Citrus Sinensis ID: 015448


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSSNNSDDTIKVRMGKKRGGTRETNDKLSNEEIQWSKSDSAAGKKLKKKSKEKEGELDAIDDAKNSGGVVPGQNKDANLNGSGDVEMEKDLKRKGRKTSENLSNKGIQVHDDDKRFRKKQKKRSKEKQGELDIIDNGETAFSELFSANIAGNPGFDGDNNMVNEASKFNSVDGLVTSSGKKKKSKNRGMGLTVQLSQEPEVGLGGPSTWGDE
ccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHcccccHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccccHHHHHcccccccccEEEHHHHccccccccccccccccccccccccccccccc
cccccHHHHHHHccccccccccEEEcccccccccHHHcccccccEEEcccccccccHHHHHcccccEEEcccccccccHHHcccccccEEEcccccccccHHHHHcccccEEEcccccccEcHHHcccccccEEHHHHccccccEEEEccccccccccHHHHEEEEccccHHccHccHHHHHHHHHHcccccccccccccccccEHHHHHccccccccHHcccccccccccccccccccccccccccccccccEEcccccccEcccccHHccccccccccccHEEEEcccccccccccccccccccHHHHHHHHHHHcHHHcccccccccccccHHHHHHccccccccccccccccccccccccEEEEEEcccccccccccccccHHccccccccccccccccccc
MTRLSTQQIlkdnktcdpnsikslSLTHKalsdvscltdfnnlerldlssnnltsleglkhcvnlkWLSLVQNKLQSlkgieglskptvlnvgknklrsmddVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNlnnlnlqgnpvAEYDKLAKKVKTLlpnlcifnarpidritknekdnivdkvndssnnsddtikvrmgkkrggtretndklsneeiqwsksdsaaGKKLKKKSkekegeldaiddaknsggvvpgqnkdanlngsgdveMEKDLkrkgrktsenlsnkgiqvhdddKRFRKKQKKRSKEKQGELDIIDNGETAFSELFSaniagnpgfdgdnnmvneaskfnsvdglvtssgkkkksknrgmgltvqlsqepevglggpstwgde
mtrlstqqilkdnktcdpnsIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSlkgieglskptvlnvgknklrsmddvTSVVSLRalilndneivSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLlpnlcifnarpidritknekdnivdkvndssnnsddtikvrmgkkrggtretndklsneeiqwsksdsaagkklkkkskekegeldaiddaknsggvvpgqnkdanlngsgdvemEKDLkrkgrktsenlsnkgiqvhdddkrfrkkqkkrskekqgeldiidnGETAFSELFSANIAGNPGFDGDNNMVNEASKFnsvdglvtssgkkkksknrgmgltvqlsqepevglggpstwgde
MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFnlnnlnlQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVndssnnsddTIKVRMGKKRGGTRETNDKLSNEEIQWsksdsaagkklkkkskekegeldAIDDAKNSGGVVPGQNKDANLNGSGDVEMEKDLKRKGRKTSENLSNKGIQVHdddkrfrkkqkkrskekQGELDIIDNGETAFSELFSANIAGNPGFDGDNNMVNEASKFNSVDGLVTssgkkkkskNRGMGLTVQLSQEPEVGLGGPSTWGDE
*************************LTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRIT*******************************************************************************************************************************************************AFSELFSANI***************************************************************
MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSSN****************************************************************************************************************************************FSE*********************************************************************
MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSSNNSDDTIKVRM*************LSNEEIQWS********************LDAIDDAKNSGGVVPGQNKDANLNGSGDVEMEKDLKRKGRKTSENLSNKGIQVHD******************ELDIIDNGETAFSELFSANIAGNPGFDGDNNMVNEASKFNSVDG***************MGLTVQLSQEPE************
*TRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSSNNSDDTIKVRMGKK*************************************************GG*********N**GS****MEKDLKRK*****************DDKRFR*************LDIIDNGETAFSELFSANIAG***************KFNSVDGLVTSSG*********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSSNNSDDTIKVRMGKKRGGTRETNDKLSNEEIQWSKSDSAAGKKLKKKSKEKEGELDAIDDAKNSGGVVPGQNKDANLNGSGDVEMEKDLKRKGRKTSENLSNKGIQVHDDDKRFRKKQKKRSKEKQGELDIIDNGETAFSELFSANIAGNPGFDGDNNMVNEASKFNSVDGLVTSSGKKKKSKNRGMGLTVQLSQEPEVGLGGPSTWGDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query406 2.2.26 [Sep-21-2011]
Q09JZ4432 Leucine-rich repeat-conta N/A no 0.438 0.412 0.301 4e-13
Q4R6X9 523 Leucine-rich repeat-conta N/A no 0.463 0.359 0.263 2e-10
Q32PL1345 Protein phosphatase 1 reg no no 0.342 0.402 0.270 4e-10
Q9D5E4 523 Leucine-rich repeat-conta yes no 0.369 0.286 0.264 4e-10
Q5HZV9360 Protein phosphatase 1 reg yes no 0.357 0.402 0.295 6e-10
Q15435360 Protein phosphatase 1 reg yes no 0.357 0.402 0.295 1e-09
Q9H069 523 Leucine-rich repeat-conta no no 0.371 0.288 0.283 2e-09
Q3T0W4360 Protein phosphatase 1 reg no no 0.270 0.305 0.310 7e-09
Q5RFS7360 Protein phosphatase 1 reg yes no 0.357 0.402 0.289 1e-08
Q3UM45361 Protein phosphatase 1 reg no no 0.357 0.401 0.289 1e-08
>sp|Q09JZ4|DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii GN=ODA7 PE=1 SV=1 Back     alignment and function desciption
 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 93/196 (47%), Gaps = 18/196 (9%)

Query: 1   MTRLSTQQILKDNKTCDPNSIK-SLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGL 59
           MT+ +  ++ K N      S+   L    K  S ++CL D+ NL+ L L  N L +LEGL
Sbjct: 5   MTKEALLEVCKQNGLYRTASLNDKLYCNFKGFSQIACLEDYVNLKALFLEGNVLETLEGL 64

Query: 60  KHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEI 119
               +LK L + QN +  + G+E +     LN+  N+L  ++ +    +LR LI   N +
Sbjct: 65  PPLADLKCLYVQQNCIWKISGLEAVPGLDTLNISNNQLTKLEGLACCPALRTLIATHNHL 124

Query: 120 V---SICKLDQMKELNTLGMDS-------------YFFNLNNLNLQGNPVAEYDKLAKKV 163
           V   S+  L + K L TL + +                +L  L L+GNPV    K  +KV
Sbjct: 125 VTLDSVAHLAECKALQTLDLQNNELEDPGIVDILKQIPDLRCLYLKGNPVVSNIKNYRKV 184

Query: 164 -KTLLPNLCIFNARPI 178
             T +P+L   + RP+
Sbjct: 185 LVTSIPSLTYLDDRPV 200




Cilium-specific protein required for cilia structures. Axonemal dynein-associated protein that participates in a structural link between inner and outer row dyneins.
Chlamydomonas reinhardtii (taxid: 3055)
>sp|Q4R6X9|LRC48_MACFA Leucine-rich repeat-containing protein 48 OS=Macaca fascicularis GN=LRRC48 PE=2 SV=1 Back     alignment and function description
>sp|Q32PL1|PP1R7_DANRE Protein phosphatase 1 regulatory subunit 7 OS=Danio rerio GN=ppp1r7 PE=2 SV=1 Back     alignment and function description
>sp|Q9D5E4|LRC48_MOUSE Leucine-rich repeat-containing protein 48 OS=Mus musculus GN=Lrrc48 PE=2 SV=1 Back     alignment and function description
>sp|Q5HZV9|PP1R7_RAT Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus GN=Ppp1r7 PE=1 SV=1 Back     alignment and function description
>sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens GN=PPP1R7 PE=1 SV=1 Back     alignment and function description
>sp|Q9H069|LRC48_HUMAN Leucine-rich repeat-containing protein 48 OS=Homo sapiens GN=LRRC48 PE=2 SV=2 Back     alignment and function description
>sp|Q3T0W4|PP1R7_BOVIN Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus GN=PPP1R7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 Back     alignment and function description
>sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
255565717485 Protein phosphatase 1 regulatory subunit 0.972 0.814 0.401 2e-60
224131776474 predicted protein [Populus trichocarpa] 0.953 0.816 0.348 9e-55
449443646478 PREDICTED: leucine-rich repeat-containin 0.972 0.826 0.355 8e-52
357453175468 Protein phosphatase 1 regulatory subunit 0.379 0.329 0.632 9e-50
217074948468 unknown [Medicago truncatula] gi|3885080 0.379 0.329 0.632 9e-50
359479546446 PREDICTED: protein phosphatase 1 regulat 0.894 0.813 0.343 3e-49
359806683472 uncharacterized protein LOC100782829 [Gl 0.379 0.326 0.614 2e-48
356543614471 PREDICTED: protein phosphatase 1 regulat 0.379 0.326 0.608 9e-47
388511123474 unknown [Lotus japonicus] 0.379 0.324 0.614 3e-46
255635076259 unknown [Glycine max] 0.379 0.594 0.608 6e-46
>gi|255565717|ref|XP_002523848.1| Protein phosphatase 1 regulatory subunit SDS22, putative [Ricinus communis] gi|223536936|gb|EEF38574.1| Protein phosphatase 1 regulatory subunit SDS22, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  239 bits (610), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 266/496 (53%), Gaps = 101/496 (20%)

Query: 1   MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLK 60
           M +LS +QILKD ++ DPNSI SLSLT KALS+VSCLT F NLERLDL+ N+LTSLEGL 
Sbjct: 1   MGKLSMEQILKDKQSGDPNSISSLSLTQKALSEVSCLTQFTNLERLDLAFNSLTSLEGLC 60

Query: 61  HCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNK------------LRSM----DDVT 104
            C+NLKWLS+VQNKL +LKGIE L K TVLN GKNK            LR++    +D+ 
Sbjct: 61  SCINLKWLSVVQNKLLNLKGIEALYKLTVLNAGKNKLKSMDEVRSLVSLRALILNDNDIV 120

Query: 105 SVV------SLRALILNDNEI-----------------VSICKLD----------QMKEL 131
           S+        L  L+L+ N I                 +S C+L           ++KEL
Sbjct: 121 SICKLDQLKELNTLVLSRNPIREIGESLVKVKSLTKLSLSYCQLQTIGSSLKSCIELKEL 180

Query: 132 NTLGMD---------------------------------SYFFNLNNLNLQGNPVAEYDK 158
                D                                 S   +L NLNLQGNP++E DK
Sbjct: 181 RLAHNDIKSLPVELSYNKNLQNLDLGNNVITRWSDVKVLSSIVDLKNLNLQGNPISEIDK 240

Query: 159 LAKKVKTLLPNLCIFNARPIDRITKNEKDNIVDKVNDSSNNSDDTIKVRMGKKRGGTRET 218
           L+KK+  LLPNL IFNARP+D+ TK        +++D S    + + V   K++   R+ 
Sbjct: 241 LSKKILKLLPNLHIFNARPLDKGTKKGGSG---RIDDFSLIPVNELAVPREKQKNSLRKI 297

Query: 219 NDKLSNEEIQWSKSDSAAGKKLKKKSKEKEGELDAIDDAKNSGGVVPGQNK-----DANL 273
               + +  +  K      KK++ K  EKE      D     GG V  + K         
Sbjct: 298 GHDYATDA-KTEKDLKKKNKKVEDKLSEKE------DVPVYEGGEVMVEKKLKRKLSLEQ 350

Query: 274 NGSGDVEMEKDLKRKGRKTSENLSNKGIQVHDD--DKRFRKKQKKRSKEKQGELDIIDNG 331
           + S D+ +E D K+K +K +E  S K +QV  D  D   RK + K+SKE+Q ELD+ID+G
Sbjct: 351 DDSNDLGIE-DGKQKRKKANEEFSKKDVQVDKDDYDAVKRKSKSKKSKEEQDELDVIDDG 409

Query: 332 ETAFSELFSANIAGNPGFDGDNNMVNEASK-FNSVDGLVTSSGKKKKSKNRGMGLTVQLS 390
           +T F++LF+ N A +    G+  M+++A K  N + G+VT SGKKKK+KN G G  VQL 
Sbjct: 410 DTPFADLFAVNTADSLKVSGEKKMLDKAGKDINLMGGVVTVSGKKKKTKNCGAGSIVQLP 469

Query: 391 QEPEVGLGGPSTWGDE 406
              EVG+GGPSTWGDE
Sbjct: 470 AVIEVGMGGPSTWGDE 485




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224131776|ref|XP_002328105.1| predicted protein [Populus trichocarpa] gi|222837620|gb|EEE75985.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443646|ref|XP_004139588.1| PREDICTED: leucine-rich repeat-containing protein 9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357453175|ref|XP_003596864.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] gi|355485912|gb|AES67115.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074948|gb|ACJ85834.1| unknown [Medicago truncatula] gi|388508012|gb|AFK42072.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359479546|ref|XP_002273076.2| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Vitis vinifera] gi|296084874|emb|CBI28283.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359806683|ref|NP_001241543.1| uncharacterized protein LOC100782829 [Glycine max] gi|255641324|gb|ACU20939.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356543614|ref|XP_003540255.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Glycine max] Back     alignment and taxonomy information
>gi|388511123|gb|AFK43623.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255635076|gb|ACU17896.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
TAIR|locus:2176397452 AT5G22320 [Arabidopsis thalian 0.330 0.296 0.679 5.4e-53
ASPGD|ASPL0000056701355 AN10088 [Emericella nidulans ( 0.293 0.335 0.352 2.5e-13
ZFIN|ZDB-GENE-051113-288345 ppp1r7 "protein phosphatase 1, 0.352 0.414 0.269 2e-12
UNIPROTKB|Q723V1589 LMOf2365_0374 "Internalin" [Li 0.337 0.232 0.312 1.7e-11
RGD|1308169360 Ppp1r7 "protein phosphatase 1, 0.325 0.366 0.300 2.7e-11
UNIPROTKB|Q15435360 PPP1R7 "Protein phosphatase 1 0.349 0.394 0.271 1e-10
UNIPROTKB|Q3T0W4360 PPP1R7 "Protein phosphatase 1 0.293 0.330 0.310 1.4e-10
UNIPROTKB|E2RI69 522 LRRC48 "Uncharacterized protei 0.362 0.281 0.290 1.4e-10
MGI|MGI:1913635361 Ppp1r7 "protein phosphatase 1, 0.293 0.329 0.302 1.8e-10
FB|FBgn0028992326 sds22 "sds22" [Drosophila mela 0.283 0.352 0.321 2.2e-10
TAIR|locus:2176397 AT5G22320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 475 (172.3 bits), Expect = 5.4e-53, Sum P(2) = 5.4e-53
 Identities = 91/134 (67%), Positives = 115/134 (85%)

Query:     1 MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLK 60
             M  L+ +Q+LK+ KT DP+S+K L+L HKAL+DVSCL+ F NLE+LDL  NNLT L+GLK
Sbjct:     1 MNSLTVEQVLKEKKTNDPDSVKELNLGHKALTDVSCLSKFKNLEKLDLRFNNLTDLQGLK 60

Query:    61 HCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIV 120
              CVNLKWLS+V+NKLQSL GIE L+K TVLN GKNKL+SM++++S+V+LRALILNDNEI 
Sbjct:    61 SCVNLKWLSVVENKLQSLNGIEALTKLTVLNAGKNKLKSMNEISSLVNLRALILNDNEIS 120

Query:   121 SICKLDQMKELNTL 134
             SICKLD +K+LN+L
Sbjct:   121 SICKLDLLKDLNSL 134


GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
ASPGD|ASPL0000056701 AN10088 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-288 ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q723V1 LMOf2365_0374 "Internalin" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
RGD|1308169 Ppp1r7 "protein phosphatase 1, regulatory subunit 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q15435 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0W4 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RI69 LRRC48 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913635 Ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0028992 sds22 "sds22" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00660138
hypothetical protein (475 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.29890001
hypothetical protein (424 aa)
       0.460
gw1.298.28.1
hypothetical protein (642 aa)
       0.456
fgenesh4_pg.C_LG_XVI001182
hypothetical protein (328 aa)
       0.443
eugene3.01970033
annotation not avaliable (438 aa)
       0.442
eugene3.00150629
hypothetical protein (516 aa)
       0.427
eugene3.00410224
hypothetical protein (478 aa)
       0.425
gw1.V.1354.1
hypothetical protein (414 aa)
       0.423
fgenesh4_pg.C_scaffold_18994000001
hypothetical protein (346 aa)
       0.418
fgenesh4_pg.C_scaffold_184000015
hypothetical protein (444 aa)
       0.418
fgenesh4_pg.C_scaffold_166000065
hypothetical protein (415 aa)
       0.418

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
 Score = 42.9 bits (102), Expect = 4e-06
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 42 NLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEG 83
          NLE LDLS+N +T L  L +  NL+ L L  NK+  L  +  
Sbjct: 2  NLETLDLSNNQITDLPPLSNLPNLETLDLSGNKITDLSPLSN 43


Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each Leucine Rich Repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine Rich Repeats are often flanked by cysteine rich domains. Length = 43

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 406
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.81
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.57
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.56
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.47
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.46
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.44
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.3
KOG0617264 consensus Ras suppressor protein (contains leucine 99.29
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 99.27
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.16
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.16
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.14
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.14
KOG4237498 consensus Extracellular matrix protein slit, conta 99.1
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.04
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.03
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.97
KOG4237498 consensus Extracellular matrix protein slit, conta 98.94
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.92
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.9
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.89
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.63
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.58
KOG2123388 consensus Uncharacterized conserved protein [Funct 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 98.48
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.44
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.43
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.42
PLN03150623 hypothetical protein; Provisional 98.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 98.28
PLN03150623 hypothetical protein; Provisional 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.07
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.97
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.88
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.81
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.64
PRK15386426 type III secretion protein GogB; Provisional 97.49
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.39
PRK15386426 type III secretion protein GogB; Provisional 97.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.4
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 96.23
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.11
KOG4308478 consensus LRR-containing protein [Function unknown 92.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.25
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.87
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.85
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 88.95
KOG1947482 consensus Leucine rich repeat proteins, some prote 88.66
KOG4308478 consensus LRR-containing protein [Function unknown 88.22
KOG4341483 consensus F-box protein containing LRR [General fu 87.23
smart0037026 LRR Leucine-rich repeats, outliers. 86.76
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.89
smart0037026 LRR Leucine-rich repeats, outliers. 85.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.57
KOG4341483 consensus F-box protein containing LRR [General fu 83.51
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.58
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.0
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
Probab=99.81  E-value=1.5e-20  Score=169.38  Aligned_cols=160  Identities=27%  Similarity=0.453  Sum_probs=57.4

Q ss_pred             CCccccccccCCCCCCCCCCccEEEeeCCCCCCCCCCC-CCCCCcEEEccCCCCCCCCCCCCCCCCcEEEecCCCCCCCC
Q 015448            1 MTRLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLT-DFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLK   79 (406)
Q Consensus         1 m~~Ls~n~i~~~~~~~~~~~L~~L~Ls~n~l~~i~~l~-~l~~L~~L~Ls~N~l~~l~~l~~L~~L~~L~Ls~N~l~~l~   79 (406)
                      ||+|+.+-|.++....++..+++|+|.+|.|+.+..++ .+.+|+.|+|++|.|+.++++..++                
T Consensus         1 ~~~lt~~~i~~~~~~~n~~~~~~L~L~~n~I~~Ie~L~~~l~~L~~L~Ls~N~I~~l~~l~~L~----------------   64 (175)
T PF14580_consen    1 MVRLTANMIEQIAQYNNPVKLRELNLRGNQISTIENLGATLDKLEVLDLSNNQITKLEGLPGLP----------------   64 (175)
T ss_dssp             -----------------------------------S--TT-TT--EEE-TTS--S--TT----T----------------
T ss_pred             CccccccccccccccccccccccccccccccccccchhhhhcCCCEEECCCCCCccccCccChh----------------
Confidence            78888888887777777777777777777777666554 3555555555555555555554444                


Q ss_pred             CCCCCCCCcEEEcCCCCCCCCc-CC-CCCCCCCEEEccCCccCCccccCCCCCCcEeeCCCCCCCCCEEEcCCCCCCCch
Q 015448           80 GIEGLSKPTVLNVGKNKLRSMD-DV-TSVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYD  157 (406)
Q Consensus        80 ~l~~l~~L~~L~Ls~N~i~~l~-~l-~~l~~L~~L~Ls~N~i~~l~~l~~L~~L~~L~Ls~~l~~L~~L~Ls~N~i~~~~  157 (406)
                            .|++|++++|.|+++. .+ ..+++|+.|+|++|+|.++..+..+.         .+++|+.|+|.+||++..+
T Consensus        65 ------~L~~L~L~~N~I~~i~~~l~~~lp~L~~L~L~~N~I~~l~~l~~L~---------~l~~L~~L~L~~NPv~~~~  129 (175)
T PF14580_consen   65 ------RLKTLDLSNNRISSISEGLDKNLPNLQELYLSNNKISDLNELEPLS---------SLPKLRVLSLEGNPVCEKK  129 (175)
T ss_dssp             ------T--EEE--SS---S-CHHHHHH-TT--EEE-TTS---SCCCCGGGG---------G-TT--EEE-TT-GGGGST
T ss_pred             ------hhhhcccCCCCCCccccchHHhCCcCCEEECcCCcCCChHHhHHHH---------cCCCcceeeccCCcccchh
Confidence                  4555555555555543 23 24566667777777766665544443         5679999999999999999


Q ss_pred             hHHHHHHhcCCCcccccCcCCChhhhhhhhhhhc
Q 015448          158 KLAKKVKTLLPNLCIFNARPIDRITKNEKDNIVD  191 (406)
Q Consensus       158 ~~~~~~~~~lp~L~~Ld~~~~~~~~~~~~~~~l~  191 (406)
                      .|+.+++..+|+|+.||+.+++..++..+..++.
T Consensus       130 ~YR~~vi~~lP~Lk~LD~~~V~~~ER~~A~~~f~  163 (175)
T PF14580_consen  130 NYRLFVIYKLPSLKVLDGQDVTEEERQEAEKLFK  163 (175)
T ss_dssp             THHHHHHHH-TT-SEETTEETTS-B---------
T ss_pred             hHHHHHHHHcChhheeCCEEccHHHhcccccccc
Confidence            9999999999999999999999999998887775



>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 1e-08
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-08
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-08
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-08
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 6e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-08
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 7e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-08
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 4e-07
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 7e-06
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 1e-05
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 4e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-04
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 37/112 (33%), Positives = 61/112 (54%) Query: 20 SIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLK 79 SIK+L LT ++DV+ L +NL+ L L N +T++ L NL++LS+ N++ L Sbjct: 114 SIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYLSIGNNQVNDLT 173 Query: 80 GIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKEL 131 + LSK T L NK+ + + S+ +L + L DN+I + L + L Sbjct: 174 PLANLSKLTTLRADDNKISDISPLASLPNLIEVHLKDNQISDVSPLANLSNL 225
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
 Score = 97.8 bits (244), Expect = 3e-23
 Identities = 38/183 (20%), Positives = 82/183 (44%), Gaps = 21/183 (11%)

Query: 4   LSTQQILKDNK----TCDPN--SIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLE 57
           L ++ I           D         +L  K+++D     + N+++++  +++++ S++
Sbjct: 3   LGSETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQ 62

Query: 58  GLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDN 117
           G+++  N+  L L  NKL  +K +  L     L + +NK++ +  +  +  L++L L  N
Sbjct: 63  GIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHN 122

Query: 118 EIVSICKLDQMKELNTLGMD----------SYFFNLNNLNLQGNPVAEYDKLAKKVKTLL 167
            I  I  L  + +L +L +           S    L+ L+L+ N +++   LA      L
Sbjct: 123 GISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAG-----L 177

Query: 168 PNL 170
             L
Sbjct: 178 TKL 180


>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.73
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.71
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.7
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.69
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.69
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.68
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.68
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.68
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.67
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.67
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.65
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.63
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.63
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.62
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.62
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.61
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.61
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.61
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.59
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.59
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.59
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.57
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.57
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.57
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.57
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.55
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.52
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.5
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.5
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.5
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.48
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.48
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.46
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.41
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.39
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.32
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.28
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.28
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.26
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.11
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.97
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.66
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.41
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.3
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.07
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.09
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
Probab=99.83  E-value=5.9e-20  Score=178.26  Aligned_cols=168  Identities=20%  Similarity=0.323  Sum_probs=128.4

Q ss_pred             ccccccccCCCCCCCCCCccEEEeeCCCCCCCCCCCCCCCCcEEEccCCCCCCCCCCCCCCCCcEEEecCCCCCCCCCCC
Q 015448            3 RLSTQQILKDNKTCDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIE   82 (406)
Q Consensus         3 ~Ls~n~i~~~~~~~~~~~L~~L~Ls~n~l~~i~~l~~l~~L~~L~Ls~N~l~~l~~l~~L~~L~~L~Ls~N~l~~l~~l~   82 (406)
                      +++.+.+..+.....+++|+.|+|++|.|+.++.+..+++|++|+|++|.|+.++.+..+++|++|+|++|.|+.++.+.
T Consensus        47 ~l~~~~i~~l~~~~~l~~L~~L~L~~n~i~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~l~  126 (308)
T 1h6u_A           47 SAFGTGVTTIEGVQYLNNLIGLELKDNQITDLAPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLA  126 (308)
T ss_dssp             ECTTSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCCSCCEEECCSCCCSCCGGGTTCTTCCEEECTTSCCCCCGGGT
T ss_pred             EeeCCCccCchhhhccCCCCEEEccCCcCCCChhHccCCCCCEEEccCCcCCCchhhcCCCCCCEEECCCCCCCCchhhc
Confidence            34555666665556677888888888888877767778888888888888887777777888888888888888777777


Q ss_pred             CCCCCcEEEcCCCCCCCCcCCCCCCCCCEEEccCCccCCccccCCCCCCcEeeCC----------CCCCCCCEEEcCCCC
Q 015448           83 GLSKPTVLNVGKNKLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMD----------SYFFNLNNLNLQGNP  152 (406)
Q Consensus        83 ~l~~L~~L~Ls~N~i~~l~~l~~l~~L~~L~Ls~N~i~~l~~l~~L~~L~~L~Ls----------~~l~~L~~L~Ls~N~  152 (406)
                      .+++|++|+|++|.++.++.+..+++|++|+|++|.++.++.+..+++|+.|+|+          ..+++|++|+|++|.
T Consensus       127 ~l~~L~~L~l~~n~l~~~~~l~~l~~L~~L~l~~n~l~~~~~l~~l~~L~~L~l~~n~l~~~~~l~~l~~L~~L~L~~N~  206 (308)
T 1h6u_A          127 GLSNLQVLYLDLNQITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASLPNLIEVHLKNNQ  206 (308)
T ss_dssp             TCTTCCEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCCEEECTTSC
T ss_pred             CCCCCCEEECCCCccCcCccccCCCCccEEEccCCcCCCChhhcCCCCCCEEECCCCccCcChhhcCCCCCCEEEccCCc
Confidence            7888888888888888777777778888888888888877777777888888777          466778888888888


Q ss_pred             CCCchhHHHHHHhcCCCcccccC
Q 015448          153 VAEYDKLAKKVKTLLPNLCIFNA  175 (406)
Q Consensus       153 i~~~~~~~~~~~~~lp~L~~Ld~  175 (406)
                      +..++.     +..+++|+.|+.
T Consensus       207 l~~~~~-----l~~l~~L~~L~l  224 (308)
T 1h6u_A          207 ISDVSP-----LANTSNLFIVTL  224 (308)
T ss_dssp             CCBCGG-----GTTCTTCCEEEE
T ss_pred             cCcccc-----ccCCCCCCEEEc
Confidence            877764     456777776654



>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 406
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-08
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 63.2 bits (153), Expect = 5e-13
 Identities = 31/126 (24%), Positives = 60/126 (47%), Gaps = 10/126 (7%)

Query: 46  LDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLK-GIEGLSKPTVLNVGKNKLRSMDDVT 104
           L L+  +LT L  L+  + +  L L  N+L++L   +  L    VL    N L ++D V 
Sbjct: 3   LHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVA 62

Query: 105 SVVSLRALILNDNEIVSICKLDQMKELNTLGMDSYFFNLNNLNLQGNPVAEYDKLAKKVK 164
           ++  L+ L+L +N +     +  +              L  LNLQGN + + + + +++ 
Sbjct: 63  NLPRLQELLLCNNRLQQSAAIQPLVSCP---------RLVLLNLQGNSLCQEEGIQERLA 113

Query: 165 TLLPNL 170
            +LP++
Sbjct: 114 EMLPSV 119


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.82
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.7
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.68
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.54
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.49
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.24
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.24
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.96
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.85
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.84
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.58
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.59
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.71
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin B
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.82  E-value=4.3e-20  Score=166.01  Aligned_cols=153  Identities=22%  Similarity=0.362  Sum_probs=131.7

Q ss_pred             CCCCCccEEEeeCCCCCCCCCCCCCCCCcEEEccCCCCCCCCCCCCCCCCcEEEecCCCCCCCCCCCCCCCCcEEEcCCC
Q 015448           16 CDPNSIKSLSLTHKALSDVSCLTDFNNLERLDLSSNNLTSLEGLKHCVNLKWLSLVQNKLQSLKGIEGLSKPTVLNVGKN   95 (406)
Q Consensus        16 ~~~~~L~~L~Ls~n~l~~i~~l~~l~~L~~L~Ls~N~l~~l~~l~~L~~L~~L~Ls~N~l~~l~~l~~l~~L~~L~Ls~N   95 (406)
                      ..+.+|+.|++++|.|+.++.+..|++|++|+|++|.|+.++++..+++|++|++++|.+..++++..++.|+.|++++|
T Consensus        37 ~~l~~l~~L~l~~~~i~~l~~l~~l~nL~~L~Ls~N~l~~~~~l~~l~~L~~L~l~~n~~~~~~~l~~l~~L~~L~l~~~  116 (199)
T d2omxa2          37 TDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNN  116 (199)
T ss_dssp             HHHTTCCEEECTTSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEECCSS
T ss_pred             HHhcCCCEEECCCCCCCCccccccCCCcCcCccccccccCcccccCCccccccccccccccccccccccccccccccccc
Confidence            34678999999999999988888899999999999999998889999999999999999998888889999999999999


Q ss_pred             CCCCCcCCCCCCCCCEEEccCCccCCccccCCCCCCcEeeCC----------CCCCCCCEEEcCCCCCCCchhHHHHHHh
Q 015448           96 KLRSMDDVTSVVSLRALILNDNEIVSICKLDQMKELNTLGMD----------SYFFNLNNLNLQGNPVAEYDKLAKKVKT  165 (406)
Q Consensus        96 ~i~~l~~l~~l~~L~~L~Ls~N~i~~l~~l~~L~~L~~L~Ls----------~~l~~L~~L~Ls~N~i~~~~~~~~~~~~  165 (406)
                      .+..++.+..+++|+.|++++|.+..++.+..+++|+.|++.          ..+++|++|+|++|+|+.++.     +.
T Consensus       117 ~~~~~~~~~~l~~L~~L~l~~n~l~~~~~l~~~~~L~~L~l~~n~l~~l~~l~~l~~L~~L~ls~N~i~~i~~-----l~  191 (199)
T d2omxa2         117 QITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLNFSSNQVTDLKPLANLTTLERLDISSNKVSDISV-----LA  191 (199)
T ss_dssp             CCCCCGGGTTCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-----GG
T ss_pred             ccccccccchhhhhHHhhhhhhhhcccccccccccccccccccccccCCccccCCCCCCEEECCCCCCCCCcc-----cc
Confidence            998888888899999999999999888888888888888776          567888888888888887764     45


Q ss_pred             cCCCcccc
Q 015448          166 LLPNLCIF  173 (406)
Q Consensus       166 ~lp~L~~L  173 (406)
                      .+++|+.|
T Consensus       192 ~L~~L~~L  199 (199)
T d2omxa2         192 KLTNLESL  199 (199)
T ss_dssp             GCTTCSEE
T ss_pred             CCCCCCcC
Confidence            67776643



>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure