Citrus Sinensis ID: 015721

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--

MGSLCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEPDVLL

cccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccEEcccccHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccccEEEEEcccccccccc

cccHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccHHHHccccccccccHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccEEEEcccHHccHHHHHHHHHHccHHccEEEccccccccHHHHHHHHHHcccccEEEccccHHccHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccccEEEEcccHHccHHHHHHHHHHccccEEEEEccccccccccc

MGSLCINEVLRDDELRSILSRLeddkdkerFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSRLVELDlsqsvsrsfypgvtdsdLAVIADGFKSLKLLNlqnckgitdaGIASIGsglcslqsldlSYCRKLTDKGLSAVAEGCQDLRSLhlagcksvtdgTLQALSKNCRNleelgllgctsisdsgvidlvngcqnikfldlnkcsnigdngiSSVSKScsslktlklldcykvgdKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNlrmdwclnisdssLSCILSQCrnlealdigcceEVTDAAFQDLGEVELSLKVLkvncpkvtVVGIGNVLEKCAsleyidvrscphvtqasceeaglqfpqcckvnfagclfepdvll

mgslcinevlrddeLRSILsrleddkdkerfGLVCkrwlhlqsterkklsvragpHMLRKIAARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEPDVLL

MGSLCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGIssvskscsslktlkllDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEPDVLL

****CINEVLR******I**********ERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEP****

*GSLCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEPDVLL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		402	2.2.26 [Sep-21-2011]
Q9C5D2		610	F-box/LRR-repeat protein	no	no	0.753	0.496	0.333	3e-40
Q5R3Z8		423	F-box/LRR-repeat protein	yes	no	0.746	0.709	0.316	9e-36
Q9UKC9		423	F-box/LRR-repeat protein	yes	no	0.746	0.709	0.316	1e-35
Q8BH16		423	F-box/LRR-repeat protein	yes	no	0.781	0.742	0.318	1e-35
A6H779		423	F-box/LRR-repeat protein	yes	no	0.746	0.709	0.313	2e-35
Q96IG2		436	F-box/LRR-repeat protein	no	no	0.781	0.720	0.303	4e-33
Q58DG6		436	F-box/LRR-repeat protein	no	no	0.781	0.720	0.303	4e-33
Q9CZV8		436	F-box/LRR-repeat protein	no	no	0.748	0.690	0.282	4e-31
C8V4D4		585	SCF E3 ubiquitin ligase c	no	no	0.676	0.464	0.282	5e-31
P34284		466	Uncharacterized F-box/LRR	yes	no	0.684	0.590	0.307	1e-30

>sp\|Q9C5D2\|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1	Back alignment and function desciption

 Score =  166 bits (420), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 168/306 (54%), Gaps = 3/306 (0%)

Query: 85  VTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSA 144
           VTD   A + +   SL+ L L + +  TD G+ +IG G   L+ L LS C  ++ KGL A
Sbjct: 281 VTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEA 340

Query: 145 VAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNI 204
           +A GC++L  + + GC ++    ++A+ K+C  L+EL LL C  I +S + ++  GC+++
Sbjct: 341 IAHGCKELERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSL 400

Query: 205 KFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLAKFCKNLETLIIGGC 264
           + L L  CS IGD  + S++K C +LK L +  CY++G+K I+S+ K CK+L  L +  C
Sbjct: 401 EILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFC 460

Query: 265 RDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAA 324
             + ++++  +   C  SL+ L +  C  ISD+ ++ I   C  L  LDI   + + D  
Sbjct: 461 DKVGNKALIAIGKGC--SLQQLNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMP 518

Query: 325 FQDLGEVELSLKVLKV-NCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQF 383
             +LGE    LK L + +C  +T  G+ ++++KC  LE   +  CP +T A         
Sbjct: 519 LAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCKLLETCHMVYCPGITSAGVATVVSSC 578

Query: 384 PQCCKV 389
           P   KV
Sbjct: 579 PHIKKV 584

Arabidopsis thaliana (taxid: 3702)

>sp\|Q5R3Z8\|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q9UKC9\|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3	Back alignment and function description

>sp\|Q8BH16\|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1	Back alignment and function description

>sp\|A6H779\|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q96IG2\|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2	Back alignment and function description

>sp\|Q58DG6\|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2	Back alignment and function description

>sp\|Q9CZV8\|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3	Back alignment and function description

>sp\|C8V4D4\|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1	Back alignment and function description

>sp\|P34284\|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		402
255544119		407	glucose regulated repressor protein, put	0.995	0.982	0.782	1e-178
224083866		406	predicted protein [Populus trichocarpa]	0.997	0.987	0.767	1e-175
114325974		407	putative F-box and leucine-rich repeat p	0.995	0.982	0.759	1e-174
15237286		405	leucine-rich repeats (LRRs), ribonucleas	1.0	0.992	0.753	1e-172
297808339		405	protein binding protein [Arabidopsis lyr	1.0	0.992	0.748	1e-171
388512917		416	unknown [Medicago truncatula]	1.0	0.966	0.729	1e-167
356575411		418	PREDICTED: F-box/LRR-repeat protein 2-li	0.992	0.954	0.739	1e-166
225463677		413	PREDICTED: EIN3-binding F-box protein 1	0.992	0.966	0.75	1e-165
356536441		419	PREDICTED: F-box/LRR-repeat protein 2-li	0.992	0.952	0.732	1e-164
449458744		421	PREDICTED: F-box/LRR-repeat protein 20-l	0.995	0.950	0.710	1e-160

>gi\|255544119\|ref\|XP_002513122.1\| glucose regulated repressor protein, putative [Ricinus communis] gi\|223548133\|gb\|EEF49625.1\| glucose regulated repressor protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 316/404 (78%), Positives = 362/404 (89%), Gaps = 4/404 (0%)

Query: 3   SLCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIA 62
           S+CINE L DDELRSILS+LE DKDKE FGLVCKRWL LQSTERKKL+ RAGPHML+K+A
Sbjct: 4   SICINETLTDDELRSILSKLESDKDKEIFGLVCKRWLRLQSTERKKLAARAGPHMLQKMA 63

Query: 63  ARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSG 122
           ARFSRL+ELDLSQSVSRSFYPGVTDSDL+VI+ GF+ L++LNLQNCKGITD G+ SIG G
Sbjct: 64  ARFSRLIELDLSQSVSRSFYPGVTDSDLSVISHGFQYLRVLNLQNCKGITDNGMRSIGCG 123

Query: 123 LCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELG 182
           L SLQSLD+SYCRKLTDKGLSAVA GC+DLR LHLAGC+ +TD  L+ALS +C NL+ELG
Sbjct: 124 LSSLQSLDVSYCRKLTDKGLSAVAGGCRDLRILHLAGCRFITDEVLKALSTSCSNLQELG 183

Query: 183 LLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSS-LKTLKLLDCYKV 241
           L GCT+I+DSGV DLV+GC+ I+FLD+NKCSNIGD GIS++SK+CSS LKTLKLLDCYKV
Sbjct: 184 LQGCTNITDSGVKDLVSGCKQIQFLDINKCSNIGDVGISNLSKACSSCLKTLKLLDCYKV 243

Query: 242 GDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSC 301
           GD+S+ SLAKFC NLETLIIGGCRDISD+S+K LA++C +SLKNLRMDWCLNISDSSLSC
Sbjct: 244 GDESLSSLAKFCNNLETLIIGGCRDISDQSVKLLASACTNSLKNLRMDWCLNISDSSLSC 303

Query: 302 ILSQCRNLEALDIGCCEEVTDAAFQDLGEVE--LSLKVLKV-NCPKVTVVGIGNVLEKCA 358
           IL++CRNLEALDIGCCEEVTDAAFQ LG VE  L LKVLK+ NCPK+TV GIG +LEKC 
Sbjct: 304 ILTECRNLEALDIGCCEEVTDAAFQVLGTVENKLKLKVLKISNCPKITVTGIGRLLEKCN 363

Query: 359 SLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEPDVLL 402
            LEY+DVRSCPHVT++ CEEAGLQFP+CCKVN+ G L EPDVL+
Sbjct: 364 VLEYLDVRSCPHVTKSGCEEAGLQFPECCKVNYTGSLNEPDVLI 407

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224083866\|ref\|XP_002307150.1\| predicted protein [Populus trichocarpa] gi\|222856599\|gb\|EEE94146.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|114325974\|gb\|ABI64127.1\| putative F-box and leucine-rich repeat protein [Jatropha curcas]	Back alignment and taxonomy information

>gi|15237286|ref|NP_197725.1| leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily protein [Arabidopsis thaliana] gi|10177823|dbj|BAB11189.1| unnamed protein product [Arabidopsis thaliana] gi|15810000|gb|AAL06927.1| AT5g23340/MKD15_20 [Arabidopsis thaliana] gi|22137014|gb|AAM91352.1| At5g23340/MKD15_20 [Arabidopsis thaliana] gi|110740667|dbj|BAE98436.1| hypothetical protein [Arabidopsis thaliana] gi|332005770|gb|AED93153.1| leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297808339\|ref\|XP_002872053.1\| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297317890\|gb\|EFH48312.1\| protein binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|388512917\|gb\|AFK44520.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356575411\|ref\|XP_003555835.1\| PREDICTED: F-box/LRR-repeat protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|225463677\|ref\|XP_002276047.1\| PREDICTED: EIN3-binding F-box protein 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356536441\|ref\|XP_003536746.1\| PREDICTED: F-box/LRR-repeat protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|449458744\|ref\|XP_004147107.1\| PREDICTED: F-box/LRR-repeat protein 20-like [Cucumis sativus] gi\|449503502\|ref\|XP_004162034.1\| PREDICTED: F-box/LRR-repeat protein 20-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		402
TAIR\|locus:2166978		405	AT5G23340 [Arabidopsis thalian	1.0	0.992	0.718	7.7e-158
TAIR\|locus:505006471		610	AT4G15475 "AT4G15475" [Arabido	0.753	0.496	0.313	6.3e-39
UNIPROTKB\|F1PWK1		422	FBXL2 "Uncharacterized protein	0.741	0.706	0.320	3.4e-38
UNIPROTKB\|Q9UKC9		423	FBXL2 "F-box/LRR-repeat protei	0.741	0.704	0.316	8.9e-38
UNIPROTKB\|Q5R3Z8		423	FBXL2 "F-box/LRR-repeat protei	0.741	0.704	0.316	8.9e-38
RGD\|1562243		422	Fbxl2 "F-box and leucine-rich	0.743	0.708	0.315	1.1e-37
MGI\|MGI:1919429		423	Fbxl2 "F-box and leucine-rich	0.741	0.704	0.316	1.5e-37
UNIPROTKB\|A6H779		423	FBXL2 "F-box/LRR-repeat protei	0.741	0.704	0.313	3e-37
UNIPROTKB\|F1NHD2		423	FBXL2 "Uncharacterized protein	0.776	0.737	0.315	3.5e-36
UNIPROTKB\|Q58DG6		436	FBXL20 "F-box/LRR-repeat prote	0.778	0.717	0.302	7.2e-36

TAIR\|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1538 (546.5 bits), Expect = 7.7e-158, P = 7.7e-158
 Identities = 291/405 (71%), Positives = 341/405 (84%)

Query:     1 MGSLCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRK 60
             M S+C+NE L DDELR +LSRL+ DKDKE FGLVCKRWL+LQST+RKKL+ RAGPHMLR+
Sbjct:     1 MSSVCVNEALTDDELRWVLSRLDSDKDKEVFGLVCKRWLNLQSTDRKKLAARAGPHMLRR 60

Query:    61 IAARFSRLVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIG 120
             +A+RF+++VELDLSQS+SRSFYPGVTDSDLAVI++GFK L++LNL NCKGITD G+ASIG
Sbjct:    61 LASRFTQIVELDLSQSISRSFYPGVTDSDLAVISEGFKFLRVLNLHNCKGITDTGLASIG 120

Query:   121 SGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEE 180
               L  LQ LD+SYCRKL+DKGLSAVAEGC DLR+LHLAGC+ +TD +L++LS+ CR+LE 
Sbjct:   121 RCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDESLKSLSERCRDLEA 180

Query:   181 LGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGIXXXXXX-XXXXXXXXXXDCY 239
             LGL GCT+I+DSG+ DLV GC+ IK LD+NKCSN+GD G+                 DCY
Sbjct:   181 LGLQGCTNITDSGLADLVKGCRKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCY 240

Query:   240 KVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSL 299
             KVG++SI SLA+FCKNLETLIIGGCRDISDESI  LA SCK SLKNLRMDWCLNISDSSL
Sbjct:   241 KVGNESISSLAQFCKNLETLIIGGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSL 300

Query:   300 SCILSQCRNLEALDIGCCEEVTDAAFQDLGEVE-LSLKVLKV-NCPKVTVVGIGNVLEKC 357
             SCIL QC+NLEALDIGCCEEVTD AF+DLG  + L LKVLKV NC K+TV GIG +L+KC
Sbjct:   301 SCILKQCKNLEALDIGCCEEVTDTAFRDLGSDDVLGLKVLKVSNCTKITVTGIGKLLDKC 360

Query:   358 ASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLFEPDVLL 402
             +SLEYIDVRS PHVT+  C EAGL+FP+CCKVNF+G L EPDVLL
Sbjct:   361 SSLEYIDVRSLPHVTEVRCSEAGLEFPKCCKVNFSGSLTEPDVLL 405

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

RGD\|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		402
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-26
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	1e-25
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	5e-06
cd00116		319	cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo	9e-06

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score =  104 bits (262), Expect = 3e-26
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 7/154 (4%)

Query: 98  KSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHL 157
             LK L L   K I D G+ ++     +LQ LDL  C  +TD G+ A+A  C  L++++L
Sbjct: 52  NKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTINL 111

Query: 158 ---AGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGC-QNIKFLDLNKCS 213
                   +TD +L AL KNC  L+ +G  GC  ++D GV +L +GC ++++ L LN C 
Sbjct: 112 GRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSLNNCR 170

Query: 214 NIGDNGISSV--SKSCSSLKTLKLLDCYKVGDKS 245
           N+ D  I ++  S    +L  L+   C  + D S
Sbjct: 171 NLTDQSIPAILASNYFPNLSVLEFRGCPLITDFS 204

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		402
KOG4341		483	consensus F-box protein containing LRR [General fu	100.0
KOG4341		483	consensus F-box protein containing LRR [General fu	99.94
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.94
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.69
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.68
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.67
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.67
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.66
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.65
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.64
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.62
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.48
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.41
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.37
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.31
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.25
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.23
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.12
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.1
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.1
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.0
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	98.98
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.84
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.83
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.78
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.66
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.63
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.61
smart00256		41	FBOX A Receptor for Ubiquitination Targets.	98.55
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.52
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	98.48
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.39
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.38
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.35
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.32
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.31
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.28
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.25
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.23
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.21
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.13
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.13
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.12
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.94
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.93
KOG0617		264	consensus Ras suppressor protein (contains leucine	97.88
KOG3864		221	consensus Uncharacterized conserved protein [Funct	97.86
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.76
KOG0617		264	consensus Ras suppressor protein (contains leucine	97.34
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.29
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.28
PRK15386		426	type III secretion protein GogB; Provisional	97.12
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.09
PRK15386		426	type III secretion protein GogB; Provisional	97.01
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.64
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	96.63
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.48
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.38
PLN03215		373	ascorbic acid mannose pathway regulator 1; Provisi	96.35
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.34
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.34
KOG2997		366	consensus F-box protein FBX9 [General function pre	96.16
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.14
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	96.06
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	96.0
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.93
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	95.93
PLN03150		623	hypothetical protein; Provisional	95.75
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	95.74
PLN03150		623	hypothetical protein; Provisional	95.43
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	95.4
PF13013		109	F-box-like_2: F-box-like domain	93.82
KOG4308		478	consensus LRR-containing protein [Function unknown	93.37
KOG4308		478	consensus LRR-containing protein [Function unknown	93.32
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	93.26
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	92.99
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	92.28
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	91.74
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	90.36
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	88.52
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	87.77
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	86.8
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	86.5
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	85.66
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	84.73
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	81.98
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	81.66

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.1e-37  Score=259.75  Aligned_cols=381  Identities=27%  Similarity=0.504  Sum_probs=335.0

Q ss_pred             ccccccCCHHHHHHHHccCCCcchhhHHHHhhHHHHHhhhhccccccc--cc-----ChhHHHHHHHhcC-cceEEeccC
Q 015721            4 LCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSV--RA-----GPHMLRKIAARFS-RLVELDLSQ   75 (402)
Q Consensus         4 ~~~~~~LP~eil~~If~~L~~~~~~~~~~~vcr~W~~~~~~~~~~l~~--~~-----~~~~~~~~~~~~~-~l~~L~l~~   75 (402)
                      ..++..||+|++..||++|+ ++.+.+++++|+.|...+.+..-|-.+  .+     .-..+..+..++. .+++|.+.+
T Consensus        69 ~~~~~~LPpEl~lkvFS~LD-tksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG  147 (483)
T KOG4341|consen   69 NSISRSLPPELLLKVFSMLD-TKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRG  147 (483)
T ss_pred             ccccccCCHHHHHHHHHHHh-HHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccc
Confidence            44566799999999999999 699999999999999887665433332  11     2245667777775 699999998


Q ss_pred             CcCCCCCCCCChhhHHHHHhhCCCCCEEEccCCCCCChhHHHHHHhcCCCCCeEecCCCCCcChHHHHHHHhcCccCcEE
Q 015721           76 SVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSL  155 (402)
Q Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L  155 (402)
                            ...+.+..+..+...+|++++|.+.+|..+++..+..++..|++|++|++..|..+++..+..+...|++|+++
T Consensus       148 ------~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~l  221 (483)
T KOG4341|consen  148 ------CRAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYL  221 (483)
T ss_pred             ------cccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHh
Confidence                  46788888888899999999999999999999999999999999999999999989998898899999999999


Q ss_pred             ecCCCccCChHHHHHHHHhCCCCcEEecCCCCCCchHHHHHHHhcCCCCCEEccCCCCCCCcccHHHHHhcCCCCCEEEe
Q 015721          156 HLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKL  235 (402)
Q Consensus       156 ~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l  235 (402)
                      +++.|+.+...++..+...+..++.+...+|...+.+.+...-..++-+-++++..|..+++.++..+...+..|+.+..
T Consensus       222 NlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~  301 (483)
T KOG4341|consen  222 NLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCY  301 (483)
T ss_pred             hhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcc
Confidence            99999999888899999989999999888999888888877777778888888889999999888888888999999999


Q ss_pred             cCCCCCChHHHHHHHHhCCCCcEEEecCCCCCChHHHHHHHHHhcCCCcEEEccCCCCCChHHHHHHHhcCCCCcEEecc
Q 015721          236 LDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIG  315 (402)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~~~~~~l~~~l~~~~~L~~L~l~  315 (402)
                      +++..+++..+.++..++++|+.|.+.+|..+++..+..+...+ +.|+.+++..+..+++..+..+..+||.|+.+.++
T Consensus       302 s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~-~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lsls  380 (483)
T KOG4341|consen  302 SSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNC-PHLERLDLEECGLITDGTLASLSRNCPRLRVLSLS  380 (483)
T ss_pred             cCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCC-hhhhhhcccccceehhhhHhhhccCCchhccCChh
Confidence            99999999999999999999999999999999999999998887 89999999999878877788888999999999999


Q ss_pred             CCCCCChHHHHHHHhc---cCCCcEEEE-eCCCCCHHHHHHHHHhCCCCCEEeccCCCCCCHhHHHhhccCCCCcceEec
Q 015721          316 CCEEVTDAAFQDLGEV---ELSLKVLKV-NCPKVTVVGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNF  391 (402)
Q Consensus       316 ~~~~~~~~~~~~~~~~---~~~L~~L~l-~~~~~~~~~l~~~~~~~~~L~~L~l~~c~~~~~~~~~~~~~~~p~l~~l~~  391 (402)
                      +|..++|.++..+...   ...|+.+++ +|..+++..++.+ ..|++||.+++.+|..++.+.+..+..++|+++....
T Consensus       381 hce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l-~~c~~Leri~l~~~q~vtk~~i~~~~~~lp~i~v~a~  459 (483)
T KOG4341|consen  381 HCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHL-SICRNLERIELIDCQDVTKEAISRFATHLPNIKVHAY  459 (483)
T ss_pred             hhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHHH-hhCcccceeeeechhhhhhhhhHHHHhhCccceehhh
Confidence            9999999988877653   347888888 8888888777555 6899999999999999999999999999999987766


Q ss_pred             cc
Q 015721          392 AG  393 (402)
Q Consensus       392 ~~  393 (402)
                      .+
T Consensus       460 ~a  461 (483)
T KOG4341|consen  460 FA  461 (483)
T ss_pred             cc
Confidence            55

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>smart00256 FBOX A Receptor for Ubiquitination Targets	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2997 consensus F-box protein FBX9 [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13013 F-box-like_2: F-box-like domain	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		402
2p1m_B		594	Tir1-ask1 Complex Structure Length = 594		2e-07
1fs2_A		272	Insights Into Scf Ubiquitin Ligases From The Struct		4e-05
3ogk_B		592	Structure Of Coi1-Ask1 In Complex With Coronatine A		1e-04

>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594

Back alignment and structure

Iteration: 1

Score = 53.9 bits (128), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 53/215 (24%), Positives = 93/215 (43%), Gaps = 50/215 (23%) Query: 12 DDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSV-------------------- 51 ++ L + S ++ DKD+ LVCK W ++ R+K+ + Sbjct: 11 EEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRS 70 Query: 52 ---RAGPHM-----------------LRKIAARFSRLVELDLSQSVSRSFYPGVTDSDLA 91 + PH + +++ ++ L E+ L + V VTD L Sbjct: 71 VELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMV-------VTDDCLE 123 Query: 92 VIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDL--SYCRKLTDKGLSAVAEGC 149 +IA FK+ K+L L +C+G + G+A+I + +L+ LDL S ++ LS + Sbjct: 124 LIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTY 183 Query: 150 QDLRSLHLAGCKS-VTDGTLQALSKNCRNLEELGL 183 L SL+++ S V+ L+ L C NL+ L L Sbjct: 184 TSLVSLNISCLASEVSFSALERLVTRCPNLKSLKL 218

PyMOL of 2p1m

>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272

Back alignment and structure

>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		402
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-62
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-51
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-47
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-22
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-60
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-47
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-43
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-42
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-35
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-34
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-22
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-49
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-38
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-20
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	8e-25
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-22
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	3e-22
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-19
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	4e-06
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	5e-22
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	3e-17
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	5e-17
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	1e-19
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	9e-17
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	1e-11
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	4e-17
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-16
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	3e-07
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-13
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	8e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-09
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	9e-07
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	7e-11
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	2e-06
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-06
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-10
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	3e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-05
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	2e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	7e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	7e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-06
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-06
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-04

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

 Score =  208 bits (531), Expect = 7e-62
 Identities = 79/414 (19%), Positives = 151/414 (36%), Gaps = 52/414 (12%)

Query: 5   CINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRA-GPHMLRKIAA 63
            I     ++ L  + S ++ DKD+    LVCK W  ++   R+K+ +          +  
Sbjct: 4   RIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIR 63

Query: 64  RFSRLVELD------------LSQSVSRSFYPG--------------------VTDSDLA 91
           RF ++  ++            +        YP                     VTD  L 
Sbjct: 64  RFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLE 123

Query: 92  VIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCR--KLTDKGLSAVAEGC 149
           +IA  FK+ K+L L +C+G +  G+A+I +   +L+ LDL       ++   LS   +  
Sbjct: 124 LIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTY 183

Query: 150 QDLRSLHLAGCKS-VTDGTLQALSKNCRNLEELGLLGCTSISDSGVIDLVNGCQNIKFLD 208
             L SL+++   S V+   L+ L   C NL+ L L     +    +  L+     ++ L 
Sbjct: 184 TSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRA--VPLEKLATLLQRAPQLEELG 241

Query: 209 LNKCSNIGDNG-ISSVSKSCSSLKTLKLLD-CYKVGDKSILSLAKFCKNLETLIIGGCRD 266
               +        S +S + S  K L+ L   +      + ++   C  L TL +     
Sbjct: 242 TGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYAT- 300

Query: 267 ISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEE------- 319
           +    +  L   C   L+ L +     I D+ L  + S C++L  L +   E        
Sbjct: 301 VQSYDLVKLLCQCP-KLQRLWV--LDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNV 357

Query: 320 -VTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCASLEYIDVRSCPHVT 372
            +T+     +      L+ +   C ++T   +  +     ++    +       
Sbjct: 358 ALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKA 411

PyMOL of 2p1m

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		402
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	100.0
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	100.0
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.97
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.96
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.95
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.92
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.9
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.85
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.82
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.82
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.79
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.77
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.72
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.72
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.69
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.65
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.65
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.64
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.64
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.64
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.63
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.63
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.62
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.62
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.62
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.61
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.61
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.6
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.6
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.6
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.59
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.59
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.58
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.57
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.57
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.56
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.56
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.56
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.55
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.55
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.54
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.52
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.52
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.52
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.51
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.5
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.47
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.46
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.46
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.45
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.44
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.44
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.43
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.43
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.41
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.4
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.4
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.39
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.38
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.36
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.36
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.35
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.34
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.33
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.32
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.32
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.31
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.3
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.29
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.29
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.29
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.29
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.29
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.28
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.27
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.25
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.25
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.24
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.23
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.2
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.19
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.19
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.19
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.18
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.15
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.1
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.07
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	99.02
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.01
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.97
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.97
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.96
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.95
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.93
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.93
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.92
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.91
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.91
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.88
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.87
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.86
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.86
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.85
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.81
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.81
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.73
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.71
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.65
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.65
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.64
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.61
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.61
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.58
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.57
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.53
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.51
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.38
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.38
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.36
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.33
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.32
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.31
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.3
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.3
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.26
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.25
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.2
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.19
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.17
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	98.16
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.14
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.13
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.12
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.09
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.06
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	97.99
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.85
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.8
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.75
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.72
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.71
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.58
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.56
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.55
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.54
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	97.52
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	97.38
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.35
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.29
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.25
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.16
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.15
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.94
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.77
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.76
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.6
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.98
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	95.06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	94.87
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	94.71
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	88.52
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	86.94

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

Probab=100.00  E-value=1.3e-37  Score=296.48  Aligned_cols=385  Identities=23%  Similarity=0.422  Sum_probs=226.6

Q ss_pred             CCcccccccCCHHHHHHHHccCCCcchhhHHHHhhHHHHHhhhhcccccccccC-hhHHHHHHHhcCcceEEeccCCcCC
Q 015721            1 MGSLCINEVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAG-PHMLRKIAARFSRLVELDLSQSVSR   79 (402)
Q Consensus         1 ~~~~~~~~~LP~eil~~If~~L~~~~~~~~~~~vcr~W~~~~~~~~~~l~~~~~-~~~~~~~~~~~~~l~~L~l~~~~~~   79 (402)
                      |+.|.+ +.||+||+.+||+||+..+|+.++++|||+|+++....+..+.+... ......+..+++++++|+++++...
T Consensus         1 ~~~d~~-~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~   79 (594)
T 2p1m_B            1 MQKRIA-LSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHF   79 (594)
T ss_dssp             ----------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSCHHHHHHHCTTCCEEEEECSCGG
T ss_pred             Ccccch-hhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccCHHHHHhhCCCceEEeccCCCch
Confidence            455554 56999999999999995589999999999999985544444333221 1112234445555555555543211


Q ss_pred             C-------C-------------------------CCCCChhhHHHHHhhCCCCCEEEccCCCCCChhHHHHHHhcCCCCC
Q 015721           80 S-------F-------------------------YPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQ  127 (402)
Q Consensus        80 ~-------~-------------------------~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~  127 (402)
                      .       .                         ...+.+..+..+...+++|++|++.+|..++...+..+...+++|+
T Consensus        80 ~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~  159 (594)
T 2p1m_B           80 ADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLK  159 (594)
T ss_dssp             GGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHHHHCTTCCEEEEESCEEEEHHHHHHHHHHCTTCC
T ss_pred             hhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHHHHHHhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCCC
Confidence            0       0                         1112333333333345555555555543344444444444444444


Q ss_pred             eEecCCCC-----------------------------CcChHHHHHHHhcCccCcEEecCCCccCChHHHHHHHH-----
Q 015721          128 SLDLSYCR-----------------------------KLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSK-----  173 (402)
Q Consensus       128 ~L~l~~~~-----------------------------~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~-----  173 (402)
                      +|++++|.                             .++...+..+...+++|++|++.+|....  .++....     
T Consensus       160 ~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~--~l~~~~~~~~~L  237 (594)
T 2p1m_B          160 ELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLE--KLATLLQRAPQL  237 (594)
T ss_dssp             EEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCTTSCHH--HHHHHHHHCTTC
T ss_pred             EEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCCCCcHH--HHHHHHhcCCcc
Confidence            44444332                             01112233333334444444444331100  0111111     


Q ss_pred             -------------------------------------------------hCCCCcEEecCCCCCCchHHHHHHHhcCCCC
Q 015721          174 -------------------------------------------------NCRNLEELGLLGCTSISDSGVIDLVNGCQNI  204 (402)
Q Consensus       174 -------------------------------------------------~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L  204 (402)
                                                                       .+++|++|+++++. +++..+..++..+++|
T Consensus       238 ~~L~l~~~~~~~~~~~~~~l~~~l~~~~~L~~Ls~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-l~~~~l~~~~~~~~~L  316 (594)
T 2p1m_B          238 EELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYAT-VQSYDLVKLLCQCPKL  316 (594)
T ss_dssp             SEEECSBCCCCCCHHHHHHHHHHHHTCTTCCEEECCBTCCGGGGGGGHHHHTTCCEEECTTCC-CCHHHHHHHHTTCTTC
T ss_pred             eEcccccccCccchhhHHHHHHHHhcCCCcccccCCcccchhhHHHHHHhhCCCCEEEccCCC-CCHHHHHHHHhcCCCc
Confidence                                                             22333333333332 3333334444445555


Q ss_pred             CEEccCCCCCCCcccHHHHHhcCCCCCEEEe--------cCCCCCChHHHHHHHHhCCCCcEEEecCCCCCChHHHHHHH
Q 015721          205 KFLDLNKCSNIGDNGISSVSKSCSSLKTLKL--------LDCYKVGDKSILSLAKFCKNLETLIIGGCRDISDESIKHLA  276 (402)
Q Consensus       205 ~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l--------~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~  276 (402)
                      ++|+++++  +.+.++..+...+++|++|++        .++..+++.++..+...+++|+.|.+ ++..+++..+..++
T Consensus       317 ~~L~l~~~--~~~~~l~~l~~~~~~L~~L~L~~~~~~g~~~~~~l~~~~l~~l~~~~~~L~~L~~-~~~~l~~~~~~~l~  393 (594)
T 2p1m_B          317 QRLWVLDY--IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLY-FCRQMTNAALITIA  393 (594)
T ss_dssp             CEEEEEGG--GHHHHHHHHHHHCTTCCEEEEECSCTTCSSCSSCCCHHHHHHHHHHCTTCCEEEE-EESCCCHHHHHHHH
T ss_pred             CEEeCcCc--cCHHHHHHHHHhCCCCCEEEEecCcccccccCCCCCHHHHHHHHHhchhHHHHHH-hcCCcCHHHHHHHH
Confidence            55555543  333334444445666666666        23345555555555555677777754 34456666666666


Q ss_pred             HHhcCCCcEEEcc-----CCCCCC----hHHHHHHHhcCCCCcEEeccCCCCCChHHHHHHHhccCCCcEEEEeCCCCCH
Q 015721          277 ASCKSSLKNLRMD-----WCLNIS----DSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTV  347 (402)
Q Consensus       277 ~~~~~~L~~L~l~-----~~~~~~----~~~l~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  347 (402)
                      ..+ ++|++|+++     +|..++    +.++..++..+++|+.|++++  .+++..+..+...+++|+.|+++++.+++
T Consensus       394 ~~~-~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~l~~~~~~L~~L~L~~--~l~~~~~~~l~~~~~~L~~L~L~~~~i~~  470 (594)
T 2p1m_B          394 RNR-PNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSG--LLTDKVFEYIGTYAKKMEMLSVAFAGDSD  470 (594)
T ss_dssp             HHC-TTCCEEEEEESSTTCCCTTTCCCTHHHHHHHHHHCTTCCEEECCS--SCCHHHHHHHHHHCTTCCEEEEESCCSSH
T ss_pred             hhC-CCcceeEeecccCCCcccccCCchhhHHHHHHhhCCCccEEeecC--cccHHHHHHHHHhchhccEeeccCCCCcH
Confidence            566 889999888     455677    667777788899999999975  67888888888877799999998888998


Q ss_pred             HHHHHHHHhCCCCCEEeccCCCCCCHhHHHhhccCCCCcceEecccccc
Q 015721          348 VGIGNVLEKCASLEYIDVRSCPHVTQASCEEAGLQFPQCCKVNFAGCLF  396 (402)
Q Consensus       348 ~~l~~~~~~~~~L~~L~l~~c~~~~~~~~~~~~~~~p~l~~l~~~~~~~  396 (402)
                      .++..+...+++|+.|++++|+. ++..+..+...+|+++.+++++|+.
T Consensus       471 ~~~~~l~~~~~~L~~L~L~~n~~-~~~~~~~~~~~l~~L~~L~l~~~~~  518 (594)
T 2p1m_B          471 LGMHHVLSGCDSLRKLEIRDCPF-GDKALLANASKLETMRSLWMSSCSV  518 (594)
T ss_dssp             HHHHHHHHHCTTCCEEEEESCSC-CHHHHHHTGGGGGGSSEEEEESSCC
T ss_pred             HHHHHHHhcCCCcCEEECcCCCC-cHHHHHHHHHhCCCCCEEeeeCCCC
Confidence            88888888899999999999986 8888887877899999999999986

PyMOL of 2p1m

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		402
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	9e-14
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-09
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	7e-08
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	5e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	4e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-04
d1pgva_		167	c.10.1.1 (A:) Tropomodulin C-terminal domain {nema	9e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.002

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.0 bits (167), Expect = 9e-14
 Identities = 58/289 (20%), Positives = 111/289 (38%), Gaps = 21/289 (7%)

Query: 71  LDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQSLD 130
           LDL+    ++ +P VT   L        S  ++  +  +   D  +A   S    +Q +D
Sbjct: 5   LDLT---GKNLHPDVTGRLL--------SQGVIAFRCPRSFMDQPLAEHFS-PFRVQHMD 52

Query: 131 LSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEELGLLGCTSIS 190
           LS    +    L  +   C  L++L L G + ++D  +  L+    NL  L L GC+  S
Sbjct: 53  LSNS-VIEVSTLHGILSQCSKLQNLSLEGLR-LSDPIVNTLA-KNSNLVRLNLSGCSGFS 109

Query: 191 DSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLA 250
           +  +  L++ C  +  L+L+ C +  +  +       S   T   L  Y+   +      
Sbjct: 110 EFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLST 169

Query: 251 KFCKNLETLIIGGCRDISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLE 310
              +    + +     +  ++         + L++L +  C +I   +L   L +   L+
Sbjct: 170 LVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLE-LGEIPTLK 228

Query: 311 ALDIGCCEEVTDAAFQDLGEVELSLKVLKVNCPKVTVVGIGNVLEKCAS 359
            L +     V D   Q L E   +L  L++NC   T +    +  K   
Sbjct: 229 TLQVFGI--VPDGTLQLLKE---ALPHLQINCSHFTTIARPTIGNKKNQ 272

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		402
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.9
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.89
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.75
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.69
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.56
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.55
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.45
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.39
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	99.33
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.07
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.07
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.98
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.94
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.93
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.92
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.91
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.85
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.69
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.68
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.66
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.64
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	98.63
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.63
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.59
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.57
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.56
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.55
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.48
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.42
d1p22a1		118	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	98.39
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.37
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.36
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.35
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.32
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.29
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.21
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.16
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.92
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.75
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.63
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.62
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.42
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.22
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.16
d2ifga3		156	High affinity nerve growth factor receptor, N-term	96.59
d2ifga3		156	High affinity nerve growth factor receptor, N-term	96.49

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=6.8e-23  Score=173.23  Aligned_cols=247  Identities=19%  Similarity=0.306  Sum_probs=153.2

Q ss_pred             CEEEccCCCCCChhHHHHHHhcCCCCCeEecCCCCCcChHHHHHHHhcCccCcEEecCCCccCChHHHHHHHHhCCCCcE
Q 015721          101 KLLNLQNCKGITDAGIASIGSGLCSLQSLDLSYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEE  180 (402)
Q Consensus       101 ~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~  180 (402)
                      +++++++. .+....+..+..  ..+..+.+.... ......  ......+|++|+++++ .+....+..+..++++|++
T Consensus         3 ~~lDLs~~-~l~~~~l~~l~~--~~~~~lrl~~~~-~~~~~~--~~~~~~~L~~LdLs~~-~i~~~~l~~l~~~c~~L~~   75 (284)
T d2astb2           3 QTLDLTGK-NLHPDVTGRLLS--QGVIAFRCPRSF-MDQPLA--EHFSPFRVQHMDLSNS-VIEVSTLHGILSQCSKLQN   75 (284)
T ss_dssp             SEEECTTC-BCCHHHHHHHHH--TTCSEEECTTCE-ECSCCC--SCCCCBCCCEEECTTC-EECHHHHHHHHTTBCCCSE
T ss_pred             CEEECCCC-CCCchHHHHHHh--ccceEeeccccc-cccchh--hhccCCCCCEEECCCC-ccCHHHHHHHHHhCCCccc
Confidence            36777763 355444555443  234444443321 111000  0112456778888776 4555666667777778888


Q ss_pred             EecCCCCCCchHHHHHHHhcCCCCCEEccCCCCCCCcccHHHHHhcCCCCCEEEecCCCCCChHHHHHHH-HhCCCCcEE
Q 015721          181 LGLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKVGDKSILSLA-KFCKNLETL  259 (402)
Q Consensus       181 L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~-~~~~~L~~L  259 (402)
                      |++.++ .+++..+. .+..+++|++|++++|..+++.++..+...+++|++|++++|..+++.++.... ..+++|+.|
T Consensus        76 L~L~~~-~l~~~~~~-~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L  153 (284)
T d2astb2          76 LSLEGL-RLSDPIVN-TLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQL  153 (284)
T ss_dssp             EECTTC-BCCHHHHH-HHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEE
T ss_pred             cccccc-CCCcHHHH-HHhcCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcccccccchh
Confidence            887775 45544433 345667777777777777777666666667777777777777666666554433 334677777


Q ss_pred             EecCCC-CCChHHHHHHHHHhcCCCcEEEccCCCCCChHHHHHHHhcCCCCcEEeccCCCCCChHHHHHHHhccCCCcEE
Q 015721          260 IIGGCR-DISDESIKHLAASCKSSLKNLRMDWCLNISDSSLSCILSQCRNLEALDIGCCEEVTDAAFQDLGEVELSLKVL  338 (402)
Q Consensus       260 ~l~~~~-~~~~~~~~~l~~~~~~~L~~L~l~~~~~~~~~~l~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L  338 (402)
                      .++++. .+++..+..++..+ ++|++|++++|..+++..+.. +..+++|++|++++|..+++.++..+.. +++|+.|
T Consensus       154 ~l~~~~~~i~~~~l~~l~~~~-~~L~~L~L~~~~~itd~~~~~-l~~~~~L~~L~L~~C~~i~~~~l~~L~~-~~~L~~L  230 (284)
T d2astb2         154 NLSGYRKNLQKSDLSTLVRRC-PNLVHLDLSDSVMLKNDCFQE-FFQLNYLQHLSLSRCYDIIPETLLELGE-IPTLKTL  230 (284)
T ss_dssp             ECCSCGGGSCHHHHHHHHHHC-TTCSEEECTTCTTCCGGGGGG-GGGCTTCCEEECTTCTTCCGGGGGGGGG-CTTCCEE
T ss_pred             hhccccccccccccccccccc-ccccccccccccCCCchhhhh-hcccCcCCEEECCCCCCCChHHHHHHhc-CCCCCEE
Confidence            777653 46666677776666 677777777776676655544 4567777777777777777766666544 3477777


Q ss_pred             EE-eCCCCCHHHHHHHHHhCCCCC
Q 015721          339 KV-NCPKVTVVGIGNVLEKCASLE  361 (402)
Q Consensus       339 ~l-~~~~~~~~~l~~~~~~~~~L~  361 (402)
                      ++ +|  +++.++..+.+.+|+|+
T Consensus       231 ~l~~~--~~d~~l~~l~~~lp~L~  252 (284)
T d2astb2         231 QVFGI--VPDGTLQLLKEALPHLQ  252 (284)
T ss_dssp             ECTTS--SCTTCHHHHHHHSTTSE
T ss_pred             eeeCC--CCHHHHHHHHHhCcccc
Confidence            77 43  55556666666777765

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure