Citrus Sinensis ID: 015481

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MTNKNNPSLNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCCLPRRPAPSTASAPTTLAAAPEHPEDWGAFSPGHLHHP
cccccccHHHHHHHcHHHHHHHHHccccHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccccccccEEEEEEccccccEEcccccccccccccccccccccccccccHHccccccccEEEccccEEEEcccccccccccccEEEccccccEEccccccccccccEEEccccEEEEcccccccccccccEEcccccccccccHHHHHcHHHHcHHHcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccHHccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEccccccccccHHHHHccHcccEEEccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccEccccccccccccEEEEEEccccccccccHHHcccccccEEEEccccccccccHHHHcccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEccccccccccHHHcccccEEEEEccccccccccHHHHHHHHHHcEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccHcccHHHHHHcccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccc
mtnknnpslnLALCGSLLLSIILLLskpshqalddndigfiipnPRLLKAYIALQFWKlsitsdpngftsnwcgpnvcnytgvycapapddpdcltvagidlnqaniagtlpekLGLLQDLALFHinsnrfcgtipdsfRNMQLLFELDvsnnqfsgcfpsvvlclpslkfldIRFNqfegeipsavfdlKLDALFlnnnkftsslpnnignspVSVLVLANnnfdsclppsltkMAGTLNEIILANAKLKGcllkdigllnqVTVFDVSFNnlvgslpesmgnmKSLEQLNVAHNnlsgaipnsicclpklenftysynffcteplaclklkvkddrqncipnrpfqrspmecktfyshpvdcgascclprrpapstasapttlaaapehpedwgafspghlhhp
mtnknnpslNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIpnrpfqrspmecKTFYSHPVDCGASCCLPRRPAPSTASAPTTLAAAPEHPEDWGAFspghlhhp
MTNKNNPslnlalcgslllsiilllsKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCClprrpapstasapttlaaapEHPEDWGAFSPGHLHHP
********LNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLP********LEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCCL************************************
***KNNPSLNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGA****************************************
MTNKNNPSLNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCCLPRR**************APEHPEDWGAFSPGHLHHP
*TNKNNPSLNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCC***********************EDWGAFSPGHLHHP
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNKNNPSLNLALCGSLLLSIILLLSKPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCCLPRRPAPSTASAPTTLAAAPEHPEDWGAFSPGHLHHP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query406 2.2.26 [Sep-21-2011]
Q9LUI1470 Leucine-rich repeat exten yes no 0.807 0.697 0.705 1e-132
Q9T0K5 760 Leucine-rich repeat exten no no 0.800 0.427 0.660 1e-120
Q9LHF1494 Leucine-rich repeat exten no no 0.817 0.672 0.637 1e-118
Q9SN46 857 Leucine-rich repeat exten no no 0.822 0.389 0.619 1e-115
Q4PSE6433 Leucine-rich repeat exten no no 0.874 0.819 0.545 1e-107
O48809 786 Leucine-rich repeat exten no no 0.839 0.433 0.573 1e-106
O65375 744 Leucine-rich repeat exten no no 0.827 0.451 0.554 1e-103
Q9LJ64 956 Pollen-specific leucine-r no no 0.817 0.347 0.525 2e-99
Q9XIL9 727 Pollen-specific leucine-r no no 0.903 0.504 0.480 4e-99
O81765 699 Pollen-specific leucine-r no no 0.899 0.522 0.475 2e-97
>sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 Back     alignment and function desciption
 Score =  472 bits (1215), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/329 (70%), Positives = 274/329 (83%), Gaps = 1/329 (0%)

Query: 42  IPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGID 101
           I NPRLLKA+ ALQ WK +ITSDPNGFTSNWCGPNVCNYTGV+CAPA D+P  LTVAGID
Sbjct: 46  ITNPRLLKAFTALQAWKFTITSDPNGFTSNWCGPNVCNYTGVFCAPALDNPYVLTVAGID 105

Query: 102 LNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPS 161
           LN ANIAG LP +LGLL DLALFHINSNRF G +P + + + LL ELDVSNN+ SG FPS
Sbjct: 106 LNHANIAGYLPLELGLLTDLALFHINSNRFQGQLPKTLKCLHLLHELDVSNNKLSGEFPS 165

Query: 162 VVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLA 221
           V+  LPSLKFLDIRFN+F+G++PS +FDL LDALF+N+NKF   LP NIGNSPVSVLVLA
Sbjct: 166 VIFSLPSLKFLDIRFNEFQGDVPSQLFDLNLDALFINDNKFQFRLPRNIGNSPVSVLVLA 225

Query: 222 NNNFD-SCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPE 280
           NN+   SC+PPS  KM  TL+EII+ N++L GCL ++IGLLNQ+TVFDVS+NNLVGSLPE
Sbjct: 226 NNDLQGSCVPPSFYKMGKTLHEIIITNSQLTGCLNREIGLLNQLTVFDVSYNNLVGSLPE 285

Query: 281 SMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQN 340
           ++G+MKSLEQLN+AHN  SG IP SIC LP+LENFTYSYNFF  EP ACL+L+  DDR+N
Sbjct: 286 TIGDMKSLEQLNIAHNKFSGYIPESICRLPRLENFTYSYNFFSGEPPACLRLQEFDDRRN 345

Query: 341 CIPNRPFQRSPMECKTFYSHPVDCGASCC 369
           C+P+RP QRS  ECK+F S+P+DC +  C
Sbjct: 346 CLPSRPMQRSLAECKSFSSYPIDCASFGC 374
Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 Back     alignment and function description
>sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 Back     alignment and function description
>sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=1 SV=1 Back     alignment and function description
>sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 Back     alignment and function description
>sp|O81765|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=PEX4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
224107963349 predicted protein [Populus trichocarpa] 0.854 0.994 0.744 1e-142
225432760394 PREDICTED: leucine-rich repeat extensin- 0.896 0.923 0.686 1e-140
255552075356 serine-threonine protein kinase, plant-t 0.866 0.988 0.707 1e-139
255552077364 serine-threonine protein kinase, plant-t 0.852 0.950 0.681 1e-134
356575879399 PREDICTED: leucine-rich repeat extensin- 0.886 0.902 0.656 1e-132
449433297376 PREDICTED: leucine-rich repeat extensin- 0.874 0.944 0.682 1e-131
297835284441 hypothetical protein ARALYDRAFT_898761 [ 0.820 0.755 0.688 1e-130
15228861470 leucine-rich repeat extensin-like protei 0.807 0.697 0.705 1e-130
224107965325 predicted protein [Populus trichocarpa] 0.795 0.993 0.693 1e-129
255635550390 unknown [Glycine max] 0.866 0.902 0.658 1e-126
>gi|224107963|ref|XP_002314669.1| predicted protein [Populus trichocarpa] gi|222863709|gb|EEF00840.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  511 bits (1317), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 259/348 (74%), Positives = 286/348 (82%), Gaps = 1/348 (0%)

Query: 27  KPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCA 86
           KPS+Q   D D+   IPNPRLLKAYIALQ WK +ITSDP  FTSNWCGPNVCNYTGVYCA
Sbjct: 2   KPSYQLSVDLDLP-PIPNPRLLKAYIALQAWKHAITSDPKNFTSNWCGPNVCNYTGVYCA 60

Query: 87  PAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLF 146
           PAPDD D LTVAGIDLN A IAG+LPE LGLL DLALFHINSNRF G+IP SF  + LL+
Sbjct: 61  PAPDDRDTLTVAGIDLNHAKIAGSLPEDLGLLTDLALFHINSNRFFGSIPGSFCELNLLY 120

Query: 147 ELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSL 206
           ELDVSNNQFSG FPSVVL LPSLKFLDIR+N+F G+IPS +FD  LDALF+NNNKF SS+
Sbjct: 121 ELDVSNNQFSGKFPSVVLSLPSLKFLDIRYNEFRGKIPSKLFDKNLDALFINNNKFQSSV 180

Query: 207 PNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTV 266
           P N+G SPVSV+VLANNNF+SC P SLTKMAGTL+EIIL N  L GCL  DIGL+NQ+TV
Sbjct: 181 PKNLGKSPVSVIVLANNNFNSCFPSSLTKMAGTLDEIILTNMGLTGCLPSDIGLMNQLTV 240

Query: 267 FDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEP 326
           FDVS N LVGSLPES+G+MK LEQLNVAHN L G IP SIC LP+LENFTYSYN+FC EP
Sbjct: 241 FDVSSNKLVGSLPESIGDMKKLEQLNVAHNMLYGDIPRSICLLPRLENFTYSYNYFCGEP 300

Query: 327 LACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCCLPRRP 374
            ACLKL+ KDD +NCIP RP QRSP ECK+FY+ P  C AS C P  P
Sbjct: 301 PACLKLQAKDDTENCIPYRPLQRSPQECKSFYAFPPSCSASGCSPPPP 348

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432760|ref|XP_002279192.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552075|ref|XP_002517082.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223543717|gb|EEF45245.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255552077|ref|XP_002517083.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223543718|gb|EEF45246.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356575879|ref|XP_003556064.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Glycine max] Back     alignment and taxonomy information
>gi|449433297|ref|XP_004134434.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Cucumis sativus] gi|449518721|ref|XP_004166385.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297835284|ref|XP_002885524.1| hypothetical protein ARALYDRAFT_898761 [Arabidopsis lyrata subsp. lyrata] gi|297331364|gb|EFH61783.1| hypothetical protein ARALYDRAFT_898761 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228861|ref|NP_188919.1| leucine-rich repeat extensin-like protein 6 [Arabidopsis thaliana] gi|75335502|sp|Q9LUI1.1|LRX6_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 6; Short=AtLRX6; Short=LRR/EXTENSIN6; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|9279698|dbj|BAB01255.1| extensin protein-like [Arabidopsis thaliana] gi|219291096|gb|ACL13984.1| At3g22800 [Arabidopsis thaliana] gi|332643157|gb|AEE76678.1| leucine-rich repeat extensin-like protein 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224107965|ref|XP_002314670.1| predicted protein [Populus trichocarpa] gi|222863710|gb|EEF00841.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255635550|gb|ACU18125.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
TAIR|locus:2094389470 AT3G22800 "AT3G22800" [Arabido 0.807 0.697 0.705 4.8e-126
TAIR|locus:2142105 760 LRX3 "AT4G13340" [Arabidopsis 0.800 0.427 0.660 3.5e-114
TAIR|locus:2094854494 AT3G24480 [Arabidopsis thalian 0.817 0.672 0.637 7.6e-112
TAIR|locus:2124142 857 AT4G18670 "AT4G18670" [Arabido 0.822 0.389 0.619 3.4e-109
TAIR|locus:2179449433 AT5G25550 "AT5G25550" [Arabido 0.810 0.759 0.568 1.9e-99
TAIR|locus:2008895 744 LRX1 "AT1G12040" [Arabidopsis 0.802 0.438 0.569 4.5e-98
TAIR|locus:2085889 956 AT3G19020 [Arabidopsis thalian 0.817 0.347 0.525 6.1e-94
TAIR|locus:2121348391 AT4G28380 [Arabidopsis thalian 0.793 0.823 0.509 9e-93
TAIR|locus:2010247 847 AT1G49490 [Arabidopsis thalian 0.800 0.383 0.533 5e-92
TAIR|locus:2044576 727 AT2G15880 [Arabidopsis thalian 0.817 0.456 0.513 6.3e-92
TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1238 (440.9 bits), Expect = 4.8e-126, P = 4.8e-126
 Identities = 232/329 (70%), Positives = 274/329 (83%)

Query:    42 IPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCAPAPDDPDCLTVAGID 101
             I NPRLLKA+ ALQ WK +ITSDPNGFTSNWCGPNVCNYTGV+CAPA D+P  LTVAGID
Sbjct:    46 ITNPRLLKAFTALQAWKFTITSDPNGFTSNWCGPNVCNYTGVFCAPALDNPYVLTVAGID 105

Query:   102 LNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPS 161
             LN ANIAG LP +LGLL DLALFHINSNRF G +P + + + LL ELDVSNN+ SG FPS
Sbjct:   106 LNHANIAGYLPLELGLLTDLALFHINSNRFQGQLPKTLKCLHLLHELDVSNNKLSGEFPS 165

Query:   162 VVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSLPNNIGNSPVSVLVLA 221
             V+  LPSLKFLDIRFN+F+G++PS +FDL LDALF+N+NKF   LP NIGNSPVSVLVLA
Sbjct:   166 VIFSLPSLKFLDIRFNEFQGDVPSQLFDLNLDALFINDNKFQFRLPRNIGNSPVSVLVLA 225

Query:   222 NNNFD-SCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPE 280
             NN+   SC+PPS  KM  TL+EII+ N++L GCL ++IGLLNQ+TVFDVS+NNLVGSLPE
Sbjct:   226 NNDLQGSCVPPSFYKMGKTLHEIIITNSQLTGCLNREIGLLNQLTVFDVSYNNLVGSLPE 285

Query:   281 SMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLACLKLKVKDDRQN 340
             ++G+MKSLEQLN+AHN  SG IP SIC LP+LENFTYSYNFF  EP ACL+L+  DDR+N
Sbjct:   286 TIGDMKSLEQLNIAHNKFSGYIPESICRLPRLENFTYSYNFFSGEPPACLRLQEFDDRRN 345

Query:   341 CIPNRPFQRSPMECKTFYSHPVDCGASCC 369
             C+P+RP QRS  ECK+F S+P+DC +  C
Sbjct:   346 CLPSRPMQRSLAECKSFSSYPIDCASFGC 374
GO:0005199 "structural constituent of cell wall" evidence=ISS
TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179449 AT5G25550 "AT5G25550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121348 AT4G28380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010247 AT1G49490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044576 AT2G15880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LUI1LRX6_ARATHNo assigned EC number0.70510.80780.6978yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  126 bits (318), Expect = 2e-31
 Identities = 91/273 (33%), Positives = 137/273 (50%), Gaps = 14/273 (5%)

Query: 57  WKLSITSDPNGFTSNWCGPN-VCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKL 115
           +K SI +DP  + SNW     VC + G+ C       +   V  IDL+  NI+G +   +
Sbjct: 37  FKSSI-NDPLKYLSNWNSSADVCLWQGITCN------NSSRVVSIDLSGKNISGKISSAI 89

Query: 116 GLLQDLALFHINSNRFCGTIPDS-FRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDI 174
             L  +   ++++N+  G IPD  F     L  L++SNN F+G  P     +P+L+ LD+
Sbjct: 90  FRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLETLDL 147

Query: 175 RFNQFEGEIPSAV-FDLKLDALFLNNNKFTSSLPNNIGN-SPVSVLVLANNNFDSCLPPS 232
             N   GEIP+ +     L  L L  N     +PN++ N + +  L LA+N     +P  
Sbjct: 148 SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE 207

Query: 233 LTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLN 292
           L +M  +L  I L    L G +  +IG L  +   D+ +NNL G +P S+GN+K+L+ L 
Sbjct: 208 LGQMK-SLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLF 266

Query: 293 VAHNNLSGAIPNSICCLPKLENFTYSYNFFCTE 325
           +  N LSG IP SI  L KL +   S N    E
Sbjct: 267 LYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE 299

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 406
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
KOG4237498 consensus Extracellular matrix protein slit, conta 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
KOG4237498 consensus Extracellular matrix protein slit, conta 99.7
PLN03150623 hypothetical protein; Provisional 99.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.46
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.43
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.34
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.23
PLN03150623 hypothetical protein; Provisional 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.33
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.94
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.64
PRK15386 426 type III secretion protein GogB; Provisional 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.95
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.92
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.66
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.2
KOG4308478 consensus LRR-containing protein [Function unknown 94.54
KOG4308478 consensus LRR-containing protein [Function unknown 94.53
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.71
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.53
KOG4341483 consensus F-box protein containing LRR [General fu 93.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.06
smart0037026 LRR Leucine-rich repeats, outliers. 91.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.28
smart0037026 LRR Leucine-rich repeats, outliers. 90.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.15
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.32
KOG1947482 consensus Leucine rich repeat proteins, some prote 81.23
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.32
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.2e-36  Score=327.90  Aligned_cols=286  Identities=30%  Similarity=0.465  Sum_probs=168.8

Q ss_pred             HHHHHHHHHHHhccCCCCCCCCCCC-CCCCCCcceeecCCCCCCCCCCcEEEEECCCCCccccCcccccCCCCCCEEEcC
Q 015481           49 KAYIALQFWKLSITSDPNGFTSNWC-GPNVCNYTGVYCAPAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHIN  127 (406)
Q Consensus        49 ~~~~~L~~~~~~~~~~~~~~~~~w~-~~~~c~w~gv~c~~~~~~~~~~~l~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~  127 (406)
                      +++.+|++||+++. ++.+...+|. ..++|.|.||+|+.      ..+|+.|+|++|++.+.++..|..+++|+.|+++
T Consensus        29 ~~~~~l~~~~~~~~-~~~~~~~~w~~~~~~c~w~gv~c~~------~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls  101 (968)
T PLN00113         29 EELELLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITCNN------SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLS  101 (968)
T ss_pred             HHHHHHHHHHHhCC-CCcccCCCCCCCCCCCcCcceecCC------CCcEEEEEecCCCccccCChHHhCCCCCCEEECC
Confidence            56789999999984 5666678896 45789999999973      2478888888888877777777788888888888


Q ss_pred             CCcCCccCCchhh-CCcCCceEecccccccccCchhhcCCCCCcEEEeecCcCCCCCchhhhccc-cCeeeccccccccC
Q 015481          128 SNRFCGTIPDSFR-NMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLK-LDALFLNNNKFTSS  205 (406)
Q Consensus       128 ~n~l~~~~p~~~~-~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~-L~~L~L~~n~l~~~  205 (406)
                      +|++++.+|..+. .+++|++|+|++|.+++.+|.  ..+++|++|+|++|.+.+.+|..+..+. |++|++++|.+.+.
T Consensus       102 ~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~  179 (968)
T PLN00113        102 NNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGK  179 (968)
T ss_pred             CCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccccc
Confidence            8887777776543 666677777766666654443  2345555555555555545555444444 55555555555444


Q ss_pred             CCCCCCCCC-ccEEEcccccCCcCCchhHHhcc-----------------------cccceeeeccCCCcccChhhhccC
Q 015481          206 LPNNIGNSP-VSVLVLANNNFDSCLPPSLTKMA-----------------------GTLNEIILANAKLKGCLLKDIGLL  261 (406)
Q Consensus       206 ~~~~~~~~~-L~~L~l~~n~l~~~~p~~l~~l~-----------------------~~L~~L~l~~n~l~~~~~~~l~~l  261 (406)
                      +|..+.... |++|++++|.+.+.+|..+..+.                       .+|++|++++|++++.+|..++++
T Consensus       180 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  259 (968)
T PLN00113        180 IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL  259 (968)
T ss_pred             CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCC
Confidence            444443322 44555555544444444444444                       045555555554444444444445


Q ss_pred             CCCcEEEeecCCCCCccchhhcCCCCCCEEeCcCCcccccCchhhcCCCCCCEEEeeCCcCCcCCC----cCCCCCeeeC
Q 015481          262 NQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPL----ACLKLKVKDD  337 (406)
Q Consensus       262 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~----~~~~L~~L~l  337 (406)
                      ++|++|+|++|++++.+|..+..+++|++|+|++|.+.+.+|..+..+++|+.|++++|.+++..|    .+++|+.|++
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L  339 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQL  339 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEEC
Confidence            555555555555544444445555555555555555554455555555555555555555544443    2345555555


Q ss_pred             CCCCCC
Q 015481          338 RQNCIP  343 (406)
Q Consensus       338 ~~N~l~  343 (406)
                      ++|.++
T Consensus       340 ~~n~l~  345 (968)
T PLN00113        340 WSNKFS  345 (968)
T ss_pred             cCCCCc
Confidence            555554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-15
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 118/261 (45%), Gaps = 28/261 (10%)
Query: 93  DCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIP----DSFRNMQL---- 144
           DC  +  +D++   ++G     +    +L L +I+SN+F G IP     S + + L    
Sbjct: 218 DCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENK 277
Query: 145 ---------------LFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIP-SAVF 188
                          L  LD+S N F G  P        L+ L +  N F GE+P   + 
Sbjct: 278 FTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLL 337
Query: 189 DLK-LDALFLNNNKFTSSLPNNIGNSPVSVLV--LANNNFDSCLPPSLTKM-AGTLNEII 244
            ++ L  L L+ N+F+  LP ++ N   S+L   L++NNF   + P+L +    TL E+ 
Sbjct: 338 KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 397
Query: 245 LANAKLKGCLLKDIGLLNQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPN 304
           L N    G +   +   +++    +SFN L G++P S+G++  L  L +  N L G IP 
Sbjct: 398 LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 457
Query: 305 SICCLPKLENFTYSYNFFCTE 325
            +  +  LE     +N    E
Sbjct: 458 ELMYVKTLETLILDFNDLTGE 478
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-37
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  153 bits (389), Expect = 1e-43
 Identities = 70/299 (23%), Positives = 110/299 (36%), Gaps = 38/299 (12%)

Query: 53  ALQFWKLSITSDPNGFTSNWCGPNVCNY--TGVYCAPAPDDPDCLTVAGIDL-------- 102
           AL   K  +  +P   +S     + CN    GV C           V  +DL        
Sbjct: 10  ALLQIKKDL-GNPTTLSSWLPTTDCCNRTWLGVLCDTDTQ---TYRVNNLDLSGLNLPKP 65

Query: 103 -------------------NQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQ 143
                                 N+ G +P  +  L  L   +I      G IPD    ++
Sbjct: 66  YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK 125

Query: 144 LLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLK--LDALFLNNNK 201
            L  LD S N  SG  P  +  LP+L  +    N+  G IP +         ++ ++ N+
Sbjct: 126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR 185

Query: 202 FTSSLPNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLL 261
            T  +P    N  ++ + L+ N  +               +I LA   L    L  +GL 
Sbjct: 186 LTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDK-NTQKIHLAKNSLAF-DLGKVGLS 243

Query: 262 NQVTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYN 320
             +   D+  N + G+LP+ +  +K L  LNV+ NNL G IP     L + +   Y+ N
Sbjct: 244 KNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGG-NLQRFDVSAYANN 301
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.4
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.54
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.51
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.79
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.9e-42  Score=326.06  Aligned_cols=292  Identities=23%  Similarity=0.405  Sum_probs=259.8

Q ss_pred             chHHHHHHHHHHHHhccCCCCCCCCCCC-CCCCCC--cceeecCCCCCCCCCCcEEEEECCCCCccc--cCcccccCCCC
Q 015481           46 RLLKAYIALQFWKLSITSDPNGFTSNWC-GPNVCN--YTGVYCAPAPDDPDCLTVAGIDLNQANIAG--TLPEKLGLLQD  120 (406)
Q Consensus        46 ~~~~~~~~L~~~~~~~~~~~~~~~~~w~-~~~~c~--w~gv~c~~~~~~~~~~~l~~L~L~~n~l~~--~~p~~l~~l~~  120 (406)
                      +..++.+||++||.++. ++. .+.+|. +.++|.  |.||.|+...   ...+|++|+|++|++.+  .+|+.|.++++
T Consensus         3 c~~~~~~aL~~~k~~~~-~~~-~l~~W~~~~~~C~~~w~gv~C~~~~---~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~   77 (313)
T 1ogq_A            3 CNPQDKQALLQIKKDLG-NPT-TLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             SCHHHHHHHHHHHHHTT-CCG-GGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCHHHHHHHHHHHHhcC-Ccc-cccCCCCCCCCCcCCCcceEeCCCC---CCceEEEEECCCCCccCCcccChhHhCCCC
Confidence            34578899999999984 444 567886 457898  9999997421   12589999999999999  89999999999


Q ss_pred             CCEEEcCC-CcCCccCCchhhCCcCCceEecccccccccCchhhcCCCCCcEEEeecCcCCCCCchhhhccc-cCeeecc
Q 015481          121 LALFHINS-NRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLK-LDALFLN  198 (406)
Q Consensus       121 L~~L~L~~-n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~-L~~L~L~  198 (406)
                      |++|++++ |.+.+.+|..|+++++|++|++++|.+++.+|..|..+++|++|++++|.+++.+|..+..++ |++|+++
T Consensus        78 L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~  157 (313)
T 1ogq_A           78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD  157 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred             CCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECc
Confidence            99999995 999999999999999999999999999999999999999999999999999999999999988 9999999


Q ss_pred             ccccccCCCCCCCCC--CccEEEcccccCCcCCchhHHhcccccceeeeccCCCcccChhhhccCCCCcEEEeecCCCCC
Q 015481          199 NNKFTSSLPNNIGNS--PVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVG  276 (406)
Q Consensus       199 ~n~l~~~~~~~~~~~--~L~~L~l~~n~l~~~~p~~l~~l~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~  276 (406)
                      +|++++.+|..+...  .|++|++++|.+++.+|..+..+.  |++|++++|++++..+..+..+++|++|+|++|++++
T Consensus       158 ~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~--L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~  235 (313)
T 1ogq_A          158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN--LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF  235 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC--CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC
T ss_pred             CCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc--ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceee
Confidence            999999999888764  599999999999988999888874  9999999999999899999999999999999999997


Q ss_pred             ccchhhcCCCCCCEEeCcCCcccccCchhhcCCCCCCEEEeeCCcCCcCCCc---CCCCCeeeCCCCC-CCCC
Q 015481          277 SLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLA---CLKLKVKDDRQNC-IPNR  345 (406)
Q Consensus       277 ~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~---~~~L~~L~l~~N~-l~~~  345 (406)
                      .+|. +..+++|++|+|++|++++.+|..+..+++|++|++++|++++.+|.   +.+|+.+++++|+ +.+.
T Consensus       236 ~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~~l~~L~~l~l~~N~~lc~~  307 (313)
T 1ogq_A          236 DLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             BGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEEST
T ss_pred             ecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCCccccccChHHhcCCCCccCC
Confidence            6665 88899999999999999999999999999999999999999988874   4567777777775 4443
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 406
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 70.6 bits (171), Expect = 3e-14
 Identities = 68/305 (22%), Positives = 116/305 (38%), Gaps = 35/305 (11%)

Query: 53  ALQFWKLSITSDPNGFTSNWCGPNVCNYT--GVYCAPAPDDPDCLTVAGIDLNQANIAG- 109
           AL   K  +  +P   +S     + CN T  GV C     D     V  +DL+  N+   
Sbjct: 10  ALLQIKKDL-GNPTTLSSWLPTTDCCNRTWLGVLCDT---DTQTYRVNNLDLSGLNLPKP 65

Query: 110 -TLPEKLGLLQDLALFHINSN-RFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLP 167
             +P  L  L  L   +I       G IP +   +  L  L +++   SG  P  +  + 
Sbjct: 66  YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK 125

Query: 168 SLKFLDIRFNQFEGEIPSAVFDLKLDALF-LNNNKFTSSLPNNIGNSPVSV--LVLANNN 224
           +L  LD  +N   G +P ++  L        + N+ + ++P++ G+       + ++ N 
Sbjct: 126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR 185

Query: 225 FDSCLPPSLTKMAGTLN---------------------EIILANAKLKGCLLKDIGLLNQ 263
               +PP+   +                          + I          L  +GL   
Sbjct: 186 LTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKN 245

Query: 264 VTVFDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFF- 322
           +   D+  N + G+LP+ +  +K L  LNV+ NNL G IP     L + +   Y+ N   
Sbjct: 246 LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKCL 304

Query: 323 CTEPL 327
           C  PL
Sbjct: 305 CGSPL 309
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.02
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.0
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=7.2e-41  Score=314.10  Aligned_cols=293  Identities=22%  Similarity=0.399  Sum_probs=257.9

Q ss_pred             chHHHHHHHHHHHHhccCCCCCCCCCCC-CCCCC--CcceeecCCCCCCCCCCcEEEEECCCCCccc--cCcccccCCCC
Q 015481           46 RLLKAYIALQFWKLSITSDPNGFTSNWC-GPNVC--NYTGVYCAPAPDDPDCLTVAGIDLNQANIAG--TLPEKLGLLQD  120 (406)
Q Consensus        46 ~~~~~~~~L~~~~~~~~~~~~~~~~~w~-~~~~c--~w~gv~c~~~~~~~~~~~l~~L~L~~n~l~~--~~p~~l~~l~~  120 (406)
                      +..++++||++||+++.++  ..+++|. +.|+|  .|.||+|+...   ...+|++|+|+++++.|  .+|+.++++++
T Consensus         3 c~~~e~~aLl~~k~~~~~~--~~l~sW~~~~d~C~~~w~gv~C~~~~---~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~   77 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNP--TTLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCC--GGGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCHHHHHHHHHHHHHCCCC--CcCCCCCCCCCCCCCcCCCeEEeCCC---CcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence            4578899999999998643  2467785 67888  49999998522   33589999999999987  58899999999


Q ss_pred             CCEEEcCC-CcCCccCCchhhCCcCCceEecccccccccCchhhcCCCCCcEEEeecCcCCCCCchhhhccc-cCeeecc
Q 015481          121 LALFHINS-NRFCGTIPDSFRNMQLLFELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLK-LDALFLN  198 (406)
Q Consensus       121 L~~L~L~~-n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~-L~~L~L~  198 (406)
                      |++|+|++ |.++|.+|..|+++++|++|+|++|++++..+..+..+.+|+++++++|.+.+.+|..+..++ +++++++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~  157 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD  157 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecc
Confidence            99999997 889999999999999999999999999999999999999999999999999999999999998 9999999


Q ss_pred             ccccccCCCCCCCCCC--ccEEEcccccCCcCCchhHHhcccccceeeeccCCCcccChhhhccCCCCcEEEeecCCCCC
Q 015481          199 NNKFTSSLPNNIGNSP--VSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTVFDVSFNNLVG  276 (406)
Q Consensus       199 ~n~l~~~~~~~~~~~~--L~~L~l~~n~l~~~~p~~l~~l~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~  276 (406)
                      +|.+.+.+|..+....  ++.+++++|++++..|..+..+  ....+++..+...+.++..+..+++++.+++++|.+.+
T Consensus       158 ~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l--~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~  235 (313)
T d1ogqa_         158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL--NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF  235 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC--CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC
T ss_pred             cccccccccccccccccccccccccccccccccccccccc--cccccccccccccccccccccccccccccccccccccc
Confidence            9999999998876644  5899999999999888887776  45679999999999999999999999999999999997


Q ss_pred             ccchhhcCCCCCCEEeCcCCcccccCchhhcCCCCCCEEEeeCCcCCcCCCc---CCCCCeeeCCCCC-CCCCC
Q 015481          277 SLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEPLA---CLKLKVKDDRQNC-IPNRP  346 (406)
Q Consensus       277 ~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~---~~~L~~L~l~~N~-l~~~p  346 (406)
                      .+| .++.+++|++|+|++|+++|.+|.+++++++|++|+|++|+|+|.+|.   +.+|+.+++++|+ +.+.|
T Consensus       236 ~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         236 DLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             BGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTT
T ss_pred             ccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCC
Confidence            655 588899999999999999999999999999999999999999998885   4467777777775 44444
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure