q 015165          249 CAVVMPAANQRIALLQQVEGPKSPEEMLMILQKVIEESN  287 (412)
Q Consensus       249 l~lI~~~~~~~~~vl~ri~G~~s~~~ll~~L~~~ie~~~  287 (412)
                      +++|++.+|..+.    .-|..++++|+..|+.+++.+.
T Consensus       105 i~~idp~~ge~v~----~~~~~~~~~fl~~L~~fl~~~~  139 (147)
T d2dlxa1         105 VSILDPRTGQKLV----EWHQLDVSSFLDQVTGFLGEHG  139 (147)
T ss_dssp             EEEECTTTCCCCE----EESSCCHHHHHHHHHHHHHHTC
T ss_pred             EEEEeCCCCeEec----ccCCCCHHHHHHHHHHHHhhCC
Confidence            9999997665443    3467899999999999998774
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure