Citrus Sinensis ID: 015167

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--

MSAIRGEGLYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKKNSEKEVEGEILQAVQKI

cccccccccccccccccHHHHHHHHHcccccHHHHHHHcccccccEEEEEEcccccEEEEEcccccHHccccccEEEccHHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEccccEEEccEEEEEcccHHHHHHHHHHccccccccccccEEEcccccccccccccEEEEEEHHHHHHHHHHHHccccEEcccccccccEEEEEcccccHHHHHHHHHccccEEEEEccccccccccccccccccccHHHHHHHHHcccHHHHHcccccEEEEEcccccccccEEEEccccccccEEEcccccccccccEEEEcccccccccEEEEEEccEEEEEEccccccEEEccccccEEcccccccEEEccccEEEEcccccEEEEEEEEEccccccccccccccccHHcccc

cccEEccccccccHHHHHHHHHHHHHccHHHHHHHHHccccccccEcccEccccccEEEEEccccHHHHccccEEEEEccHHHHHHHHHHcccccEEcccEEEEEEEcccEEEEEEccccEEEccEEEEccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHEccccccccEHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccHHHHHHccccEEEEEccccccccccEEEEcccccccEEEEcccccccccccEEEccccEcccEEEEEEEccEEEEEEccccccEEEcccccEEEEccccccEEcccccEEEEccccEEEEEEEEEEcccccccHHcccHHHHHHHHcc

msairgeglyrgpiqIQSNALAALEAIDLDVAEEVMRAGcvtgdringlvdgisgswyikfdtftpaaekglpvtRVISRMTLQQILAHAVGndiilndsnvidfmdhgdKVSVMLENgqcyagdvlvgaDGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYlsvglgplsfltkfwiphpgrvVRRFFIDLAMPLMLNWVlggnssklegrspccrlsdkASDQLRTWLRDNDALERAmngewllvpsgsetvvsqpiylsrsdenepyligsesqedfprtsivipsaqvsKMHAHIRYKDGAFYLIDLrsehgtyitdnegrryrvspnfparfrpsnsiqfgsdkkaTFQVKVIRstpkknsekEVEGEILQAVQKI

msairgeglyrgpIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASklcsyesarRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGewllvpsgsetVVSQPIYLSRSDENEPYLIgsesqedfprtSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGtyitdnegrryrvspnfparfrpsnsiqfgsdkkatfqVKVIrstpkknsekevegeilqavqki

MSAIRGEGLYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMNllmswllclsslklTTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKKNSEKEVEGEILQAVQKI

********LYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNS********CCRL******QLRTWLRDNDALERAMNGEWLLVPSGSETVVSQPIYL**********************SIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYR*****************************************************

**AIRGEGLYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNS********************************AMNGEWLLVPSGSETV*********SDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQ***************************

*SAIRGEGLYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRST********************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		412	2.2.26 [Sep-21-2011]
Q9FGC7		667	Zeaxanthin epoxidase, chl	yes	no	0.706	0.436	0.585	3e-93
O81360		661	Zeaxanthin epoxidase, chl	N/A	no	0.699	0.435	0.614	2e-91
Q40412		663	Zeaxanthin epoxidase, chl	N/A	no	0.582	0.361	0.659	2e-89
P93236		669	Zeaxanthin epoxidase, chl	N/A	no	0.631	0.388	0.604	3e-85
Q96375		660	Zeaxanthin epoxidase, chl	N/A	no	0.580	0.362	0.614	1e-80
Q0JCU7		659	Zeaxanthin epoxidase, chl	yes	no	0.703	0.440	0.549	7e-79
Q9F131		394	3-hydroxybenzoate 6-hydro	N/A	no	0.279	0.291	0.318	5e-05

>sp\|Q9FGC7\|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1	Back alignment and function desciption

 Score =  342 bits (878), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 175/299 (58%), Positives = 216/299 (72%), Gaps = 8/299 (2%)

Query: 109 GDKVSVMLEN-GQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYES 167
           GD +  M  N GQ   G  +   D     + L  +W     S++ TT +   S L  YE 
Sbjct: 372 GDSIHAMQPNMGQ---GGCMAIEDSFQLALELDEAWK---QSVETTTPVDVVSSLKRYEE 425

Query: 168 ARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPL 227
           +RRLRVAIIH +AR AA+MASTY  YL VGLGPLSFLTKF +PHPGRV  RFF+D+AMP 
Sbjct: 426 SRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPS 485

Query: 228 MLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVPSGSETVVS 287
           ML+WVLGGNS KL+GR P CRL+DKA D+LR W  D+DALER + GEW L+P G +  VS
Sbjct: 486 MLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIPHGDDCCVS 545

Query: 288 QPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHG 347
           + + L++ DE++P ++GSE  +DFP   IVIPS+QVSKMHA + YKDGAF+L+DLRSEHG
Sbjct: 546 ETLCLTK-DEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHG 604

Query: 348 TYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKKNSEKEVEGEIL 406
           TY+TDNEGRRYR +PNFPARFR S+ I+FGSDKKA F+VKVIR TPK   + E   + L
Sbjct: 605 TYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKTPKSTRKNESNNDKL 663

Zeaxanthin epoxidase that plays an important role in the xanthophyll cycle and abscisic acid (ABA) biosynthesis. Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Required for resistance to osmotic and drought stresses, ABA-dependent stomatal closure, seed development and dormancy, modulation of defense gene expression and disease resistance and non-photochemical quencing (NPQ). Through its role in ABA biosynthesis, regulates the expression of stress-responsive genes such as RD29A during osmotic stress and is required for normal plant growth during vegetative development. Is required for late skotomorphogenic growth through its role in the xanthophyll carotenoids neoxanthin, violaxanthin and antheraxanthin biosynthesis. Required for beta-aminobutyric acid (BABA)-induced priming in disease resistance, tolerance to salt and drought stresses and sterility. Participates in NPQ by regulating the level of zeaxanthin in photosynthetic energy conversion. NPQ is a process that maintains the balance between dissipation and utilization of light energy to minimize the generation of oxidizing molecules and the molecular damages they can generate.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 9EC: 0

>sp\|O81360\|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1	Back alignment and function description

>sp\|Q40412\|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1	Back alignment and function description

>sp\|P93236\|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1	Back alignment and function description

>sp\|Q96375\|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1	Back alignment and function description

>sp\|Q0JCU7\|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1	Back alignment and function description

>sp\|Q9F131\|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		412
17402597		664	zeaxanthin epoxidase [Citrus unshiu]	0.716	0.444	0.741	1e-120
290361322		664	zeaxanthin epoxidase [Citrus unshiu]	0.716	0.444	0.741	1e-120
290361326		664	zeaxanthin epoxidase [Citrus sinensis]	0.716	0.444	0.741	1e-120
190576749		664	zeaxanthin epoxidase [Citrus maxima]	0.716	0.444	0.745	1e-120
290361324		664	zeaxanthin epoxidase [Citrus unshiu]	0.716	0.444	0.708	1e-111
290361328		664	zeaxanthin epoxidase [Citrus sinensis]	0.716	0.444	0.701	1e-110
56384438		666	zeaxanthin epoxidase [Eutrema halophilum	0.713	0.441	0.610	8e-99
284927594		669	zeaxanthin epoxidase [Brassica napus] gi	0.711	0.437	0.596	1e-97
222840530		668	zeaxanthin epoxidase [Brassica rapa subs	0.711	0.438	0.596	1e-97
224084342		692	predicted protein [Populus trichocarpa]	0.711	0.423	0.587	3e-97

>gi\|17402597\|dbj\|BAB78733.1\| zeaxanthin epoxidase [Citrus unshiu]	Back alignment and taxonomy information

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/302 (74%), Positives = 242/302 (80%), Gaps = 7/302 (2%)

Query: 109 GDKVSVMLEN-GQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYES 167
           GD V  M  N GQ   G  +   DG    + L  +   C  S +  T I   S L SYE 
Sbjct: 369 GDSVHAMQPNLGQ---GGCMAIEDGYQLAVELEKA---CKKSNESKTPIDIVSALKSYER 422

Query: 168 ARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPL 227
           ARRLRVA+IH LARSAA+MASTY  YL VGLGPLSFLTKF IPHPGRV  RFFIDLAMPL
Sbjct: 423 ARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPL 482

Query: 228 MLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVPSGSETVVS 287
           ML+WVLGGNSSKLEGRSPCC+LSDKASD LRTW RD+DALERAMNGEW LVPSGSE VVS
Sbjct: 483 MLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVS 542

Query: 288 QPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHG 347
           QPIYLS S ENEPYLIGSES EDFPRTSIVIPSAQVSKMHA I YKDGAFYLIDL+SEHG
Sbjct: 543 QPIYLSGSHENEPYLIGSESHEDFPRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHG 602

Query: 348 TYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKKNSEKEVEGEILQ 407
           TY+TDNEGRRYRVS NFPARFRPS++I+FGSDKKA F+VKVI + P  NSE++  GEILQ
Sbjct: 603 TYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQ 662

Query: 408 AV 409
           AV
Sbjct: 663 AV 664

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|290361322\|dbj\|BAI79257.1\| zeaxanthin epoxidase [Citrus unshiu]	Back alignment and taxonomy information

>gi\|290361326\|dbj\|BAI79259.1\| zeaxanthin epoxidase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|190576749\|gb\|ACE79170.1\| zeaxanthin epoxidase [Citrus maxima]	Back alignment and taxonomy information

>gi\|290361324\|dbj\|BAI79258.1\| zeaxanthin epoxidase [Citrus unshiu]	Back alignment and taxonomy information

>gi\|290361328\|dbj\|BAI79260.1\| zeaxanthin epoxidase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|56384438\|gb\|AAV85824.1\| zeaxanthin epoxidase [Eutrema halophilum]	Back alignment and taxonomy information

>gi\|284927594\|gb\|ADC29517.1\| zeaxanthin epoxidase [Brassica napus] gi\|290783794\|gb\|ADD62493.1\| zeaxanthin epoxidase [Brassica napus]	Back alignment and taxonomy information

>gi\|222840530\|gb\|ACM68704.1\| zeaxanthin epoxidase [Brassica rapa subsp. pekinensis]	Back alignment and taxonomy information

>gi\|224084342\|ref\|XP_002307265.1\| predicted protein [Populus trichocarpa] gi\|222856714\|gb\|EEE94261.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		412
TAIR\|locus:2158083		667	ABA1 "ABA DEFICIENT 1" [Arabid	0.616	0.380	0.644	4.6e-148
UNIPROTKB\|Q0JCU7		659	ZEP "Zeaxanthin epoxidase, chl	0.592	0.370	0.602	1.8e-131

TAIR\|locus:2158083 ABA1 "ABA DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 874 (312.7 bits), Expect = 4.6e-148, Sum P(2) = 4.6e-148
 Identities = 165/256 (64%), Positives = 201/256 (78%)

Query:   153 TTRIVHASKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHP 212
             TT +   S L  YE +RRLRVAIIH +AR AA+MASTY  YL VGLGPLSFLTKF +PHP
Sbjct:   411 TTPVDVVSSLKRYEESRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHP 470

Query:   213 GRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMN 272
             GRV  RFF+D+AMP ML+WVLGGNS KL+GR P CRL+DKA D+LR W  D+DALER + 
Sbjct:   471 GRVGGRFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIK 530

Query:   273 GEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRY 332
             GEW L+P G +  VS+ + L++ DE++P ++GSE  +DFP   IVIPS+QVSKMHA + Y
Sbjct:   531 GEWYLIPHGDDCCVSETLCLTK-DEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIY 589

Query:   333 KDGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRST 392
             KDGAF+L+DLRSEHGTY+TDNEGRRYR +PNFPARFR S+ I+FGSDKKA F+VKVIR T
Sbjct:   590 KDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKT 649

Query:   393 PKKNSEKEVEGE-ILQ 407
             PK   + E   + +LQ
Sbjct:   650 PKSTRKNESNNDKLLQ 665

GO:0008152 "metabolic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;IEA;IDA

GO:0009540 "zeaxanthin epoxidase [overall

GO:0009688 "abscisic acid biosynthetic process" evidence=IEA;TAS

GO:0016020 "membrane" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0006970 "response to osmotic stress" evidence=IMP

GO:0009414 "response to water deprivation" evidence=IMP

GO:0010182 "sugar mediated signaling pathway" evidence=TAS

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009408 "response to heat" evidence=IMP

GO:0010114 "response to red light" evidence=IEP

GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA

GO:0016123 "xanthophyll biosynthetic process" evidence=IMP

UNIPROTKB\|Q0JCU7 ZEP "Zeaxanthin epoxidase, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.14.13	0.921
3rd Layer	1.14.13.90	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_V000519	hypothetical protein (692 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	fgenesh4_pg.C_LG_III000619	hypothetical protein (144 aa)	•	0.448

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		412
PLN02927		668	PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa	1e-118
PLN02927		668	PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa	5e-73
cd00060		102	cd00060, FHA, Forkhead associated domain (FHA); fo	1e-14
pfam00498		67	pfam00498, FHA, FHA domain	3e-12
PRK06847		375	PRK06847, PRK06847, hypothetical protein; Provisio	1e-11
PRK08163		396	PRK08163, PRK08163, salicylate hydroxylase; Provis	9e-09
COG1716		191	COG1716, COG1716, FOG: FHA domain [Signal transduc	3e-08
COG0654		387	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox	6e-08
smart00240		52	smart00240, FHA, Forkhead associated domain	9e-08
PRK06753		373	PRK06753, PRK06753, hypothetical protein; Provisio	8e-07
PRK07538		413	PRK07538, PRK07538, hypothetical protein; Provisio	0.004

>gnl\|CDD\|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

 Score =  358 bits (919), Expect = e-118
 Identities = 176/299 (58%), Positives = 216/299 (72%), Gaps = 8/299 (2%)

Query: 109 GDKVSVMLEN-GQCYAGDVLVGADGIWSKMNLLMSWLLCLSSLKLTTRIVHASKLCSYES 167
           GD +  M  N GQ   G  +   D     + L  +W     S++  T +   S L  YE 
Sbjct: 373 GDSIHAMQPNMGQ---GGCMAIEDSFQLALELDEAWK---QSVETNTPVDVVSSLKRYEE 426

Query: 168 ARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPL 227
           +RRLRVAIIH +AR AA+MASTY  YL VGLGPLSFLTKF +PHPGRV  RFF+D+AMPL
Sbjct: 427 SRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPL 486

Query: 228 MLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVPSGSETVVS 287
           ML+WVLGGNS KLEGR P CRL+DKA D+LR W  D+DALER + GEW L+P G +  VS
Sbjct: 487 MLDWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIPHGDDCCVS 546

Query: 288 QPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHG 347
           + + L++ DE++P ++GSE  +DFP   IVIPS+QVSKMHA + YKDGAF+L+DLRSEHG
Sbjct: 547 ETLCLTK-DEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHG 605

Query: 348 TYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKKNSEKEVEGEIL 406
           TY+TDNEGRRYR +PNFPARFR S+ I+FGSDKKA F+VKVIR TPK   + E   + L
Sbjct: 606 TYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKTPKSTRKNESNNDKL 664

Length = 668

>gnl\|CDD\|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>gnl\|CDD\|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins	Back alignment and domain information

>gnl\|CDD\|215951 pfam00498, FHA, FHA domain	Back alignment and domain information

>gnl\|CDD\|235874 PRK06847, PRK06847, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional	Back alignment and domain information

>gnl\|CDD\|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|214578 smart00240, FHA, Forkhead associated domain	Back alignment and domain information

>gnl\|CDD\|168661 PRK06753, PRK06753, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236046 PRK07538, PRK07538, hypothetical protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		412
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	100.0
PRK06475		400	salicylate hydroxylase; Provisional	99.7
PF00498		68	FHA: FHA domain; InterPro: IPR000253 The forkhead-	99.68
PRK07588		391	hypothetical protein; Provisional	99.66
PRK07538		413	hypothetical protein; Provisional	99.65
PRK05868		372	hypothetical protein; Validated	99.64
PRK06753		373	hypothetical protein; Provisional	99.64
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	99.63
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	99.61
PRK08163		396	salicylate hydroxylase; Provisional	99.61
KOG2614		420	consensus Kynurenine 3-monooxygenase and related f	99.56
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.53
PRK07236		386	hypothetical protein; Provisional	99.5
PRK08013		400	oxidoreductase; Provisional	99.41
PRK06847		375	hypothetical protein; Provisional	99.41
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	99.41
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	99.38
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	99.37
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.34
cd00060		102	FHA Forkhead associated domain (FHA); found in euk	99.33
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.33
TIGR03354		396	VI_FHA type VI secretion system FHA domain protein	99.33
PRK07045		388	putative monooxygenase; Reviewed	99.31
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.27
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.27
PRK09126		392	hypothetical protein; Provisional	99.24
PRK06184		502	hypothetical protein; Provisional	99.21
COG1716		191	FOG: FHA domain [Signal transduction mechanisms]	99.21
PRK08294		634	phenol 2-monooxygenase; Provisional	99.21
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	99.2
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	99.2
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	99.18
PRK06126		545	hypothetical protein; Provisional	99.18
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	99.17
KOG1882		293	consensus Transcriptional regulator SNIP1, contain	99.17
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	99.16
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.16
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	99.15
PRK08244		493	hypothetical protein; Provisional	99.14
COG3456		430	Predicted component of the type VI protein secreti	99.14
PRK07190		487	hypothetical protein; Provisional	99.11
PRK08132		547	FAD-dependent oxidoreductase; Provisional	99.08
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.07
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.05
smart00240		52	FHA Forkhead associated domain. Found in eukaryoti	99.05
PRK06834		488	hypothetical protein; Provisional	99.0
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	98.99
PRK06185		407	hypothetical protein; Provisional	98.99
PRK06996		398	hypothetical protein; Provisional	98.97
PLN02985		514	squalene monooxygenase	98.94
PTZ00367		567	squalene epoxidase; Provisional	98.87
PRK11445		351	putative oxidoreductase; Provisional	98.75
KOG3855		481	consensus Monooxygenase involved in coenzyme Q (ub	98.71
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	98.66
KOG1881		793	consensus Anion exchanger adaptor protein Kanadapt	98.61
KOG1880		337	consensus Nuclear inhibitor of phosphatase-1 [Gene	98.39
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	97.97
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	97.96
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	97.94
PRK10157		428	putative oxidoreductase FixC; Provisional	97.64
PLN02463		447	lycopene beta cyclase	97.58
PRK10015		429	oxidoreductase; Provisional	97.51
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	97.46
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	97.34
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	97.17
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	97.13
PLN02697		529	lycopene epsilon cyclase	96.94
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	96.88
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	96.85
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	96.68
KOG1298		509	consensus Squalene monooxygenase [Lipid transport	96.55
KOG2293		547	consensus Daxx-interacting protein MSP58/p78, cont	96.46
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	96.18
TIGR02500		410	type_III_yscD type III secretion apparatus protein	95.93
KOG1892		1629	consensus Actin filament-binding protein Afadin [C	95.31
PRK11728		393	hydroxyglutarate oxidase; Provisional	95.18
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	95.09
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	94.68
PLN02568		539	polyamine oxidase	93.99
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	93.83
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	93.8
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	93.44
PRK05257		494	malate:quinone oxidoreductase; Validated	93.21
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	93.16
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	93.05
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	93.0
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	92.87
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	92.75
COG2081		408	Predicted flavoproteins [General function predicti	92.43
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	92.35
TIGR00275		400	flavoprotein, HI0933 family. The model when search	91.57
PLN02676		487	polyamine oxidase	91.22
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	91.07
COG0579		429	Predicted dehydrogenase [General function predicti	91.07
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	91.02
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	90.78
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	90.61
PRK11883		451	protoporphyrinogen oxidase; Reviewed	90.55
PRK12416		463	protoporphyrinogen oxidase; Provisional	90.23
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	90.19
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	89.31
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	89.2
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	89.18
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	88.67
PRK06116		450	glutathione reductase; Validated	88.34
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	88.24
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	88.14
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	87.99
PRK13339		497	malate:quinone oxidoreductase; Reviewed	87.96
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	87.79
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	87.56
PLN02268		435	probable polyamine oxidase	87.54
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	87.48
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	86.77
PRK07845		466	flavoprotein disulfide reductase; Reviewed	85.6
PRK07846		451	mycothione reductase; Reviewed	85.3
PTZ00383		497	malate:quinone oxidoreductase; Provisional	84.97
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	84.96
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	84.53
KOG0241		1714	consensus Kinesin-like protein [Cytoskeleton]	84.46
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	83.82
PLN02507		499	glutathione reductase	83.65
PRK07233		434	hypothetical protein; Provisional	83.3
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	83.16
PRK09897		534	hypothetical protein; Provisional	82.71
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	82.65
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	82.28
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	82.1
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	81.9
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	80.85

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

Probab=100.00  E-value=2.8e-48  Score=402.64  Aligned_cols=404  Identities=70%  Similarity=1.165  Sum_probs=322.4

Q ss_pred             cccCcccccceeeCHHHHHHHHHcccChHHHHHhcccccccceeEEEECCCCcEEEEEeCCCcccccCCCeEEEEeHHHH
Q 015167            4 IRGEGLYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTL   83 (412)
Q Consensus         4 ~~~~~~~Gagi~l~~~~~~~L~~l~~Gl~~~l~~~~~~~~~~~~~~~~~~~g~~l~~~~~~~~~~~~g~~~~~~i~r~~L   83 (412)
                      +++.|..+++|.|++|++++|++|++++.+++.+.+......+..+.++..|..+..++........+.++.+.|+|.+|
T Consensus       117 ~r~~G~~~~~I~L~pngl~aLe~LGl~~~e~l~~~g~~~~~~i~~~~d~~~G~~~~~~~~~~~~~~~g~p~~~~I~R~~L  196 (668)
T PLN02927        117 IRGEGKYRGPIQIQSNALAALEAIDIDVAEQVMEAGCITGDRINGLVDGISGSWYVKFDTFTPAASRGLPVTRVISRMTL  196 (668)
T ss_pred             cccccccCcccccCHHHHHHHHHcCcchHHHHHhhcCcccceeeeeeecCCCceEeeccccccccccCCCeEEEEeHHHH
Confidence            45566667889999999999999955567888776654322221244544666655555322222234554578999999


Q ss_pred             HHHHHhhcCCCEEEcCCeEEEEEEeCCeEEEEEccCcEEEeCEEEEecCcCchhH-HH----------------------
Q 015167           84 QQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQCYAGDVLVGADGIWSKMN-LL----------------------  140 (412)
Q Consensus        84 ~~~L~~~l~~~~i~~~~~v~~i~~~~~~v~v~~~dG~~~~adllVgADG~~S~vr-~~----------------------  140 (412)
                      +++|.+.++...++++++|+++++++++|++++.||+++++|+||||||++|.+| .+                      
T Consensus       197 ~~~L~~alg~~~i~~g~~V~~I~~~~d~VtV~~~dG~ti~aDlVVGADG~~S~vR~~l~g~~~~~~sG~~~~rgi~~~~p  276 (668)
T PLN02927        197 QQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYEGDLLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADFIP  276 (668)
T ss_pred             HHHHHhhCCCCEEEcCCEEEEEEEeCCEEEEEECCCCEEEcCEEEECCCCCcHHHHHhcCCCCCcccceEEEEEEcCCCc
Confidence            9999999976668999999999999999999999999999999999999999994 33                      


Q ss_pred             ---------------------------Hhhhhc---------------------------c-------cc---c------
Q 015167          141 ---------------------------MSWLLC---------------------------L-------SS---L------  150 (412)
Q Consensus       141 ---------------------------~~~~~~---------------------------~-------~d---~------  150 (412)
                                                 +.|+.+                           .       .+   +      
T Consensus       277 ~~~~~~~~~~~~G~~~~~v~~~v~~g~~~~~~f~~~p~~~~~~~~~~~e~L~~~f~~w~~~v~elI~~t~~~~i~~~~iy  356 (668)
T PLN02927        277 ADIESVGYRVFLGHKQYFVSSDVGGGKMQWYAFHEEPAGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRDIY  356 (668)
T ss_pred             ccccccceEEEEcCCeEEEEEcCCCCeEEEEEEEECCccccccchhHHHHHHHHhccCCHHHHHHHHhCccccceeeeEE
Confidence                                       001000                           0       00   0      


Q ss_pred             ------cc-------cCccccc----------------------------------------hhhccccccccceeeeeh
Q 015167          151 ------KL-------TTRIVHA----------------------------------------SKLCSYESARRLRVAIIH  177 (412)
Q Consensus       151 ------~~-------~~~~~~~----------------------------------------~~~~~~~~~~~~~~~~~~  177 (412)
                            .|       .|+..|+                                        .++..|...|++++..++
T Consensus       357 d~~p~~~W~~grVvLiGDAAH~~~P~~GqG~n~AieDa~~La~~L~~~~~~~~~~~~~~~~~~aL~~Ye~~R~~rv~~i~  436 (668)
T PLN02927        357 DRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETNTPVDVVSSLKRYEESRRLRVAIIH  436 (668)
T ss_pred             eccCCCccccCcEEEEcCccCCCCCccccchHHHHHHHHHHHHHHHHhhccccccCCcccHHHHHHHHHHHHHHHHHHHH
Confidence                  00       0111111                                        123344556666777777


Q ss_pred             hhhHHHHHHhhhccceeecCCccccceeeeecCCCCcccchheecccCCeEEEEEEeeeCCCCCCCCCccchhhHHHHHh
Q 015167          178 RLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQL  257 (412)
Q Consensus       178 ~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~  257 (412)
                      +.++....+...+..|++.+.+++.++..+.+||++++.+|+++...+|..+.|++.++.+.++.+.....+.+.+.+.+
T Consensus       437 ~~ar~a~~~~~~~~~y~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  516 (668)
T PLN02927        437 AMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPLMLDWVLGGNSEKLEGRPPSCRLTDKADDRL  516 (668)
T ss_pred             HHHHHHHHHHHHHHHHhcCCCCHHHHHHhcCCCCCCceeeeeeeecccHHHhhhhhcCCccccCCCCCccccccchhHHH
Confidence            77777777777788888877788888899999999999999999999999999999999999987667778889999999


Q ss_pred             hcccCCchhhhhccCCceEEEEcCCCCCccccEEeeccCCCCCEEecCCCCCCCCceeEEeCCCcccccceEEEEECCEE
Q 015167          258 RTWLRDNDALERAMNGEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAF  337 (412)
Q Consensus       258 ~~W~p~~~~l~~a~~~~w~l~~~~~~~~~~~~i~l~~~~~~~~~~iGR~~~~~~~~~~~~i~~~~vSr~Ha~i~~~~~~~  337 (412)
                      ..|-..+.++.+++.++|.|+|.++....+++|+|.+ +++.|++|||.++++.|+..++|+++.||+.||+|.++++.|
T Consensus       517 ~~~~~~~~~~~~~~~~~w~l~~~~~~~~~~~~~~l~~-~~~~p~~iG~~~~~~~~~~~i~i~~~~vS~~Ha~i~~~~~~~  595 (668)
T PLN02927        517 REWFEDDDALERTIKGEWYLIPHGDDCCVSETLCLTK-DEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAF  595 (668)
T ss_pred             HHHhcccHHHHHhhcCCeEEEecCCCCcccceeeeec-CCCCCeEecCCCCcCCCCceEEecCCccChhHeEEEEECCEE
Confidence            9999999999999999999999988777778999987 788999999999999999999999999999999999999999


Q ss_pred             EEEEcCCccceeeeCcCCceeecCCCCcEEeCCCCEEEECCCCceEEEEEEeccCCCCCCccccc--ccccccc
Q 015167          338 YLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKKNSEKEVE--GEILQAV  409 (412)
Q Consensus       338 ~i~Dl~S~nGt~vn~~~~~~~~l~~~~~~~l~~gd~i~~G~~~~~~f~~~~~~~~~~~~~~~~~~--~~~~~~~  409 (412)
                      ||+||+|+||||||++.++++++.||.+++|++||+|.||+.+++.|+++.++.+|.. +.+.++  .+.+|++
T Consensus       596 ~~~Dl~S~nGT~v~~~~~~r~~~~p~~~~~l~~~d~I~~g~~~~~~fr~~~~~~~~~~-~~~~~~~~~~~~~~~  668 (668)
T PLN02927        596 FLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKTPKS-TRKNESNNDKLLQTA  668 (668)
T ss_pred             EEEECCCCCccEEeCCCCceEecCCCCceEeCCCCEEEeCCCcceeEEEEeecCCCcc-hhhcccchhhhhhcC
Confidence            9999999999999999999999999999999999999999987888999999999987 454444  3577764

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only]	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>TIGR03354 VI_FHA type VI secretion system FHA domain protein	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>COG1716 FOG: FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>smart00240 FHA Forkhead associated domain	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only]	Back alignment and domain information

>KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only]	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism]	Back alignment and domain information

>KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family	Back alignment and domain information

>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton]	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>KOG0241 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		412
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	1e-27
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	3e-20
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	2e-17
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	6e-14
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	3e-13
2pie_A		138	E3 ubiquitin-protein ligase RNF8; FHA domain, comp	8e-11
3va4_A		132	Mediator of DNA damage checkpoint protein 1; cell	1e-10
2jpe_A		140	Nuclear inhibitor of protein phosphatase 1; FHA do	2e-10
2csw_A		145	Ubiquitin ligase protein RNF8; 11-stranded beta sa	7e-10
3els_A		158	PRE-mRNA leakage protein 1; intrinsically unstruct	5e-09
1uht_A		118	Expressed protein; FHA domain, beta-sandwich, anti	1e-08
3elv_A		205	PRE-mRNA leakage protein 1; intrinsically unstruct	2e-08
1r21_A		128	Antigen KI-67; beta sandwich, cell cycle; NMR {Hom	3e-07
2xt9_B		115	Putative signal transduction protein GARA; lyase-s	3e-07
1g3g_A		164	Protien kinase SPK1; FHA domain, RAD53, phosphopep	4e-07
3po8_A		100	RV0020C protein, putative uncharacterized protein	4e-07
1g6g_A		127	Protein kinase RAD53; beta-sandwich, phosphopeptid	4e-07
2jqj_A		151	DNA damage response protein kinase DUN1; protein/p	5e-07
3gqs_A		106	Adenylate cyclase-like protein; FHA domain, struct	5e-07
2kfu_A		162	RV1827 PThr 22; FHA domain, phosphorylation, intra	8e-07
2kb3_A		143	Oxoglutarate dehydrogenase inhibitor; forkhead-ass	8e-07
1mzk_A		139	Kinase associated protein phosphatase; beta sandwi	1e-06
3oun_A		157	Putative uncharacterized protein TB39.8; peptidogl	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-05
3hx1_A		131	SLR1951 protein; P74513_SYNY3, adenylate cyclase-l	9e-05
1qu5_A		182	Protein kinase SPK1; FHA, RAD53, transferase; NMR	7e-04
1wln_A		120	Afadin; beta sandwich, FHA domain, structural geno	7e-04

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407	Back alignment and structure

 Score =  111 bits (281), Expect = 1e-27
 Identities = 31/135 (22%), Positives = 50/135 (37%), Gaps = 8/135 (5%)

Query: 2   SAIRGEGLYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKF 61
             I+  G     I +  N +  +    L + + +   G     R     D  SG    +F
Sbjct: 56  KEIKPVG---AAISVWPNGVKCMAH--LGMGDIMETFGGPL--RRMAYRDFRSGENMTQF 108

Query: 62  DTFTPAAEKGLPVTRVISRMTLQQILAHAVGNDIILNDSNVIDFMDHGDKVSVMLENGQC 121
               P  E+       +SR  LQ+ +    G D +     V    +  D V+V   +G  
Sbjct: 109 S-LAPLIERTGSRPCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSS 167

Query: 122 YAGDVLVGADGIWSK 136
            +GD+L+ ADG  S 
Sbjct: 168 ASGDLLIAADGSHSA 182

PyMOL of 3rp8

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379	Back alignment and structure

>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138	Back alignment and structure

>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132	Back alignment and structure

>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140	Back alignment and structure

>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145	Back alignment and structure

>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158	Back alignment and structure

>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118	Back alignment and structure

>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205	Back alignment and structure

>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128	Back alignment and structure

>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115	Back alignment and structure

>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164	Back alignment and structure

>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100	Back alignment and structure

>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127	Back alignment and structure

>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151	Back alignment and structure

>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106	Back alignment and structure

>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162	Back alignment and structure

>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143	Back alignment and structure

>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131	Back alignment and structure

>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182	Back alignment and structure

>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		412
4h87_A		130	Kanadaptin; FHA domain of PF00498, mRNA processing	99.79
3va4_A		132	Mediator of DNA damage checkpoint protein 1; cell	99.77
1uht_A		118	Expressed protein; FHA domain, beta-sandwich, anti	99.77
3gqs_A		106	Adenylate cyclase-like protein; FHA domain, struct	99.77
2pie_A		138	E3 ubiquitin-protein ligase RNF8; FHA domain, comp	99.75
3els_A		158	PRE-mRNA leakage protein 1; intrinsically unstruct	99.73
2csw_A		145	Ubiquitin ligase protein RNF8; 11-stranded beta sa	99.71
2xt9_B		115	Putative signal transduction protein GARA; lyase-s	99.71
2jpe_A		140	Nuclear inhibitor of protein phosphatase 1; FHA do	99.71
4hb9_A		412	Similarities with probable monooxygenase; flavin,	99.71
1lgp_A		116	Cell cycle checkpoint protein CHFR; FHA, tungstate	99.7
2kb3_A		143	Oxoglutarate dehydrogenase inhibitor; forkhead-ass	99.7
1gxc_A		149	CHK2, CDS1, serine/threonine-protein kinase CHK2;	99.7
3po8_A		100	RV0020C protein, putative uncharacterized protein	99.7
1dmz_A		158	Protein (protein kinase SPK1); beta-sandwich, anti	99.69
3elv_A		205	PRE-mRNA leakage protein 1; intrinsically unstruct	99.69
1mzk_A		139	Kinase associated protein phosphatase; beta sandwi	99.69
2kfu_A		162	RV1827 PThr 22; FHA domain, phosphorylation, intra	99.68
2jqj_A		151	DNA damage response protein kinase DUN1; protein/p	99.68
1r21_A		128	Antigen KI-67; beta sandwich, cell cycle; NMR {Hom	99.67
1qu5_A		182	Protein kinase SPK1; FHA, RAD53, transferase; NMR	99.65
3oun_A		157	Putative uncharacterized protein TB39.8; peptidogl	99.65
1g6g_A		127	Protein kinase RAD53; beta-sandwich, phosphopeptid	99.64
1g3g_A		164	Protien kinase SPK1; FHA domain, RAD53, phosphopep	99.64
3hx1_A		131	SLR1951 protein; P74513_SYNY3, adenylate cyclase-l	99.63
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	99.63
1wln_A		120	Afadin; beta sandwich, FHA domain, structural geno	99.63
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	99.54
3fm8_A		124	Kinesin-like protein KIF13B; kinesin, GAP, GTPase	99.49
4ejq_A		154	Kinesin-like protein KIF1A; homodimer, FHA domain,	99.49
3huf_A		325	DNA repair and telomere maintenance protein NBS1;	99.41
3kt9_A		102	Aprataxin; FHA domain, beta sandwich, beta sheet,	99.27
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	99.18
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	99.16
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	99.13
4a0e_A		123	YSCD, type III secretion protein; transport protei	99.11
1pn0_A		665	Phenol 2-monooxygenase; two dimers, TLS refinement	99.09
3uv0_A		102	Mutator 2, isoform B; FHA, protein binding, dimeri	99.09
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	99.06
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	99.06
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	99.06
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	99.04
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	99.02
2brf_A		110	Bifunctional polynucleotide phosphatase/kinase; hy	99.01
3i6u_A		419	CDS1, serine/threonine-protein kinase CHK2; Ser/Th	98.94
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	98.94
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	98.93
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	98.86
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	98.85
1yj5_C		143	5' polynucleotide kinase-3' phosphatase FHA domai;	98.81
4egx_A		184	Kinesin-like protein KIF1A; FHA domain, transport	98.77
1ujx_A		119	Polynucleotide kinase 3'-phosphatase; DNA repair,	98.76
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	98.68
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	98.66
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	98.55
1wv3_A		238	Similar to DNA segregation ATPase and related prot	98.42
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	98.38
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	98.35
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	98.23
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	98.22
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	98.18
3atr_A		453	Conserved archaeal protein; saturating double bond	98.15
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	98.1
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	97.65
3c4a_A		381	Probable tryptophan hydroxylase VIOD; alpha-beta p	97.6
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	96.81
2bry_A		497	NEDD9 interacting protein with calponin homology a	96.76
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	96.6
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	96.5
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	96.4
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	96.34
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	96.3
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	96.28
3dme_A		369	Conserved exported protein; structural genomics, P	96.24
2cul_A		232	Glucose-inhibited division protein A-related PROT	96.17
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	95.94
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	95.76
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	95.68
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	95.66
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	95.6
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	95.5
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	95.4
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	95.24
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	95.22
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	95.22
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	95.21
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	95.13
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	95.08
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	94.9
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	94.65
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	94.6
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	94.57
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	94.49
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	94.4
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	94.29
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	93.96
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	93.94
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	93.91
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	93.9
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	93.86
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	93.5
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	93.32
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	93.25
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	93.21
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	93.09
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	92.93
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	92.92
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	92.78
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	92.67
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	92.49
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	92.44
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	92.36
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	92.14
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	92.12
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	91.77
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	91.39
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	91.37
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	91.34
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	90.9
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	90.89
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	90.66
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	90.63
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	90.62
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	90.58
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	90.56
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	90.48
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	90.47
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	90.44
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	90.43
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	90.32
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	90.29
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	90.29
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	90.15
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	89.98
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	89.08
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	88.86
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	88.86
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	88.63
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	88.54
1fec_A		490	Trypanothione reductase; redox-active center, oxid	88.41
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	88.39
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	88.38
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	88.34
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	88.24
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	88.1
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	87.33
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	87.29
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	87.2
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	86.89
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	86.58
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	85.94
1ojt_A		482	Surface protein; redox-active center, glycolysis,	85.91
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	85.37
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	85.23
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	84.94
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	84.43
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	84.43
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	84.14
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	83.75
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	83.63
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	83.53
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	83.51
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	83.5
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	83.28
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	83.26
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	82.66
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	82.5
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	82.22
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	81.9
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	81.81
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	81.4
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	81.31
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	81.07
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	80.69
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	80.41
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	80.25
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	80.23
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	80.15

>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens}	Back alignment and structure

Probab=99.79  E-value=3.9e-19  Score=148.27  Aligned_cols=99  Identities=25%  Similarity=0.418  Sum_probs=78.0

Q ss_pred             CceEEEEcCCCCCccccEEeeccCCCCCEEecCCCCCCCCceeEEeCCCcccccceEEEE-----------ECCEEEEEE
Q 015167          273 GEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRY-----------KDGAFYLID  341 (412)
Q Consensus       273 ~~w~l~~~~~~~~~~~~i~l~~~~~~~~~~iGR~~~~~~~~~~~~i~~~~vSr~Ha~i~~-----------~~~~~~i~D  341 (412)
                      ..|.|....+.. ....+.|..   +..++|||.+.+     |++|+++.|||+||+|.+           .++.|+|+|
T Consensus        19 ~~~~L~v~k~g~-~~~~~~L~~---~~~~~IGR~~~~-----di~l~~~~VSr~HA~I~~r~~~~~~~~~~~~~~~~l~D   89 (130)
T 4h87_A           19 APYSLETLKGGT-ILGTRSLKG---TSYCLFGRLSGC-----DVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYD   89 (130)
T ss_dssp             SCCEEEEEETTE-EEEEEECTT---CSEEEEESSTTS-----SEECCCTTSCSSCEEEEEBCCCCCC------CCEEEEE
T ss_pred             CCEEEEEEECCe-eeeeEEeCC---CceEEEcCCcCC-----CEEeCCCCcchhcEEEEEecccCccceeccCCcceEee
Confidence            467887766543 224444433   556899998865     699999999999999965           456799999


Q ss_pred             cCCccceeeeCcCCceeecCCCCcEEeCCCCEEEECCCCceEEEE
Q 015167          342 LRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKATFQV  386 (412)
Q Consensus       342 l~S~nGt~vn~~~~~~~~l~~~~~~~l~~gd~i~~G~~~~~~f~~  386 (412)
                      |+|+||||||+.     +|.++.+++|++||+|+||.... .|.+
T Consensus        90 l~StNGT~vNg~-----ri~~~~~~~L~~GD~I~~G~str-~yvl  128 (130)
T 4h87_A           90 LGSTHGTFLNKT-----RIPPRTYCRVHVGHVVRFGGSTR-LFIL  128 (130)
T ss_dssp             CSCSSCEEETTE-----ECCTTCCEECCTTCEEEETTCSE-EEEE
T ss_pred             CCCCCceEECCE-----ECCCCceeECCCCCEEEECCceE-EEEE
Confidence            999999999999     99999999999999999998643 3554

PyMOL of 4h87

>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B	Back alignment and structure

>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2	Back alignment and structure

>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis}	Back alignment and structure

>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2	Back alignment and structure

>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2	Back alignment and structure

>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis}	Back alignment and structure

>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus}	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A	Back alignment and structure

>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A	Back alignment and structure

>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2	Back alignment and structure

>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A	Back alignment and structure

>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A*	Back alignment and structure

>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A	Back alignment and structure

>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A	Back alignment and structure

>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A*	Back alignment and structure

>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A*	Back alignment and structure

>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2	Back alignment and structure

>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis}	Back alignment and structure

>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2	Back alignment and structure

>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A*	Back alignment and structure

>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP}	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A*	Back alignment and structure

>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A	Back alignment and structure

>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A*	Back alignment and structure

>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A	Back alignment and structure

>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A*	Back alignment and structure

>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster}	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A*	Back alignment and structure

>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2	Back alignment and structure

>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens}	Back alignment and structure

>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472}	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		412
d1dmza_		158	b.26.1.2 (A:) Phosphotyrosine binding domain of Ra	1e-08
d1uhta_		118	b.26.1.2 (A:) FHA domain containing protein At4G14	2e-08
d1mzka_		122	b.26.1.2 (A:) Kinase associated protein phosphatas	4e-08
d1g6ga_		127	b.26.1.2 (A:) Phosphotyrosine binding domain of Ra	3e-06
d2piea1		127	b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8	8e-06
d2affa1		98	b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi	6e-05
d1k0ia1		292	c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr	2e-04
d1wlna1		107	b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T	4e-04
d2g1la1		102	b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H	0.002

>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158	Back information, alignment and structure


class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: Phosphotyrosine binding domain of Rad53
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 51.7 bits (123), Expect = 1e-08
 Identities = 22/152 (14%), Positives = 52/152 (34%), Gaps = 32/152 (21%)

Query: 272 NGEWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIR 331
           NG +L +    ++++ + + + +     P+ IG     +       I   ++S++H  I 
Sbjct: 2   NGRFLTLKPLPDSIIQESLEIQQGVN--PFFIGRSEDCN-----CKIEDNRLSRVHCFIF 54

Query: 332 YK---------------DGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQF 376
            K                   +       + +Y+ +N     R+        +  + I+ 
Sbjct: 55  KKRHAVGKSMYESPAQGLDDIWYCHT-GTNVSYLNNN-----RMIQGTKFLLQDGDEIKI 108

Query: 377 GSDKK----ATFQVKVIRSTPKKNSEKEVEGE 404
             DK       F+V++  +T   N    +  E
Sbjct: 109 IWDKNNKFVIGFKVEINDTTGLFNEGLGMLQE 140

PyMOL of d1dmza_

>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118	Back information, alignment and structure

>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122	Back information, alignment and structure

>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127	Back information, alignment and structure

>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127	Back information, alignment and structure

>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292	Back information, alignment and structure

>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107	Back information, alignment and structure

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		412
d1uhta_		118	FHA domain containing protein At4G14490 {Thale cre	99.8
d2piea1		127	Ubiquitin ligase protein RNF8 {Human (Homo sapiens	99.74
d1mzka_		122	Kinase associated protein phosphatase {Thale cress	99.74
d2ff4a3		99	Probable regulatory protein EmbR, C-terminal domai	99.74
d2brfa1		101	Polynucleotide kinase 3'-phosphatase {Human (Homo	99.64
d1g6ga_		127	Phosphotyrosine binding domain of Rad53 {Baker's y	99.64
d2affa1		98	Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}	99.64
d1gxca_		116	Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]}	99.63
d1lgpa_		113	Cell cycle checkpoint protein Chfr {Human (Homo sa	99.62
d1dmza_		158	Phosphotyrosine binding domain of Rad53 {Baker's y	99.57
d1wlna1		107	Afadin {Mouse (Mus musculus) [TaxId: 10090]}	99.5
d2g1la1		102	Kinesin-like protein kif1c {Human (Homo sapiens) [	99.43
d3c96a1		288	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	99.13
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	98.95
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	98.91
d1pn0a1		360	Phenol hydroxylase {Soil-living yeast (Trichosporo	97.57
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	97.31
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	96.61
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	95.95
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	95.87
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	95.12
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	94.92
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	94.89
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	94.73
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	94.55
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	94.47
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	94.35
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	94.34
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	92.94
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	92.56
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	92.31
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	92.04
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	91.96
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	91.36
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	91.06
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	90.16
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	89.44
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	89.28
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	87.89
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	87.42
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	87.09
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	86.02
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	85.85
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	84.28
d3c96a2		111	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	80.38

>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: FHA domain containing protein At4G14490
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.80  E-value=1.8e-19  Score=145.94  Aligned_cols=106  Identities=21%  Similarity=0.279  Sum_probs=82.4

Q ss_pred             ceEEEEcCCCCCccccEEeeccCCCCCEEecCCCCCCCCceeEEeCCCcccccceEEEEECCEEEEEEcCCccceeeeCc
Q 015167          274 EWLLVPSGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDN  353 (412)
Q Consensus       274 ~w~l~~~~~~~~~~~~i~l~~~~~~~~~~iGR~~~~~~~~~~~~i~~~~vSr~Ha~i~~~~~~~~i~Dl~S~nGt~vn~~  353 (412)
                      .+.|....+.. .++.+.+..   ...++|||....    |+++|+++.|||+||+|.++++.|+|+|++|+||||||+.
T Consensus        12 ~l~L~v~~Gp~-~g~~~~l~~---~~~~~iGR~~~~----~di~l~d~~VSr~Ha~i~~~~~~~~i~Dl~S~nGT~vng~   83 (118)
T d1uhta_          12 SLRLVFVKGPR-EGDALDYKP---GSTIRVGRIVRG----NEIAIKDAGISTKHLRIESDSGNWVIQDLGSSNGTLLNSN   83 (118)
T ss_dssp             EEEEEESSSTT-TTCBCCBCT---TCCEEEESSSTT----CSEECCSSSSCTTCEEEEECSSSEEEECCCCSSCCEESSS
T ss_pred             cEEEEEEeCCC-CCcEEEeCC---CCEEEECCCCcC----CeEEeCccCcchheeEEEEECCEEEEEECCCcceeEECCE
Confidence            44555444322 124444432   567999997543    5799999999999999999999999999999999999998


Q ss_pred             CCceeecCCCCcEEeCCCCEEEECCCCceEEEEEEeccCCCC
Q 015167          354 EGRRYRVSPNFPARFRPSNSIQFGSDKKATFQVKVIRSTPKK  395 (412)
Q Consensus       354 ~~~~~~l~~~~~~~l~~gd~i~~G~~~~~~f~~~~~~~~~~~  395 (412)
                           ++.++++++|++||+|+||..   +|.+.....+|..
T Consensus        84 -----~l~~~~~~~L~~Gd~i~lG~~---~~~~v~~~~~p~~  117 (118)
T d1uhta_          84 -----ALDPETSVNLGDGDVIKLGEY---TSILVNFVSGPSS  117 (118)
T ss_dssp             -----BCCTTCEEECCTTEEEEETTT---EEEEEEEECSSCC
T ss_pred             -----EcCCCcEEECCCCCEEEECCE---EEEEEEecCCCCC
Confidence                 998888999999999999987   4555555455543

PyMOL of d1uhta_

>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure