Citrus Sinensis ID: 015862

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MLLNIGSRAKEAKQNQEENNDNMAIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSSLVTKKND
cccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEHHccccccccccccccccccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccHHHHHHccccEEEcccccHHHHHHHHHcccccEEEccccccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHccc
cccccccccccccccccHccccccccccccccccccEccccEcccEEEEccccccccccccccHHHHHHHHHHcccccEEEEEEEEccccccccccccEcccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHcHHHcccEEcccccccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHccccccccccccccHHHHcHHHHHHHHHHHHHHcHHHEEEEEcccccccccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEEcHHHHHcccHHHHHHHccccccccHHHcccccccccccccccccHHHccccccc
MLLNIGSRAKEAkqnqeenndnmaietpvilfltpykmgnfnlshrvvlapltrqrsynnvpqphaILYYSQRTTKGGFLIAEAtgvsntaqgnpntpsiwtKEQVEAWKPIVDAVHAKGGIFFCQIrhvgrvsnrdyqpngqapisctdkpltpqirangvdvaqftpprrlrtdeipQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKdqvndrtdqyggsleNRCRFALEIVEAVSneigadrvgirlspfanymesgdsnpeALGLYMAESLNKYGILYChmveprmktreeksecphsllpmrkaFKGTflvaggydredgnkaIAEGRADLVVYGRLflanpdlprrfelnaplnkynretfytsdpvvgytdypflntsslvtkknd
MLLNIGSRAKEakqnqeenndnmaIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATgvsntaqgnpntPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRANgvdvaqftpprrlrtdeipQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAvsneigadrvgIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKsecphsllpmrKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLanpdlprrfelnaplnkynretfytsdpvvgytdypflntsslvtkknd
MLLNIGSRAKEAKQNQEENNDNMAIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSSLVTKKND
***********************AIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSN********PSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDY*****************QIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYME******EALGLYMAESLNKYGILYCHMVE***************LLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNT*********
*******************************FLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNT*********
MLLNIGSR*********ENNDNMAIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRM**********HSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSSLVTKKND
*****************************ILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQI****VDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSSL******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLNIGSRAKEAKQNQEENNDNMAIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSSLVTKKND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query399 2.2.26 [Sep-21-2011]
Q8GYB8374 12-oxophytodienoate reduc yes no 0.909 0.970 0.796 1e-180
Q8LAH7372 12-oxophytodienoate reduc no no 0.909 0.975 0.787 1e-177
Q9XG54376 12-oxophytodienoate reduc N/A no 0.909 0.965 0.782 1e-176
B9FSC8367 Putative 12-oxophytodieno yes no 0.894 0.972 0.798 1e-176
Q84QK0380 12-oxophytodienoate reduc yes no 0.887 0.931 0.705 1e-152
Q69TH8380 Putative 12-oxophytodieno no no 0.889 0.934 0.692 1e-152
Q69TH6382 Putative 12-oxophytodieno no no 0.887 0.926 0.7 1e-152
Q0E0C6406 Putative 12-oxophytodieno no no 0.899 0.884 0.680 1e-152
Q69TH4376 Putative 12-oxophytodieno no no 0.887 0.941 0.708 1e-152
Q69TI0374 Putative 12-oxophytodieno no no 0.884 0.943 0.695 1e-150
>sp|Q8GYB8|OPR2_ARATH 12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=2 SV=2 Back     alignment and function desciption
 Score =  632 bits (1630), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 289/363 (79%), Positives = 329/363 (90%)

Query: 30  ILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSN 89
           +  LTPYKMG FNLSHRVVLAPLTRQ+SY +VPQPHAILYYSQRT+ GGFLIAEATGVS+
Sbjct: 12  VPLLTPYKMGRFNLSHRVVLAPLTRQKSYGSVPQPHAILYYSQRTSPGGFLIAEATGVSD 71

Query: 90  TAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCT 149
           TAQG P+TP IWTKE VEAWKPIVDAVHAKGGIFFCQI HVGRVSNR +QP  QAPISCT
Sbjct: 72  TAQGYPDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPRRQAPISCT 131

Query: 150 DKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYL 209
            KP+ PQ+RANG+D A+FTPPRRL  +EIP IVNDFRLAARNA+EAGFDGVE+HGAHGYL
Sbjct: 132 GKPIMPQMRANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGAHGYL 191

Query: 210 IDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSN 269
           IDQF+KD+VNDRTD+YGGSL+NRC+FALE+V+AV+ EIG DRVGIRLSPFA+YMESGD+N
Sbjct: 192 IDQFMKDKVNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSPFADYMESGDTN 251

Query: 270 PEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDRE 329
           PEALGLYM ESLNKYGILYCHM+EPRMKT  E + C H+L+PMR+AFKGTF+ AGG+ RE
Sbjct: 252 PEALGLYMVESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFKGTFISAGGFTRE 311

Query: 330 DGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLN 389
           DGN+A+A+GR DLV YGR FLANPDLP+RF+L+APLNKYNR TFYTSDPVVGYTDYP L 
Sbjct: 312 DGNEAVAKGRTDLVAYGRWFLANPDLPKRFQLDAPLNKYNRSTFYTSDPVVGYTDYPSLE 371

Query: 390 TSS 392
           +++
Sbjct: 372 STA 374
Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds. May be involved in the biosynthesis or metabolism of oxylipin signaling molecules. In vitro, reduces 9R,13R-12-oxophyodienoic acid (9R,13R-OPDA) to 9R,13R-OPC-8:0, but only poorly 9S,13S-OPDA, the natural precursor of jasmonic acid. Can detoxify the explosive 2,4,6-trinitrotoluene (TNT) in vitro and in vivo by catalyzing its nitroreduction to form hydroxylamino-dinitrotoluene (HADNT).
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 2
>sp|Q8LAH7|OPR1_ARATH 12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9XG54|OPR1_SOLLC 12-oxophytodienoate reductase 1 OS=Solanum lycopersicum GN=OPR1 PE=1 SV=1 Back     alignment and function description
>sp|B9FSC8|OPR11_ORYSJ Putative 12-oxophytodienoate reductase 11 OS=Oryza sativa subsp. japonica GN=OPR11 PE=2 SV=1 Back     alignment and function description
>sp|Q84QK0|OPR1_ORYSJ 12-oxophytodienoate reductase 1 OS=Oryza sativa subsp. japonica GN=OPR1 PE=2 SV=1 Back     alignment and function description
>sp|Q69TH8|OPR4_ORYSJ Putative 12-oxophytodienoate reductase 4 OS=Oryza sativa subsp. japonica GN=OPR4 PE=2 SV=1 Back     alignment and function description
>sp|Q69TH6|OPR3_ORYSJ Putative 12-oxophytodienoate reductase 3 OS=Oryza sativa subsp. japonica GN=OPR3 PE=3 SV=1 Back     alignment and function description
>sp|Q0E0C6|OPR8_ORYSJ Putative 12-oxophytodienoate reductase 8 OS=Oryza sativa subsp. japonica GN=OPR8 PE=2 SV=1 Back     alignment and function description
>sp|Q69TH4|OPR2_ORYSJ Putative 12-oxophytodienoate reductase 2 OS=Oryza sativa subsp. japonica GN=OPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q69TI0|OPR5_ORYSJ Putative 12-oxophytodienoate reductase 5 OS=Oryza sativa subsp. japonica GN=OPR5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
224135727370 predicted protein [Populus trichocarpa] 0.927 1.0 0.832 0.0
225460240379 PREDICTED: 12-oxophytodienoate reductase 0.902 0.949 0.861 0.0
225460244379 PREDICTED: 12-oxophytodienoate reductase 0.919 0.968 0.847 0.0
147778557379 hypothetical protein VITISV_033920 [Viti 0.902 0.949 0.858 0.0
449524545376 PREDICTED: 12-oxophytodienoate reductase 0.929 0.986 0.827 0.0
40645459375 LEDI-5c protein [Lithospermum erythrorhi 0.919 0.978 0.833 0.0
449478866369 PREDICTED: putative 12-oxophytodienoate 0.894 0.967 0.845 0.0
359493373 505 PREDICTED: 12-oxophytodienoate reductase 0.959 0.758 0.787 0.0
356497438371 PREDICTED: 12-oxophytodienoate reductase 0.897 0.964 0.835 0.0
357480967369 12-oxophytodienoate reductase [Medicago 0.899 0.972 0.841 0.0
>gi|224135727|ref|XP_002327289.1| predicted protein [Populus trichocarpa] gi|222835659|gb|EEE74094.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/370 (83%), Positives = 339/370 (91%)

Query: 23  MAIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIA 82
           M  ETP +  LTPYKMG FNLSHR+VLAPLTRQRSYNNVPQPHAILYYSQRTT+GG LIA
Sbjct: 1   MVAETPTLPLLTPYKMGKFNLSHRIVLAPLTRQRSYNNVPQPHAILYYSQRTTEGGLLIA 60

Query: 83  EATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNG 142
           EATGVS+TAQG PNTP IWTKEQVEAWKPIVDAVHAKGGIFFCQ+ HVGRVSNRD+QPNG
Sbjct: 61  EATGVSDTAQGYPNTPGIWTKEQVEAWKPIVDAVHAKGGIFFCQLWHVGRVSNRDFQPNG 120

Query: 143 QAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEL 202
           QAPISCTDKPL PQIRANG+D   FT PRRLRTDEIP +VNDFR+AARNA+EAGFDGVE+
Sbjct: 121 QAPISCTDKPLAPQIRANGIDAVDFTTPRRLRTDEIPHVVNDFRIAARNAMEAGFDGVEI 180

Query: 203 HGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANY 262
           HGAHGYLIDQF+KDQVNDRTDQYGGSLENRCRFALE+V AV +EIGADRVGIRLSP+ANY
Sbjct: 181 HGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEVVGAVVDEIGADRVGIRLSPYANY 240

Query: 263 MESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLV 322
            ++GDSNP ALGLYM ESLNKYGIL+CHMVEPRMKT  E+ E PHSLLPMRKAF GTF+V
Sbjct: 241 GQAGDSNPGALGLYMVESLNKYGILFCHMVEPRMKTVGERVESPHSLLPMRKAFNGTFIV 300

Query: 323 AGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGY 382
           AGGYDRE+GNKA+AE  +DLV YGR+FLANPDLPRRFEL+APLNKY+R TFYT+DPV+GY
Sbjct: 301 AGGYDREEGNKAVAENYSDLVAYGRVFLANPDLPRRFELDAPLNKYDRGTFYTTDPVIGY 360

Query: 383 TDYPFLNTSS 392
           TDYPFL +++
Sbjct: 361 TDYPFLESTA 370

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225460240|ref|XP_002281119.1| PREDICTED: 12-oxophytodienoate reductase 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460244|ref|XP_002281348.1| PREDICTED: 12-oxophytodienoate reductase 2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147778557|emb|CAN60665.1| hypothetical protein VITISV_033920 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449524545|ref|XP_004169282.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|40645459|dbj|BAD06575.1| LEDI-5c protein [Lithospermum erythrorhizon] Back     alignment and taxonomy information
>gi|449478866|ref|XP_004155439.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359493373|ref|XP_002281430.2| PREDICTED: 12-oxophytodienoate reductase 2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497438|ref|XP_003517567.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357480967|ref|XP_003610769.1| 12-oxophytodienoate reductase [Medicago truncatula] gi|355512104|gb|AES93727.1| 12-oxophytodienoate reductase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
TAIR|locus:2030096374 OPR2 "12-oxophytodienoate redu 0.902 0.962 0.802 8.1e-163
TAIR|locus:2030086397 OPR1 "12-oxophytodienoate redu 0.521 0.523 0.735 1.4e-159
UNIPROTKB|Q84QK0380 OPR1 "12-oxophytodienoate redu 0.887 0.931 0.708 2.7e-139
TAIR|locus:2012285324 AT1G09400 [Arabidopsis thalian 0.812 1.0 0.739 9.8e-135
UNIPROTKB|Q6Z965394 OPR7 "12-oxophytodienoate redu 0.894 0.906 0.552 5.3e-104
UNIPROTKB|C5H429387 DBR2 "Artemisinic aldehyde Del 0.919 0.948 0.527 2e-102
TAIR|locus:2030948269 AT1G17990 [Arabidopsis thalian 0.631 0.936 0.735 4.9e-101
TAIR|locus:1005716725269 AT1G18020 [Arabidopsis thalian 0.631 0.936 0.735 4.9e-101
ASPGD|ASPL0000034369388 AN9177 [Emericella nidulans (t 0.721 0.742 0.43 5.2e-79
UNIPROTKB|Q4KCX1366 nemA "N-ethylmaleimide reducta 0.892 0.972 0.465 1.1e-78
TAIR|locus:2030096 OPR2 "12-oxophytodienoate reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1585 (563.0 bits), Expect = 8.1e-163, P = 8.1e-163
 Identities = 289/360 (80%), Positives = 328/360 (91%)

Query:    33 LTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQ 92
             LTPYKMG FNLSHRVVLAPLTRQ+SY +VPQPHAILYYSQRT+ GGFLIAEATGVS+TAQ
Sbjct:    15 LTPYKMGRFNLSHRVVLAPLTRQKSYGSVPQPHAILYYSQRTSPGGFLIAEATGVSDTAQ 74

Query:    93 GNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKP 152
             G P+TP IWTKE VEAWKPIVDAVHAKGGIFFCQI HVGRVSNR +QP  QAPISCT KP
Sbjct:    75 GYPDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPRRQAPISCTGKP 134

Query:   153 LTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQ 212
             + PQ+RANG+D A+FTPPRRL  +EIP IVNDFRLAARNA+EAGFDGVE+HGAHGYLIDQ
Sbjct:   135 IMPQMRANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQ 194

Query:   213 FLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEA 272
             F+KD+VNDRTD+YGGSL+NRC+FALE+V+AV+ EIG DRVGIRLSPFA+YMESGD+NPEA
Sbjct:   195 FMKDKVNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSPFADYMESGDTNPEA 254

Query:   273 LGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGN 332
             LGLYM ESLNKYGILYCHM+EPRMKT  E + C H+L+PMR+AFKGTF+ AGG+ REDGN
Sbjct:   255 LGLYMVESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFKGTFISAGGFTREDGN 314

Query:   333 KAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSS 392
             +A+A+GR DLV YGR FLANPDLP+RF+L+APLNKYNR TFYTSDPVVGYTDYP L +++
Sbjct:   315 EAVAKGRTDLVAYGRWFLANPDLPKRFQLDAPLNKYNRSTFYTSDPVVGYTDYPSLESTA 374
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009611 "response to wounding" evidence=IEP
GO:0009695 "jasmonic acid biosynthetic process" evidence=TAS
GO:0016629 "12-oxophytodienoate reductase activity" evidence=ISS
TAIR|locus:2030086 OPR1 "12-oxophytodienoate reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84QK0 OPR1 "12-oxophytodienoate reductase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2012285 AT1G09400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Z965 OPR7 "12-oxophytodienoate reductase 7" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|C5H429 DBR2 "Artemisinic aldehyde Delta(11(13)) reductase" [Artemisia annua (taxid:35608)] Back     alignment and assigned GO terms
TAIR|locus:2030948 AT1G17990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716725 AT1G18020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000034369 AN9177 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KCX1 nemA "N-ethylmaleimide reductase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40952KYE1_KLULA1, ., 3, ., 1, ., 3, 10.36360.84960.8517yesno
Q9FEX0OPRL_SOLLC1, ., 3, ., 1, ., -0.54780.88470.9943N/Ano
Q69TH4OPR2_ORYSJ1, ., 3, ., 1, ., -0.70830.88720.9414nono
P41816OYE3_YEAST1, ., 6, ., 9, 9, ., 10.37990.86960.8675yesno
Q8GYA3OPRL1_ARATH1, ., 3, ., 1, ., -0.73630.81201.0nono
Q4WZ70OYE3_ASPFU1, ., 5, ., 1, ., 4, 40.38790.86460.9175yesno
B9FSC8OPR11_ORYSJ1, ., 3, ., 1, ., -0.79830.89470.9727yesno
C5H429DBR2_ARTAN1, ., 3, ., 1, ., 9, 20.51960.90970.9379N/Ano
Q9XG54OPR1_SOLLC1, ., 3, ., 1, ., 4, 20.78230.90970.9654N/Ano
Q9FEW9OPR3_SOLLC1, ., 3, ., 1, ., 4, 20.55850.88720.8939N/Ano
Q84QK0OPR1_ORYSJ1, ., 3, ., 1, ., 4, 20.70550.88720.9315yesno
Q8GYB8OPR2_ARATH1, ., 3, ., 1, ., 4, 20.79610.90970.9705yesno
Q09670OYEA_SCHPO1, ., 6, ., 9, 9, ., 10.39140.87960.9188yesno
Q8LAH7OPR1_ARATH1, ., 3, ., 1, ., 4, 20.78780.90970.9758nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.10.983
4th Layer1.6.99.10.824
3rd Layer1.3.1.420.979
3rd Layer1.6.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_scaffold_41000063
hypothetical protein (370 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.VIII.1137.1
allene-oxide cyclase family protein (EC-5.3.99.6) (173 aa)
     •• 0.901
ACLL20
acyl-coa ligase (554 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
cd02933338 cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-lik 0.0
PLN02411391 PLN02411, PLN02411, 12-oxophytodienoate reductase 1e-169
PRK10605362 PRK10605, PRK10605, N-ethylmaleimide reductase; Pr 1e-118
COG1902363 COG1902, NemA, NADH:flavin oxidoreductases, Old Ye 1e-110
cd02803327 cd02803, OYE_like_FMN_family, Old yellow enzyme (O 1e-100
pfam00724336 pfam00724, Oxidored_FMN, NADH:flavin oxidoreductas 2e-92
cd02932336 cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) Yqj 3e-65
cd04747361 cd04747, OYE_like_5_FMN, Old yellow enzyme (OYE)-r 5e-63
cd04735353 cd04735, OYE_like_4_FMN, Old yellow enzyme (OYE)-r 3e-57
cd04734343 cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-r 2e-55
cd04733338 cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-r 3e-48
cd02930353 cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) 2e-44
PRK13523337 PRK13523, PRK13523, NADPH dehydrogenase NamA; Prov 2e-39
PRK08255765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R 2e-38
TIGR03997 645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 8e-36
cd02931382 cd02931, ER_like_FMN, Enoate reductase (ER)-like F 4e-34
cd02929370 cd02929, TMADH_HD_FMN, Trimethylamine dehydrogenas 3e-27
TIGR03996 633 TIGR03996, mycofact_OYE_1, mycofactocin system Fad 1e-15
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 1e-05
>gnl|CDD|239243 cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information 
 Score =  533 bits (1376), Expect = 0.0
 Identities = 184/341 (53%), Positives = 233/341 (68%), Gaps = 5/341 (1%)

Query: 31  LFLTPYKMGNFNLSHRVVLAPLTRQRS-YNNVPQPHAILYYSQRTTKGGFLIAEATGVSN 89
           LF +P K+GN  L +R+V+APLTR R+  + VP      YY+QR + G  +I EAT +S 
Sbjct: 2   LF-SPLKLGNLTLKNRIVMAPLTRSRADPDGVPTDLMAEYYAQRASAG-LIITEATQISP 59

Query: 90  TAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCT 149
             QG PNTP I+T EQVE WK + DAVHAKGG  F Q+ HVGRVS+    P G  P++ +
Sbjct: 60  QGQGYPNTPGIYTDEQVEGWKKVTDAVHAKGGKIFLQLWHVGRVSHPSLLPGGAPPVAPS 119

Query: 150 DKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYL 209
                 ++         +  PR L T+EIP IV DFR AARNAIEAGFDGVE+HGA+GYL
Sbjct: 120 AIAAEGKVFTPA-GKVPYPTPRALTTEEIPGIVADFRQAARNAIEAGFDGVEIHGANGYL 178

Query: 210 IDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSN 269
           IDQFL+D  N RTD+YGGS+ENR RF LE+V+AV+  IGADRVGIRLSPF  + + GDS+
Sbjct: 179 IDQFLRDGSNKRTDEYGGSIENRARFLLEVVDAVAEAIGADRVGIRLSPFGTFNDMGDSD 238

Query: 270 PEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDRE 329
           PEA   Y+A+ LNK G+ Y H+VEPR+    E  + P  L  +RKAFKG  + AGGYD E
Sbjct: 239 PEATFSYLAKELNKRGLAYLHLVEPRVAGNPE-DQPPDFLDFLRKAFKGPLIAAGGYDAE 297

Query: 330 DGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNR 370
               A+A+G+ADLV +GR F+ANPDL  R +  APLN+Y+R
Sbjct: 298 SAEAALADGKADLVAFGRPFIANPDLVERLKNGAPLNEYDR 338

OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes. Length = 338
>gnl|CDD|178033 PLN02411, PLN02411, 12-oxophytodienoate reductase Back     alignment and domain information
>gnl|CDD|182584 PRK10605, PRK10605, N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>gnl|CDD|224814 COG1902, NemA, NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239201 cd02803, OYE_like_FMN_family, Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>gnl|CDD|216083 pfam00724, Oxidored_FMN, NADH:flavin oxidoreductase / NADH oxidase family Back     alignment and domain information
>gnl|CDD|239242 cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>gnl|CDD|240095 cd04747, OYE_like_5_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>gnl|CDD|240086 cd04735, OYE_like_4_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>gnl|CDD|240085 cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>gnl|CDD|240084 cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>gnl|CDD|239240 cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>gnl|CDD|184110 PRK13523, PRK13523, NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|239241 cd02931, ER_like_FMN, Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>gnl|CDD|239239 cd02929, TMADH_HD_FMN, Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|188511 TIGR03996, mycofact_OYE_1, mycofactocin system FadH/OYE family oxidoreductase 1 Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 399
PLN02411391 12-oxophytodienoate reductase 100.0
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 100.0
PRK10605362 N-ethylmaleimide reductase; Provisional 100.0
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 100.0
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 100.0
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 100.0
PRK13523337 NADPH dehydrogenase NamA; Provisional 100.0
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 100.0
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 100.0
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 100.0
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 100.0
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 100.0
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 100.0
KOG0134400 consensus NADH:flavin oxidoreductase/12-oxophytodi 100.0
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 99.98
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 99.97
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 99.97
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.96
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.96
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 99.95
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 99.95
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 99.94
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 99.94
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.93
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 99.9
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 99.89
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 99.85
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 99.85
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 99.83
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.83
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 99.83
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 99.81
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.8
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 99.78
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 99.74
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 99.74
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 99.62
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.53
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 99.53
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 99.52
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 99.52
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 99.41
KOG2333614 consensus Uncharacterized conserved protein [Gener 99.4
PLN02826409 dihydroorotate dehydrogenase 99.38
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 99.35
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.31
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.27
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 98.94
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.92
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 98.81
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 98.8
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.79
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 98.78
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 98.77
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.74
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 98.73
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 98.69
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.68
PRK14024241 phosphoribosyl isomerase A; Provisional 98.68
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.64
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.63
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 98.59
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.59
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.55
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.54
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.54
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.48
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 98.48
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 98.47
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.46
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 98.45
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.45
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.44
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 98.44
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.44
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 98.43
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 98.42
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.4
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 98.38
KOG2334 477 consensus tRNA-dihydrouridine synthase [Translatio 98.35
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 98.35
PRK06806281 fructose-bisphosphate aldolase; Provisional 98.35
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.35
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 98.32
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 98.3
PRK07695201 transcriptional regulator TenI; Provisional 98.29
cd03322361 rpsA The starvation sensing protein RpsA from E.co 98.28
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 98.27
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 98.23
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 98.19
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.19
PRK14017382 galactonate dehydratase; Provisional 98.19
PRK07315293 fructose-bisphosphate aldolase; Provisional 98.19
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.18
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 98.17
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 98.16
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.15
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.15
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 98.15
PRK02714320 O-succinylbenzoate synthase; Provisional 98.14
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 98.13
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 98.13
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 98.11
PRK15440394 L-rhamnonate dehydratase; Provisional 98.1
PRK00507221 deoxyribose-phosphate aldolase; Provisional 98.08
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 98.08
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.07
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 98.07
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 98.07
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 98.06
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.06
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.05
PLN02274505 inosine-5'-monophosphate dehydrogenase 98.04
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate deh 98.03
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.01
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 98.01
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.01
PRK00208250 thiG thiazole synthase; Reviewed 97.99
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 97.99
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 97.98
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.98
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 97.98
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.97
PRK06801286 hypothetical protein; Provisional 97.96
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.95
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 97.95
cd03317354 NAAAR N-acylamino acid racemase (NAAAR), an octame 97.93
PRK14024241 phosphoribosyl isomerase A; Provisional 97.92
PLN02334229 ribulose-phosphate 3-epimerase 97.92
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.92
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.91
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.89
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.88
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 97.88
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 97.87
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.87
PRK02901327 O-succinylbenzoate synthase; Provisional 97.87
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 97.84
TIGR01927307 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthe 97.84
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.84
PLN02979366 glycolate oxidase 97.81
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.8
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 97.79
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 97.79
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.78
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 97.78
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 97.77
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 97.77
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 97.76
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.75
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 97.74
PF01645368 Glu_synthase: Conserved region in glutamate syntha 97.74
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.74
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 97.74
PLN02591250 tryptophan synthase 97.73
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 97.71
PLN02535364 glycolate oxidase 97.68
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.68
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.67
PRK11197381 lldD L-lactate dehydrogenase; Provisional 97.66
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 97.66
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.65
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.63
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 97.63
PRK08185283 hypothetical protein; Provisional 97.62
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.61
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 97.61
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.6
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 97.6
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.6
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.58
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.58
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 97.56
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 97.56
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 97.55
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.55
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 97.55
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 97.54
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 97.54
cd00308229 enolase_like Enolase-superfamily, characterized by 97.53
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 97.52
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.51
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.51
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.51
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.5
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 97.48
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.47
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 97.47
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.46
PRK07709285 fructose-bisphosphate aldolase; Provisional 97.41
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.41
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 97.41
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.4
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 97.4
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.37
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.37
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 97.36
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.35
PRK08610286 fructose-bisphosphate aldolase; Reviewed 97.34
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.32
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 97.31
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 97.3
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 97.3
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.29
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 97.29
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.26
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 97.25
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.25
PRK08999312 hypothetical protein; Provisional 97.23
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.22
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.21
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.21
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 97.2
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 97.19
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 97.18
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 97.18
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 97.18
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.17
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 97.15
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.12
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 97.12
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.11
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 97.09
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 97.09
PRK15129321 L-Ala-D/L-Glu epimerase; Provisional 97.09
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.07
PRK05835307 fructose-bisphosphate aldolase; Provisional 97.04
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 97.03
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.02
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.01
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 97.01
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.0
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 96.98
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 96.93
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 96.9
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 96.89
PLN02617 538 imidazole glycerol phosphate synthase hisHF 96.89
PRK05283257 deoxyribose-phosphate aldolase; Provisional 96.88
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 96.86
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 96.85
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 96.81
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 96.81
PRK05105322 O-succinylbenzoate synthase; Provisional 96.76
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 96.73
PLN02617538 imidazole glycerol phosphate synthase hisHF 96.7
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 96.68
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 96.66
PRK09197350 fructose-bisphosphate aldolase; Provisional 96.66
PRK04302223 triosephosphate isomerase; Provisional 96.66
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 96.65
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 96.63
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 96.63
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 96.6
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 96.59
PRK07084321 fructose-bisphosphate aldolase; Provisional 96.59
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 96.59
PF0118867 MR_MLE: Mandelate racemase / muconate lactonizing 96.58
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 96.57
PRK08005210 epimerase; Validated 96.51
cd03314369 MAL Methylaspartate ammonia lyase (3-methylasparta 96.49
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 96.45
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 96.44
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 96.44
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.41
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 96.41
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 96.41
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 96.36
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 96.32
PRK08227264 autoinducer 2 aldolase; Validated 96.31
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 96.3
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 96.28
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.25
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 96.23
TIGR01060425 eno phosphopyruvate hydratase. Alternate name: eno 96.23
TIGR01502408 B_methylAsp_ase methylaspartate ammonia-lyase. Thi 96.21
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 96.14
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 96.13
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 96.09
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 96.07
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 96.06
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 96.06
PRK08091228 ribulose-phosphate 3-epimerase; Validated 96.04
PRK14057254 epimerase; Provisional 96.03
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 96.03
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 96.03
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 96.02
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 95.95
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 95.91
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 95.89
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 95.81
PRK06852304 aldolase; Validated 95.78
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.74
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 95.73
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 95.68
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 95.68
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 95.65
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 95.65
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 95.63
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 95.61
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.6
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.57
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 95.56
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 95.55
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 95.54
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 95.5
PRK09250348 fructose-bisphosphate aldolase; Provisional 95.49
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 95.47
PRK03170292 dihydrodipicolinate synthase; Provisional 95.43
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 95.42
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.4
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 95.38
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 95.32
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 95.3
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 95.29
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.21
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 95.18
PLN028581378 fructose-bisphosphate aldolase 95.17
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 95.16
TIGR02127261 pyrF_sub2 orotidine 5'-phosphate decarboxylase, su 95.12
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 95.1
cd03313408 enolase Enolase: Enolases are homodimeric enzymes 95.1
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.06
PRK04147293 N-acetylneuraminate lyase; Provisional 95.03
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 95.03
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 94.96
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 94.93
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 94.92
PLN02460338 indole-3-glycerol-phosphate synthase 94.92
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 94.91
PRK00077425 eno enolase; Provisional 94.9
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.86
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 94.86
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 94.86
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 94.82
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 94.77
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.76
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.74
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 94.74
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 94.71
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 94.7
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 94.69
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 94.65
TIGR03569 329 NeuB_NnaB N-acetylneuraminate synthase. This famil 94.62
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 94.62
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 94.61
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 94.6
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 94.57
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 94.55
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 94.54
PLN02424332 ketopantoate hydroxymethyltransferase 94.53
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 94.5
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 94.47
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 94.47
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 94.45
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 94.43
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 94.42
PF00682237 HMGL-like: HMGL-like of this family is not conserv 94.39
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 94.35
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 94.33
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.32
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 94.28
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 94.28
KOG1436398 consensus Dihydroorotate dehydrogenase [Nucleotide 94.26
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 94.25
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 94.12
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 94.06
PRK12330 499 oxaloacetate decarboxylase; Provisional 94.04
PLN02274 505 inosine-5'-monophosphate dehydrogenase 94.02
TIGR03586 327 PseI pseudaminic acid synthase. 93.81
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 93.79
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 93.76
PRK02227238 hypothetical protein; Provisional 93.76
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 93.72
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 93.67
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 93.62
TIGR01334277 modD putative molybdenum utilization protein ModD. 93.62
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 93.59
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 93.55
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 93.49
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 93.45
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 93.4
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 93.34
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 93.34
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 93.29
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.27
PRK09016296 quinolinate phosphoribosyltransferase; Validated 93.25
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 93.23
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 93.2
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 93.18
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 93.11
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 93.11
PRK06096284 molybdenum transport protein ModD; Provisional 93.08
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.07
PRK12581 468 oxaloacetate decarboxylase; Provisional 93.06
PLN02495 385 oxidoreductase, acting on the CH-CH group of donor 93.03
PLN02417280 dihydrodipicolinate synthase 92.99
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 92.92
PRK05581220 ribulose-phosphate 3-epimerase; Validated 92.87
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 92.75
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 92.74
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 92.7
TIGR01306 321 GMP_reduct_2 guanosine monophosphate reductase, ba 92.57
KOG0538363 consensus Glycolate oxidase [Energy production and 92.54
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 92.5
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 92.47
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 92.4
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 92.39
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 92.19
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 92.13
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 92.1
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.07
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 92.05
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 92.03
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 91.99
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 91.98
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 91.97
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 91.92
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 91.74
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 91.63
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 91.55
TIGR01232325 lacD tagatose 1,6-diphosphate aldolase. This famil 91.54
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 91.52
PRK12331 448 oxaloacetate decarboxylase; Provisional 91.5
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 91.48
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 91.38
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 91.38
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 91.35
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 91.29
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 91.25
TIGR01417565 PTS_I_fam phosphoenolpyruvate-protein phosphotrans 91.23
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 91.14
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 91.06
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 90.95
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 90.94
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 90.92
PRK14041 467 oxaloacetate decarboxylase; Provisional 90.81
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 90.78
PRK02048 611 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 90.76
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 90.69
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 90.66
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 90.62
PRK06852304 aldolase; Validated 90.59
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 90.53
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 90.5
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 90.47
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 90.46
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 90.34
KOG0134400 consensus NADH:flavin oxidoreductase/12-oxophytodi 90.33
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 90.24
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 90.22
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 90.18
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 90.16
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 90.12
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 90.08
PRK14040 593 oxaloacetate decarboxylase; Provisional 90.02
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 89.98
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 89.92
PLN00191457 enolase 89.91
COG0854243 PdxJ Pyridoxal phosphate biosynthesis protein [Coe 89.9
PLN02979366 glycolate oxidase 89.86
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 89.81
PRK15452 443 putative protease; Provisional 89.69
COG3684306 LacD Tagatose-1,6-bisphosphate aldolase [Carbohydr 89.63
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 89.55
PF00682237 HMGL-like: HMGL-like of this family is not conserv 89.51
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 89.51
PRK09282 592 pyruvate carboxylase subunit B; Validated 89.48
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 89.47
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 89.46
PLN02746347 hydroxymethylglutaryl-CoA lyase 89.41
PRK14042 596 pyruvate carboxylase subunit B; Provisional 89.4
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 89.3
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 89.16
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 89.02
PRK12399324 tagatose 1,6-diphosphate aldolase; Reviewed 88.97
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 88.96
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 88.82
PLN02363256 phosphoribosylanthranilate isomerase 88.66
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 88.66
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 88.48
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 88.37
PF05853272 DUF849: Prokaryotic protein of unknown function (D 88.37
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 88.35
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 88.3
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 88.29
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 88.23
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 88.16
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 88.07
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 88.04
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 87.99
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 87.91
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 87.85
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 87.82
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 87.79
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 87.73
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 87.64
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 87.49
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information 
Probab=100.00  E-value=8e-89  Score=682.73  Aligned_cols=360  Identities=57%  Similarity=0.993  Sum_probs=307.3

Q ss_pred             CccCCCccccCCeeeCCceeeCCCCCCCCCCCCCCHHHHHHHHhhcCCCcEEEEcccccCCCCCCCCCCCCCCCHHHHhh
Q 015862           29 VILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEA  108 (399)
Q Consensus        29 ~~~Lf~P~~ig~~~lkNRiv~apm~~~~~~~G~~t~~~~~~y~~~a~g~Glii~e~~~V~~~g~~~~~~~~l~~d~~i~~  108 (399)
                      +++||+|++||+++|||||||+||+++++.||.||+.+++||++||+|+||||+|+++|++.+..+++++++|+|+++++
T Consensus         9 ~~~Lf~P~~ig~~~lkNRiv~aPm~~~~~~dG~~t~~~~~yy~~rA~gGGLIIte~~~V~~~g~~~~~~~gi~~d~~i~~   88 (391)
T PLN02411          9 NETLFSPYKMGRFDLSHRVVLAPMTRCRALNGIPNAALAEYYAQRSTPGGFLISEGTLISPTAPGFPHVPGIYSDEQVEA   88 (391)
T ss_pred             chhcCCCeeECCEEEcccCEECCcCcCcCCCCCCCHHHHHHHHHHHcCCCEEEeCceEECcccCcCCCCCccCCHHHHHH
Confidence            46899999999999999999999999888789999999999999999459999999999999999999999999999999


Q ss_pred             hHHHHHHHHHcCCeEEEecccCCCccCCCCCCCCCCCcccCCCCCCccc---ccCCCcccCCCCCCCCChhHHHHHHHHH
Q 015862          109 WKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQI---RANGVDVAQFTPPRRLRTDEIPQIVNDF  185 (399)
Q Consensus       109 ~~~l~~~vh~~g~~i~~QL~H~Gr~~~~~~~~~~~~~~aps~~~~~~~~---~~~g~~~~~~~~p~~mt~~eI~~ii~~f  185 (399)
                      ||+++++||++|+++++||+|+||++.+.....+..+++||.++.....   ...+. ......|++||.+||+++|++|
T Consensus        89 ~~~l~~avH~~G~~i~~QL~H~Gr~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~-~~~~~~pr~mt~~eI~~ii~~f  167 (391)
T PLN02411         89 WKKVVDAVHAKGSIIFCQLWHVGRASHQVYQPGGAAPISSTNKPISERWRILMPDGS-YGKYPKPRALETSEIPEVVEHY  167 (391)
T ss_pred             HHHHHHHHHhcCCEEEEeccCCCCCCccccccCCCCccCCccccccCCcccccCCcc-ccCCCCCccCCHHHHHHHHHHH
Confidence            9999999999999999999999999876432234566788765432100   00000 0013468999999999999999


Q ss_pred             HHHHHHHHHhCCCEEEEccccchhhhhcccCcccCCCCCCCCchhhhhHHHHHHHHHHHHHhCCCceEEEecCCcccCCC
Q 015862          186 RLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMES  265 (399)
Q Consensus       186 ~~aA~~a~~aGfDgVeIh~~~GyLl~qFlSp~~N~R~D~yGGslenR~r~~~eii~avR~~vg~~~v~vrls~~~~~~~~  265 (399)
                      ++||+||++|||||||||++|||||+|||||.+|+|||+||||+|||+||++|||++||++||+++|+||||+.+++.+.
T Consensus       168 ~~AA~rA~~AGFDGVEIH~AhGYLl~QFLSp~tN~RtDeYGGSlENR~RF~lEIi~aVr~~vg~d~vgvRiS~~~~~~~~  247 (391)
T PLN02411        168 RQAALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSIENRCRFLMQVVQAVVSAIGADRVGVRVSPAIDHLDA  247 (391)
T ss_pred             HHHHHHHHHcCCCEEEEccccchHHHHhCCCccCCCCCcCCCCHHHHhHHHHHHHHHHHHHcCCCeEEEEEcccccccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999988899999986554432


Q ss_pred             CCCChHHHHHHHHHhhhhh------CceEEEEeCCCccccc-----ccC---CCchhhHHHHhhcCCcEEEeCCCCHHHH
Q 015862          266 GDSNPEALGLYMAESLNKY------GILYCHMVEPRMKTRE-----EKS---ECPHSLLPMRKAFKGTFLVAGGYDREDG  331 (399)
Q Consensus       266 ~~~~~~~~~~~l~~~Le~~------Gvd~l~v~~~~~~~~~-----~~~---~~~~~~~~ir~~~~~pvi~~Ggit~~~a  331 (399)
                      ...++.+++..+++.|++.      |+||||++.+.+....     ...   ....+++.||+.+++||+++|++++++|
T Consensus       248 ~~~~~~~~~~~~~~~l~~~~~~~g~~vd~i~vs~g~~~~~~~~~~~~~~~~~~~~~~a~~ik~~v~~pvi~~G~i~~~~a  327 (391)
T PLN02411        248 TDSDPLNLGLAVVERLNKLQLQNGSKLAYLHVTQPRYTAYGQTESGRHGSEEEEAQLMRTLRRAYQGTFMCSGGFTRELG  327 (391)
T ss_pred             CCCcchhhHHHHHHHHHHHHhhcCCCeEEEEecCCcccccCCCcccccCCccchhHHHHHHHHHcCCCEEEECCCCHHHH
Confidence            2344567788888888864      5999999987542110     011   1224678899999999999999998999


Q ss_pred             HHHHHcCCCcEEEechHHhhCCcHHHHHHhCCCCCCCCcccccccCCCCCccccCCCC
Q 015862          332 NKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLN  389 (399)
Q Consensus       332 ~~~L~~G~~D~V~~gR~~iadPdl~~k~~~g~~~~~~~~~~~~~~~~~~g~~~~~~~~  389 (399)
                      +++|++|.+|+|+|||++|+||||++|+++|+++++++..+||+.++..||+|||+++
T Consensus       328 ~~~l~~g~aDlV~~gR~~iadPdl~~k~~~g~~l~~~~~~~~~~~~~~~gy~~~p~~~  385 (391)
T PLN02411        328 MQAVQQGDADLVSYGRLFISNPDLVLRFKLNAPLNKYIRKTFYTQDPVVGYTDYPFLS  385 (391)
T ss_pred             HHHHHcCCCCEEEECHHHHhCccHHHHHhcCCCCCCCChhheeCCCCCCCCCcccccc
Confidence            9999999999999999999999999999999999999999999734456999999875

>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>KOG0134 consensus NADH:flavin oxidoreductase/12-oxophytodienoate reductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PRK02714 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK15440 L-rhamnonate dehydratase; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK02901 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK15129 L-Ala-D/L-Glu epimerase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK05105 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PF01188 MR_MLE: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain; InterPro: IPR013342 Mandelate racemase 5 Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01060 eno phosphopyruvate hydratase Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK00077 eno enolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>TIGR01232 lacD tagatose 1,6-diphosphate aldolase Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0134 consensus NADH:flavin oxidoreductase/12-oxophytodienoate reductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PLN00191 enolase Back     alignment and domain information
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>COG3684 LacD Tagatose-1,6-bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK12399 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PF05853 DUF849: Prokaryotic protein of unknown function (DUF849); InterPro: IPR008567 This family consists of several hypothetical prokaryotic proteins with no known function Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
1vji_A372 Gene Product Of At1g76680 From Arabidopsis Thaliana 1e-178
1icp_A376 Crystal Structure Of 12-Oxophytodienoate Reductase 1e-177
3hgo_A402 Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTA 1e-120
2hs6_A402 Crystal Structure Of The E291k Mutant Of 12- Oxophy 1e-119
2hs8_A402 Crystal Structure Of The Y364f Mutant Of 12- Oxophy 1e-119
1q45_A391 12-0xo-Phytodienoate Reductase Isoform 3 Length = 3 1e-113
2r14_A377 Structure Of Morphinone Reductase In Complex With T 3e-79
3gx9_A377 Structure Of Morphinone Reductase N189a Mutant In C 3e-79
1gwj_A377 Morphinone Reductase Length = 377 2e-78
1h50_A364 Stucture Of Pentaerythritol Tetranitrate Reductase 5e-76
3p7y_A365 Pentaerythritol Tetranitrate Reductase Co-Crystal S 5e-76
3p62_A373 Wild-Type Pentaerythritol Tetranitrate Reductase Co 5e-76
1vys_X364 Stucture Of Pentaerythritol Tetranitrate Reductase 5e-76
1vyp_X364 Stucture Of Pentaerythritol Tetranitrate Reductase 8e-76
3p8i_A365 Y351f Mutant Of Pentaerythritol Tetranitrate Reduct 1e-75
3p67_A373 T26s Mutant Of Pentaerythritol Tetranitrate Reducta 1e-75
2abb_A364 Structure Of Petn Reductase Y186f In Complex With C 1e-75
3p8j_A365 Y351s Mutant Of Pentaerythritol Tetranitrate Reduct 2e-75
3p84_A365 Y351a Mutant Of Pentaerythritol Tetranitrate Reduct 3e-75
3p74_A373 H181n Mutant Of Pentaerythritol Tetranitrate Reduct 4e-75
3p82_A365 H184n Mutant Of Pentaerythritol Tetranitrate Reduct 4e-75
4ab4_A362 Structure Of Xenobiotic Reductase B From Pseudomona 4e-74
3gka_A361 Crystal Structure Of N-Ethylmaleimidine Reductase F 5e-74
2gou_A365 Structure Of Wild Type, Oxidized Sye1, An Oye Homol 1e-69
4a3u_A358 X-Structure Of The Old Yellow Enzyme Homologue From 4e-69
3aty_A379 Crystal Structure Of Tcoye Length = 379 4e-57
3txz_A400 Oye1-W116q Complexed With R-Carvone Length = 400 2e-55
1bwl_A399 Old Yellow Enzyme (Oye1) Double Mutant H191n:n194h 3e-55
4gbu_A400 Oye1-W116a In Complex With Aromatic Product Of S-Ca 3e-55
1oya_A400 Old Yellow Enzyme At 2 Angstroms Resolution: Overal 5e-55
4gwe_A400 W116l-Oye1 Complexed With (R)-Carvone Length = 400 5e-55
4ge8_A400 Oye1-W116i Complexed With (S)-Carvone Length = 400 6e-55
3rnd_A399 W116i-Oye1 Complexed With 2-(Hydroxymethyl)-Cyclope 6e-55
1k02_A399 Crystal Structure Of Old Yellow Enzyme Mutant Gln11 2e-54
1bwk_A399 Old Yellow Enzyme (Oye1) Mutant H191n Length = 399 3e-54
3tjl_A407 Crystal Structure Of A Novel Oye From The Xylose-Fe 5e-50
4df2_A407 P. Stipitis Oye2.6 Complexed With P-Chlorophenol Le 6e-50
3kru_A343 Crystal Structure Of The Thermostable Old Yellow En 8e-32
3krz_A337 Crystal Structure Of The Thermostable Nadh4-Bound O 8e-32
3l67_A363 Xenobiotic Reductase A - C25s Variant Length = 363 2e-28
3n14_A363 Xena - W358a Length = 363 3e-28
3l65_A363 Xenobiotic Reductase A - C25a Mutant Length = 363 3e-28
3l5l_A363 Xenobiotic Reductase A - Oxidized Length = 363 3e-28
2h8z_A359 Xenobiotic Reductase A In Complex With 8-Hydroxycou 3e-28
2h8x_A358 Xenobiotic Reductase A-Oxidized Length = 358 4e-28
3n16_A363 Xena - Y183f Length = 363 9e-28
3gr7_A340 Structure Of Oye From Geobacillus Kaustophilus, Hex 2e-27
1ps9_A 671 The Crystal Structure And Reaction Mechanism Of E. 2e-25
1z41_A338 Crystal Structure Of Oxidized Yqjm From Bacillus Su 1e-24
3hf3_A349 Old Yellow Enzyme From Thermus Scotoductus Sa-01 Le 1e-21
3k30_A 690 Histamine Dehydrogenase From Nocardiodes Simplex Le 9e-18
2tmd_A 729 Correlation Of X-Ray Deduced And Experimental Amino 1e-16
1djq_A 729 Structural And Biochemical Characterization Of Reco 1e-16
3l5a_A419 Crystal Structure Of A Probable Nadh-Dependent Flav 2e-09
>pdb|1VJI|A Chain A, Gene Product Of At1g76680 From Arabidopsis Thaliana Length = 372 Back     alignment and structure 
Iteration: 1

 Score =  621 bits (1602), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 286/363 (78%), Positives = 325/363 (89%)
Query: 30  ILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSN 89
           +  LTPYKMG FNLSHRVVLAPLTRQRSY NVPQPHA +YYSQRTT GGFLI EATGVS+
Sbjct: 10  VPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSD 69
Query: 90  TAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCT 149
           TAQG  +TP IWTKE VEAWKPIVDAVHAKGGIFFCQI HVGRVSN  +QPNG+APISC+
Sbjct: 70  TAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCS 129
Query: 150 DKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYL 209
           DKPL PQIR+NG+D A FTPPRRL  +EIP IVNDFRLAARNA+EAGFDGVE+HGA+GYL
Sbjct: 130 DKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYL 189
Query: 210 IDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSN 269
           IDQF+KD VNDRTD+YGGSL+NRC+F LEIV+AV+ EIG DRVGIRLSPFA+YMESGD+N
Sbjct: 190 IDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTN 249
Query: 270 PEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDRE 329
           P ALGLYMAESLNKYGILYCH++E RMKT  E   CPH+L+PMRKAFKGTF+ AGG+ RE
Sbjct: 250 PGALGLYMAESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKGTFISAGGFTRE 309
Query: 330 DGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLN 389
           DGN+A+++GR DLV YGR FLANPDLP+RF+++APLNKY+R TFYTSDPVVGYTDYPFL 
Sbjct: 310 DGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE 369
Query: 390 TSS 392
           +++
Sbjct: 370 STA 372
>pdb|1ICP|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 1 From Tomato Complexed With Peg400 Length = 376 Back     alignment and structure
>pdb|3HGO|A Chain A, Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTANT FROM Tomato Length = 402 Back     alignment and structure
>pdb|2HS6|A Chain A, Crystal Structure Of The E291k Mutant Of 12- Oxophytodienoate Reductase 3 (Opr3) From Tomato Length = 402 Back     alignment and structure
>pdb|2HS8|A Chain A, Crystal Structure Of The Y364f Mutant Of 12- Oxophytodienoate Reductase 3 From Tomato Length = 402 Back     alignment and structure
>pdb|1Q45|A Chain A, 12-0xo-Phytodienoate Reductase Isoform 3 Length = 391 Back     alignment and structure
>pdb|2R14|A Chain A, Structure Of Morphinone Reductase In Complex With Tetrahydronad Length = 377 Back     alignment and structure
>pdb|3GX9|A Chain A, Structure Of Morphinone Reductase N189a Mutant In Complex With Tetrahydronad Length = 377 Back     alignment and structure
>pdb|1GWJ|A Chain A, Morphinone Reductase Length = 377 Back     alignment and structure
>pdb|1H50|A Chain A, Stucture Of Pentaerythritol Tetranitrate Reductase And Complexes Length = 364 Back     alignment and structure
>pdb|3P7Y|A Chain A, Pentaerythritol Tetranitrate Reductase Co-Crystal Structure With Bound (E)-1-(2'-Hydroxyphenyl)-2-Nitroethene Length = 365 Back     alignment and structure
>pdb|3P62|A Chain A, Wild-Type Pentaerythritol Tetranitrate Reductase Containing A C- Terminal 8-Histidine Tag Length = 373 Back     alignment and structure
>pdb|1VYS|X Chain X, Stucture Of Pentaerythritol Tetranitrate Reductase W102y Mutant And Complexed With Picric Acid Length = 364 Back     alignment and structure
>pdb|1VYP|X Chain X, Stucture Of Pentaerythritol Tetranitrate Reductase W102f Mutant And Complexed With Picric Acid Length = 364 Back     alignment and structure
>pdb|3P8I|A Chain A, Y351f Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 Back     alignment and structure
>pdb|3P67|A Chain A, T26s Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 373 Back     alignment and structure
>pdb|2ABB|A Chain A, Structure Of Petn Reductase Y186f In Complex With Cyanide Length = 364 Back     alignment and structure
>pdb|3P8J|A Chain A, Y351s Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 Back     alignment and structure
>pdb|3P84|A Chain A, Y351a Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 Back     alignment and structure
>pdb|3P74|A Chain A, H181n Mutant Of Pentaerythritol Tetranitrate Reductase Containing A C- Terminal His8-Tag Length = 373 Back     alignment and structure
>pdb|3P82|A Chain A, H184n Mutant Of Pentaerythritol Tetranitrate Reductase Containing Bound Acetate Ion Length = 365 Back     alignment and structure
>pdb|4AB4|A Chain A, Structure Of Xenobiotic Reductase B From Pseudomonas Putida In Complex With Tnt Length = 362 Back     alignment and structure
>pdb|3GKA|A Chain A, Crystal Structure Of N-Ethylmaleimidine Reductase From Burkholderia Pseudomallei Length = 361 Back     alignment and structure
>pdb|2GOU|A Chain A, Structure Of Wild Type, Oxidized Sye1, An Oye Homologue From S. Oneidensis Length = 365 Back     alignment and structure
>pdb|4A3U|A Chain A, X-Structure Of The Old Yellow Enzyme Homologue From Zymomonas Mobilis (Ncr) Length = 358 Back     alignment and structure
>pdb|3ATY|A Chain A, Crystal Structure Of Tcoye Length = 379 Back     alignment and structure
>pdb|3TXZ|A Chain A, Oye1-W116q Complexed With R-Carvone Length = 400 Back     alignment and structure
>pdb|1BWL|A Chain A, Old Yellow Enzyme (Oye1) Double Mutant H191n:n194h Length = 399 Back     alignment and structure
>pdb|4GBU|A Chain A, Oye1-W116a In Complex With Aromatic Product Of S-Carvone Dismutation Length = 400 Back     alignment and structure
>pdb|1OYA|A Chain A, Old Yellow Enzyme At 2 Angstroms Resolution: Overall Structure, Ligand Binding And Comparison With Related Flavoproteins Length = 400 Back     alignment and structure
>pdb|4GWE|A Chain A, W116l-Oye1 Complexed With (R)-Carvone Length = 400 Back     alignment and structure
>pdb|4GE8|A Chain A, Oye1-W116i Complexed With (S)-Carvone Length = 400 Back     alignment and structure
>pdb|3RND|A Chain A, W116i-Oye1 Complexed With 2-(Hydroxymethyl)-Cyclopent-2-Enone Length = 399 Back     alignment and structure
>pdb|1K02|A Chain A, Crystal Structure Of Old Yellow Enzyme Mutant Gln114asn Length = 399 Back     alignment and structure
>pdb|1BWK|A Chain A, Old Yellow Enzyme (Oye1) Mutant H191n Length = 399 Back     alignment and structure
>pdb|3TJL|A Chain A, Crystal Structure Of A Novel Oye From The Xylose-Fermenting Fungus P. Stipitis Length = 407 Back     alignment and structure
>pdb|4DF2|A Chain A, P. Stipitis Oye2.6 Complexed With P-Chlorophenol Length = 407 Back     alignment and structure
>pdb|3KRU|A Chain A, Crystal Structure Of The Thermostable Old Yellow Enzyme From Thermoanaerobacter Pseudethanolicus E39 Length = 343 Back     alignment and structure
>pdb|3KRZ|A Chain A, Crystal Structure Of The Thermostable Nadh4-Bound Old Yellow Enzyme From Thermoanaerobacter Pseudethanolicus E39 Length = 337 Back     alignment and structure
>pdb|3L67|A Chain A, Xenobiotic Reductase A - C25s Variant Length = 363 Back     alignment and structure
>pdb|3N14|A Chain A, Xena - W358a Length = 363 Back     alignment and structure
>pdb|3L65|A Chain A, Xenobiotic Reductase A - C25a Mutant Length = 363 Back     alignment and structure
>pdb|3L5L|A Chain A, Xenobiotic Reductase A - Oxidized Length = 363 Back     alignment and structure
>pdb|2H8Z|A Chain A, Xenobiotic Reductase A In Complex With 8-Hydroxycoumarin Length = 359 Back     alignment and structure
>pdb|2H8X|A Chain A, Xenobiotic Reductase A-Oxidized Length = 358 Back     alignment and structure
>pdb|3N16|A Chain A, Xena - Y183f Length = 363 Back     alignment and structure
>pdb|3GR7|A Chain A, Structure Of Oye From Geobacillus Kaustophilus, Hexagonal Crystal Form Length = 340 Back     alignment and structure
>pdb|1PS9|A Chain A, The Crystal Structure And Reaction Mechanism Of E. Coli 2,4- Dienoyl Coa Reductase Length = 671 Back     alignment and structure
>pdb|1Z41|A Chain A, Crystal Structure Of Oxidized Yqjm From Bacillus Subtilis Length = 338 Back     alignment and structure
>pdb|3HF3|A Chain A, Old Yellow Enzyme From Thermus Scotoductus Sa-01 Length = 349 Back     alignment and structure
>pdb|3K30|A Chain A, Histamine Dehydrogenase From Nocardiodes Simplex Length = 690 Back     alignment and structure
>pdb|2TMD|A Chain A, Correlation Of X-Ray Deduced And Experimental Amino Acid Sequences Of Trimethylamine Dehydrogenase Length = 729 Back     alignment and structure
>pdb|1DJQ|A Chain A, Structural And Biochemical Characterization Of Recombinant C30a Mutant Of Trimethylamine Dehydrogenase From Methylophilus Methylotrophus (Sp. W3a1) Length = 729 Back     alignment and structure
>pdb|3L5A|A Chain A, Crystal Structure Of A Probable Nadh-Dependent Flavin Oxidoreductase From Staphylococcus Aureus Length = 419 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 0.0
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 0.0
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 0.0
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 0.0
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 0.0
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 0.0
3rnd_A399 NADPH dehydrogenase 1; TIM barrel, oxidoreductase; 0.0
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 0.0
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 0.0
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 1e-113
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 2e-71
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 3e-69
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 7e-67
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 7e-67
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 1e-66
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 2e-66
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 5e-65
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 8e-64
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Length = 376 Back     alignment and structure
 Score =  661 bits (1708), Expect = 0.0
 Identities = 284/379 (74%), Positives = 326/379 (86%), Gaps = 4/379 (1%)

Query: 14  QNQEENNDNMAIETPVILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQR 73
           +N+      +     + L  +P KMG F L HRVVLAPLTRQRSY  +PQPHAIL+YSQR
Sbjct: 2   ENKVVEEKQV---DKIPLM-SPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQR 57

Query: 74  TTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRV 133
           +T GG LI EAT +S T  G  + P IWTKEQVEAWKPIVDAVHAKGGIFFCQI HVGRV
Sbjct: 58  STNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRV 117

Query: 134 SNRDYQPNGQAPISCTDKPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAI 193
           SN+D+QPNG+ PISCTD+ LTPQI +NG+D+A FT PRRL TDEIPQIVN+FR+AARNAI
Sbjct: 118 SNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAI 177

Query: 194 EAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVG 253
           EAGFDGVE+HGAHGYLIDQF+KDQVNDR+D+YGGSLENRCRFALEIVEAV+NEIG+DRVG
Sbjct: 178 EAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVG 237

Query: 254 IRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMR 313
           IR+SPFA+Y E+GD+NP ALGLYM ESLNKY + YCH+VEPRMKT  EK EC  SL+PMR
Sbjct: 238 IRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMR 297

Query: 314 KAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETF 373
           KA+KGTF+VAGGYDREDGN+A+ E RADLV YGRLF++NPDLP+RFELNAPLNKYNR+TF
Sbjct: 298 KAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTF 357

Query: 374 YTSDPVVGYTDYPFLNTSS 392
           YTSDP+VGYTDYPFL T +
Sbjct: 358 YTSDPIVGYTDYPFLETMT 376
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Length = 402 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Length = 377 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Length = 364 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Length = 365 Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} Length = 361 Back     alignment and structure
>3rnd_A NADPH dehydrogenase 1; TIM barrel, oxidoreductase; HET: FMN 3RN; 1.40A {Saccharomyces pastorianus} PDB: 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Length = 399 Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Length = 407 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Length = 379 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Length = 419 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} PDB: 3hf3_A* Length = 349 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Length = 338 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Length = 340 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} PDB: 3krz_A* Length = 343 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Length = 363 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 100.0
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 100.0
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 100.0
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 100.0
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 100.0
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 100.0
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 100.0
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 100.0
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 100.0
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 100.0
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 100.0
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 100.0
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 100.0
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 100.0
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 100.0
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 100.0
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 100.0
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 100.0
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 100.0
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 100.0
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 100.0
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 100.0
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.96
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 99.92
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 99.92
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 99.92
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 99.91
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.83
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.82
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.8
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.8
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.76
2gl5_A410 Putative dehydratase protein; structural genomics, 99.66
2poz_A392 Putative dehydratase; octamer, structural genomics 99.65
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.63
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.58
2o56_A407 Putative mandelate racemase; dehydratase, structur 99.54
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 99.52
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.49
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 99.46
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.46
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 99.44
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 99.39
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 99.39
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 99.37
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.36
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 99.36
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 99.34
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 99.33
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 99.33
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 99.33
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 99.32
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 99.32
2qgy_A391 Enolase from the environmental genome shotgun sequ 99.3
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.28
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 99.28
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 99.27
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.26
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.25
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 99.23
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 99.23
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 99.22
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 99.22
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 99.2
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.18
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.18
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 99.18
2oz8_A389 MLL7089 protein; structural genomics, unknown func 99.17
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 99.16
1tzz_A392 Hypothetical protein L1841; structural genomics, m 99.16
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 99.16
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.16
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 99.14
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 99.13
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 99.13
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 99.13
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 99.12
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.1
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 99.06
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.06
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 99.05
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 99.04
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 99.04
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 99.02
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 99.01
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 99.01
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 99.01
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 99.01
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.0
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 99.0
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 99.0
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 99.0
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 98.98
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 98.97
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 98.97
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 98.96
3eez_A378 Putative mandelate racemase/muconate lactonizing e 98.95
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 98.94
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 98.94
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.91
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 98.91
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 98.9
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 98.88
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 98.88
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 98.88
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 98.87
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 98.84
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 98.84
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 98.83
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 98.81
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 98.81
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.81
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.8
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 98.8
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 98.79
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 98.79
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 98.79
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.77
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 98.77
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 98.77
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.77
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.76
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 98.75
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 98.74
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 98.73
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 98.72
3r0u_A379 Enzyme of enolase superfamily; structural genomics 98.72
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 98.71
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 98.7
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 98.7
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 98.7
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 98.69
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 98.61
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.61
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 98.58
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 98.57
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 98.55
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.55
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 98.54
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 98.54
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 98.52
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.5
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 98.5
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 98.48
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.48
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.47
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 98.47
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 98.46
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 98.46
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 98.46
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.44
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 98.43
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 98.43
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 98.42
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.42
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 98.42
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 98.41
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 98.39
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.38
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.38
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.38
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 98.37
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.36
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 98.35
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.34
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 98.33
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 98.3
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 98.3
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.29
3va8_A445 Probable dehydratase; enolase, magnesium binding s 98.28
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 98.28
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 98.28
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.28
3v5c_A392 Mandelate racemase/muconate lactonizing protein; e 98.28
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 98.23
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 98.22
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.19
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.19
3oa3_A288 Aldolase; structural genomics, seattle structural 98.19
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 98.18
3ekg_A404 Mandelate racemase/muconate lactonizing enzyme; st 98.18
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 98.15
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 98.13
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 98.11
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 98.11
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 98.11
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.1
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 98.1
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 98.1
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 98.08
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.07
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.07
3fxg_A 455 Rhamnonate dehydratase; structural gemomics, enola 98.05
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 98.04
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 98.04
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 98.04
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 98.03
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 98.03
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 98.02
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 98.02
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 98.0
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 97.97
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 97.96
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 97.95
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 97.94
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.92
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 97.88
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.86
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.85
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 97.85
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 97.83
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 97.82
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.81
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 97.81
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.81
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 97.78
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 97.77
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 97.76
2p3z_A415 L-rhamnonate dehydratase; enolase, structural geno 97.75
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 97.75
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.75
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.71
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.68
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 97.68
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 97.66
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 97.66
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 97.64
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 97.63
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 97.61
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.6
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.56
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.56
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 97.55
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipe 97.54
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 97.54
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.53
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.51
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 97.49
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 97.47
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 97.46
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 97.44
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.39
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 97.37
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 97.37
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 97.37
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 97.34
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 97.33
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 97.31
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 97.28
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 97.25
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 97.25
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 97.16
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 97.15
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 97.15
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 97.14
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 97.12
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.08
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 97.07
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 97.07
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 97.02
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 96.95
3tha_A252 Tryptophan synthase alpha chain; structural genomi 96.9
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 96.9
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 96.86
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 96.85
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 96.83
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 96.79
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 96.73
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 96.71
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 96.7
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 96.69
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 96.67
1r6w_A322 OSB synthase, O-succinylbenzoate synthase, OSBS; e 96.67
1w6t_A444 Enolase; bacterial infection, surface protein, moo 96.65
2qr6_A 393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 96.65
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 96.65
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 96.59
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 96.51
3qn3_A417 Enolase; structural genomics, center for structura 96.5
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 96.49
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 96.49
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 96.46
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 96.43
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 96.39
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 96.38
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 96.38
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 96.37
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 96.37
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.36
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 96.33
3caw_A330 O-succinylbenzoate synthase; structural genomics, 96.25
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 96.23
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 96.22
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 96.18
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 96.15
3uj2_A449 Enolase 1; enzyme function initiative, EFI, lyase; 96.13
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 96.07
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 96.06
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-bindi 96.05
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 96.02
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.01
3qw3_A255 Orotidine-5-phosphate decarboxylase/orotate phosph 95.99
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 95.99
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 95.98
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 95.93
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 95.92
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.92
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 95.92
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 95.85
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 95.83
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 95.8
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 95.78
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 95.73
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 95.72
2fiq_A420 Putative tagatose 6-phosphate kinase 1; structural 95.72
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 95.72
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 95.71
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 95.7
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 95.66
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 95.64
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 95.62
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 95.59
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 95.58
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 95.57
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 95.56
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 95.55
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.55
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 95.52
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 95.48
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 95.45
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 95.44
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 95.43
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.42
3elf_A349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 95.42
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 95.4
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 95.36
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 95.32
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.22
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 95.18
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 95.16
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 95.13
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 95.09
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 95.06
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.05
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.99
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 94.98
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 94.97
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 94.95
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 94.95
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 94.88
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 94.85
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 94.84
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 94.74
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 94.72
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 94.69
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 94.69
4gfi_A329 Mandelate racemase/muconate lactonizing enzyme FA 94.68
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 94.68
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 94.67
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 94.64
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 94.47
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.4
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 94.38
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 94.32
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 94.24
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 94.2
3qw4_B 453 UMP synthase; N-terminal orotidine monophosphate d 94.19
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 94.11
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 94.06
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 94.04
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 94.03
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 93.91
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 93.79
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 93.77
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 93.77
3qm3_A357 Fructose-bisphosphate aldolase; structural genomic 93.72
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 93.71
1dos_A358 Aldolase class II; lyase, classii fructose 1,6-bis 93.69
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 93.59
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 93.5
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 93.47
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.45
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 93.44
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 93.38
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 93.29
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 93.26
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 93.26
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 93.24
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 93.2
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 93.2
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 93.19
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 93.16
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 93.15
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 93.15
3txv_A 450 Probable tagatose 6-phosphate kinase; structural g 93.11
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 93.05
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 93.03
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 93.02
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 92.99
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 92.91
2hmc_A 344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 92.79
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 92.76
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 92.7
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 92.61
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 92.59
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 92.51
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 92.48
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 92.42
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 92.35
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 92.24
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.14
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 91.95
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 91.93
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 91.91
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 91.91
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 91.87
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 91.86
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 91.73
1ypf_A 336 GMP reductase; GUAC, purines, pyrimidines, nucleos 91.72
2ffc_A353 Orotidine 5-monophosphate decarboxylase; PV-PF10_0 91.71
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 91.64
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 91.64
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 91.62
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 91.61
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 91.59
3no5_A275 Uncharacterized protein; PFAM DUF849 domain contai 91.54
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 91.51
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 91.48
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 91.45
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 91.21
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 91.17
2wqp_A 349 Polysialic acid capsule biosynthesis protein SIAC; 91.17
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 91.0
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 90.91
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 90.87
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 90.86
1aj0_A 282 DHPS, dihydropteroate synthase; antibiotic, resist 90.49
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 90.47
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 90.42
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 90.41
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 90.35
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 90.25
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 90.24
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 90.17
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 90.17
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 89.91
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 89.83
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 89.77
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 89.58
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 89.53
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 89.36
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 89.36
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 89.27
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 89.24
3ble_A337 Citramalate synthase from leptospira interrogans; 88.94
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 88.86
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 88.69
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 88.55
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 88.37
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 88.36
2c6q_A 351 GMP reductase 2; TIM barrel, metal-binding, NADP, 88.29
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 88.17
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 88.16
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 88.11
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 87.9
1tx2_A 297 DHPS, dihydropteroate synthase; folate biosynthesi 87.88
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 87.72
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 87.37
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 87.17
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 86.79
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 86.78
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 86.69
2xz9_A324 Phosphoenolpyruvate-protein kinase (PTS system EI 86.45
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 86.36
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 86.28
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 86.28
3n3m_A342 Orotidine 5'-phosphate decarboxylase; P. falciparu 86.26
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 86.22
2vef_A 314 Dihydropteroate synthase; antibiotic resistance, t 86.17
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 86.15
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 86.13
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 86.09
4hb7_A 270 Dihydropteroate synthase; transferase; 1.95A {Stap 86.0
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 85.92
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 85.9
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 85.89
3chv_A284 Prokaryotic domain of unknown function (DUF849) W 85.36
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 85.25
3ble_A337 Citramalate synthase from leptospira interrogans; 85.22
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 85.03
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 85.0
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 84.95
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 84.71
3g8r_A 350 Probable spore coat polysaccharide biosynthesis P; 84.53
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 84.51
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 84.25
1eye_A 280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 84.22
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 83.96
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 83.77
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 83.63
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
Probab=100.00  E-value=1.6e-92  Score=703.24  Aligned_cols=355  Identities=40%  Similarity=0.703  Sum_probs=317.9

Q ss_pred             CccCCCccccCCeeeCCceeeCCCCCCCC-CCCCCCHHHHHHHHhhcCCCcEEEEcccccCCCCCCCCCCCCCCCHHHHh
Q 015862           29 VILFLTPYKMGNFNLSHRVVLAPLTRQRS-YNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVE  107 (399)
Q Consensus        29 ~~~Lf~P~~ig~~~lkNRiv~apm~~~~~-~~G~~t~~~~~~y~~~a~g~Glii~e~~~V~~~g~~~~~~~~l~~d~~i~  107 (399)
                      |++||+|++||+++|||||||+||+++++ .||.||+.+++||++||+ +||||+|++.|++.|+..++++++|+|++++
T Consensus         1 Mp~LF~P~~ig~~~lkNRiv~apm~~~~a~~dg~~t~~~~~~y~~rA~-gGliite~~~V~~~g~~~~~~~gi~~d~~i~   79 (358)
T 4a3u_A            1 MPSLFDPIRFGAFTAKNRIWMAPLTRGRATRDHVPTEIMAEYYAQRAS-AGLIISEATGISQEGLGWPYAPGIWSDAQVE   79 (358)
T ss_dssp             -CCTTSCEEETTEEESCSEEECCCCCCCSCTTCCCCHHHHHHHHHTTT-SSSEEEEEEESSTTTCCSTTCCBCSSHHHHH
T ss_pred             CCCCCCCceECCEEECCceEEcccCCCccCCCCCCCHHHHHHHHHHcC-CCEEEEeeeEECccccCCCCCcccCchHhHH
Confidence            37899999999999999999999999988 899999999999999995 7999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHcCCeEEEecccCCCccCCCCCCCCCCCcccCCCCCCccc-ccCCCcccCCCCCCCCChhHHHHHHHHHH
Q 015862          108 AWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQI-RANGVDVAQFTPPRRLRTDEIPQIVNDFR  186 (399)
Q Consensus       108 ~~~~l~~~vh~~g~~i~~QL~H~Gr~~~~~~~~~~~~~~aps~~~~~~~~-~~~g~~~~~~~~p~~mt~~eI~~ii~~f~  186 (399)
                      +||+++++||++|+++++||+|+||++.+..  .+..+++||+++..... ...+.  .+...|++||.+||+++|++|+
T Consensus        80 ~~k~l~~avh~~G~~i~~QL~H~Gr~~~~~~--~g~~~~apS~~~~~~~~~~~~~~--~~~~~pr~mt~~eI~~ii~~F~  155 (358)
T 4a3u_A           80 AWLPITQAVHDAGGLIFAQLWHMGRMVPSNV--SGMQPVAPSASQAPGLGHTYDGK--KPYDVARALRLDEIPRLLDDYE  155 (358)
T ss_dssp             HHHHHHHHHHHTTCCEEEEEECCGGGCCHHH--HSSCCEESSCEECSSEEECSSSE--EECCEEEECCGGGHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCceeeccccccccccccc--cccCCCCCcccccCCcccccCCC--CCCccCccCCHHHHHHHHHHHH
Confidence            9999999999999999999999999986543  45678999987654211 01110  1245689999999999999999


Q ss_pred             HHHHHHHHhCCCEEEEccccchhhhhcccCcccCCCCCCCCchhhhhHHHHHHHHHHHHHhCCCceEEEecCCcccCCCC
Q 015862          187 LAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESG  266 (399)
Q Consensus       187 ~aA~~a~~aGfDgVeIh~~~GyLl~qFlSp~~N~R~D~yGGslenR~r~~~eii~avR~~vg~~~v~vrls~~~~~~~~~  266 (399)
                      +||++|++|||||||||++|||||+|||||.+|+|||+||||+|||+||++|||++||++||+++|+||||+++...+..
T Consensus       156 ~AA~rA~~AGFDgVEIH~ahGYLl~QFLSp~tN~RtDeYGGS~eNR~Rf~~Eii~avr~~vg~~~v~vRls~~~~~~g~~  235 (358)
T 4a3u_A          156 KAARHALKAGFDGVQIHAANGYLIDEFIRDSTNHRHDEYGGAVENRIRLLKDVTERVIATIGKERTAVRLSPNGEIQGTV  235 (358)
T ss_dssp             HHHHHHHHTTCSEEEEEECTTSHHHHHHSTTTCCCCSTTSSSHHHHTHHHHHHHHHHHHHHCGGGEEEEECCSSCBTTBC
T ss_pred             HHHHHHHHcCCCeEeecccCCCcHHhceecccCCeeCCCCCCHHHHHHHHHHHHHHHHHHcCccceEEEeccCcccCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999889999999977666555


Q ss_pred             CCChHHHHHHHHHhhhhhCceEEEEeCCCcccccccCCCchhhHHHHhhcCCcEEEeCCCCHHHHHHHHHcCCCcEEEec
Q 015862          267 DSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYG  346 (399)
Q Consensus       267 ~~~~~~~~~~l~~~Le~~Gvd~l~v~~~~~~~~~~~~~~~~~~~~ir~~~~~pvi~~Ggit~~~a~~~L~~G~~D~V~~g  346 (399)
                      ..++.++.+.+++.+++.|+++++++.+.............+++.+|+.+..||+++|.+|++.|+++|++|.||+|+||
T Consensus       236 ~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~a~~ik~~~~~~v~~~g~~~~~~ae~~l~~G~aD~V~~g  315 (358)
T 4a3u_A          236 DSHPEQVFIPAAKMLSDLDIAFLGMREGAVDGTFGKTDQPKLSPEIRKVFKPPLVLNQDYTFETAQAALDSGVADAISFG  315 (358)
T ss_dssp             CSSTHHHHHHHHHHHHHHTCSEEEEECCBTTCSSSBCSSCCCHHHHHHHCCSCEEEESSCCHHHHHHHHHHTSCSEEEES
T ss_pred             ccchHHHHHHHHHhhhccCccccccccccccCcccccccHHHHHHHHHhcCCcEEEeCCCCHHHHHHHHHcCCceEeHhh
Confidence            55667778899999999999999999887654444445567889999999999988877799999999999999999999


Q ss_pred             hHHhhCCcHHHHHHhCCCCCCCCcccccccCCCCCccccCCCC
Q 015862          347 RLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLN  389 (399)
Q Consensus       347 R~~iadPdl~~k~~~g~~~~~~~~~~~~~~~~~~g~~~~~~~~  389 (399)
                      |++|+|||||+|+++|+|++++++.+||+ ....||+|||++.
T Consensus       316 R~~ladPdlp~k~~~g~pl~~~~~~t~y~-~~~~GY~dyp~~~  357 (358)
T 4a3u_A          316 RPFIGNPDLPRRFFEKAPLTKDVIETWYT-QTPKGYTDYPLLG  357 (358)
T ss_dssp             HHHHHCTTHHHHHHHTCCCCCCCGGGSSC-SSSTTTTCSCCC-
T ss_pred             HHHHhChhHHHHHHhCCCCCCCchhcCCC-CCCCCcCCCCCCC
Confidence            99999999999999999999999999998 6779999999985
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3v5c_A Mandelate racemase/muconate lactonizing protein; enolase fold, galacturonate dehydratase, double Mg site, LYA; 1.53A {Paenibacillus SP} PDB: 3v5f_A* 3p3b_A* 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3ekg_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, nysgrc, L-rhamnonate dehydratase,target PSI-2; HET: TLA; 1.60A {Azotobacter vinelandii avop} PDB: 2oz3_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2p3z_A L-rhamnonate dehydratase; enolase, structural genomics, PSI, protein structure initiat YORK structural genomics research consortium; 1.80A {Salmonella typhimurium LT2} PDB: 3box_A 3cxo_A* 2gsh_A 3d47_A 3d46_A 2i5q_A Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>1r6w_A OSB synthase, O-succinylbenzoate synthase, OSBS; enolase superfamily, TIM barrel, capping alpha+beta domain, lyase; HET: 164; 1.62A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 PDB: 1fhv_A* 1fhu_A 2ofj_A 3gc2_A* Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>3caw_A O-succinylbenzoate synthase; structural genomics, PSI-2, NYSGXRC, target 9462A, protein structure initiative; 1.87A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>4gfi_A Mandelate racemase/muconate lactonizing enzyme FA protein; putative L-Ala-L/D-Glu epimerase; HET: GLU; 1.90A {Agrobacterium tumefaciens} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3qm3_A Fructose-bisphosphate aldolase; structural genomics, center for structural genomics of infec diseases, csgid, TIM beta/alpha-barrel, lyase; 1.85A {Campylobacter jejuni} SCOP: c.1.10.2 Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2xz9_A Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria); thermophilic, PEP-utilising enzyme, transferase; 1.68A {Thermoanaerobacter tengcongensis} PDB: 2bg5_A 2xz7_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3n3m_A Orotidine 5'-phosphate decarboxylase; P. falciparum, 5'-monophosphate decarboxylase, 6- UMP, lyase; HET: PGE NUP; 1.47A {Plasmodium falciparum} SCOP: c.1.2.3 PDB: 2qaf_A* 3bar_A* 2q8z_A* 3mwa_A* 3n2m_A* 3bpw_A* 3n34_A* 3s9y_A* 2f84_A 2q8l_A 2za1_A* 2za2_A 2za3_A* 2zcg_A 3vi2_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 399
d1icpa_364 c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, O 1e-112
d1q45a_380 c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, O 5e-95
d1gwja_374 c.1.4.1 (A:) Morphinone reductase {Pseudomonas put 2e-91
d1vyra_363 c.1.4.1 (A:) Pentaerythritol tetranirate reductase 2e-85
d1oyaa_399 c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast 5e-80
d1z41a1337 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacill 4e-61
d1ps9a1330 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-ter 3e-57
d1djqa1340 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N- 3e-46
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Length = 364 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: 12-oxophytodienoate reductase (OPR, OYE homolog)
species: Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]

 Score =  331 bits (850), Expect = e-112
 Identities = 282/358 (78%), Positives = 319/358 (89%), Gaps = 1/358 (0%)

Query: 31  LFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNT 90
           L  +P KMG F L HRVVLAPLTRQRSY  +PQPHAIL+YSQR+T GG LI EAT +S T
Sbjct: 7   LM-SPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISET 65

Query: 91  AQGNPNTPSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTD 150
             G  + P IWTKEQVEAWKPIVDAVHAKGGIFFCQI HVGRVSN+D+QPNG+ PISCTD
Sbjct: 66  GIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTD 125

Query: 151 KPLTPQIRANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLI 210
           + LTPQI +NG+D+A FT PRRL TDEIPQIVN+FR+AARNAIEAGFDGVE+HGAHGYLI
Sbjct: 126 RGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLI 185

Query: 211 DQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNP 270
           DQF+KDQVNDR+D+YGGSLENRCRFALEIVEAV+NEIG+DRVGIR+SPFA+Y E+GD+NP
Sbjct: 186 DQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNP 245

Query: 271 EALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDRED 330
            ALGLYM ESLNKY + YCH+VEPRMKT  EK EC  SL+PMRKA+KGTF+VAGGYDRED
Sbjct: 246 TALGLYMVESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMRKAYKGTFIVAGGYDRED 305

Query: 331 GNKAIAEGRADLVVYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFL 388
           GN+A+ E RADLV YGRLF++NPDLP+RFELNAPLNKYNR+TFYTSDP+VGYTDYPFL
Sbjct: 306 GNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFL 363
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Length = 380 Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Length = 374 Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Length = 363 Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Length = 399 Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Length = 337 Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 340 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 100.0
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 100.0
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 100.0
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 100.0
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 100.0
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 100.0
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 99.9
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.7
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 99.63
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.31
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 99.22
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 99.2
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 99.16
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 99.16
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 99.12
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 98.84
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 98.79
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 98.74
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 98.65
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 98.64
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 98.56
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 98.55
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 98.54
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 98.51
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.42
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 98.42
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 98.4
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 98.32
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 98.27
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 98.23
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.21
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 98.18
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 98.12
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 98.12
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 98.08
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 97.99
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 97.96
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.91
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 97.88
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 97.81
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.8
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 97.76
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 97.69
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 97.65
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 97.63
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 97.6
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.59
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.57
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 97.56
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 97.44
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 97.36
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 97.36
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 97.36
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 97.31
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 97.28
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 97.23
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 97.11
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 97.1
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 97.06
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 97.04
d1ofda2809 Alpha subunit of glutamate synthase, central and F 96.97
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 96.95
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.85
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 96.75
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 96.71
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 96.62
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 96.58
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 96.57
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 96.55
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 96.51
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 96.48
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.48
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 96.47
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 96.39
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 96.37
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 96.27
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 96.09
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 95.81
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 95.63
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 95.54
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 95.53
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 95.45
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.43
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 95.4
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 95.22
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 95.22
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 95.18
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 95.17
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 95.14
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 95.08
d1r6wa1221 O-succinylbenzoate synthase {Escherichia coli [Tax 95.02
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 94.57
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 94.54
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 94.51
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 94.28
d1vqta1198 Orotidine 5'-monophosphate decarboxylase (OMP deca 94.22
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 94.2
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 94.07
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 93.85
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 93.85
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 93.82
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 93.78
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 93.77
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 93.74
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 93.7
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 93.7
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 93.69
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 93.62
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 93.58
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 93.41
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 93.22
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 93.19
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 93.03
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 93.03
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 92.84
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 92.62
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 92.53
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 92.31
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 92.2
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 92.08
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 92.05
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 91.84
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 91.51
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 91.46
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 91.43
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 91.33
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 91.0
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 90.84
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 90.64
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 90.44
d1ad1a_ 264 Dihydropteroate synthetase {Staphylococcus aureus 90.31
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 90.29
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 89.93
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 89.87
d1eyea_ 270 Dihydropteroate synthetase {Mycobacterium tubercul 89.82
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 89.59
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 89.46
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 89.33
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 89.22
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 88.0
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 87.87
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 87.07
d1ajza_ 282 Dihydropteroate synthetase {Escherichia coli [TaxI 86.85
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 86.22
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 86.21
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 86.08
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 85.83
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 85.81
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 85.47
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 84.88
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 84.14
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 83.73
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 83.12
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 83.01
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 82.13
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 81.88
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Morphinone reductase
species: Pseudomonas putida [TaxId: 303]

Probab=100.00  E-value=2.9e-88  Score=674.17  Aligned_cols=364  Identities=44%  Similarity=0.727  Sum_probs=321.4

Q ss_pred             CccCCCccccCCeeeCCceeeCCCCCCCCCCCCCCHHHHHHHHhhcCCCcEEEEcccccCCCCCCCCCCCCCCCHHHHhh
Q 015862           29 VILFLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHAILYYSQRTTKGGFLIAEATGVSNTAQGNPNTPSIWTKEQVEA  108 (399)
Q Consensus        29 ~~~Lf~P~~ig~~~lkNRiv~apm~~~~~~~G~~t~~~~~~y~~~a~g~Glii~e~~~V~~~g~~~~~~~~l~~d~~i~~  108 (399)
                      +++||+|++||+++|||||+|+||+++++.||.||+.+++||++||+ +||||+|.++|++.++..++++++|+|+++++
T Consensus         5 ~P~LF~Pl~Ig~~~lkNRiv~apm~~~~~~dg~~t~~~~~yy~~rA~-gGlii~e~~~V~~~~~~~~~~~~i~~d~~i~~   83 (374)
T d1gwja_           5 NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRAS-AGLIISEATNISPTARGYVYTPGIWTDAQEAG   83 (374)
T ss_dssp             CCCTTSCEEETTEEESCSEEECCCCCCCCSSSCCCHHHHHHHHHTTT-SSEEEEEEEESSGGGCCBTTCCBCSSHHHHHH
T ss_pred             cCCCCCCeeECCEEECCCeEEcccCCCCCCCCCCCHHHHHHHHHHhC-CCEEEEEeEEECCccCCCCCCCccchhhhhhh
Confidence            47999999999999999999999998888889999999999999996 78999999999999999999999999999999


Q ss_pred             hHHHHHHHHHcCCeEEEecccCCCccCCCCCCCCCCCcccCCCCCCccccc----CCC-cccCCCCCCCCChhHHHHHHH
Q 015862          109 WKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQIRA----NGV-DVAQFTPPRRLRTDEIPQIVN  183 (399)
Q Consensus       109 ~~~l~~~vh~~g~~i~~QL~H~Gr~~~~~~~~~~~~~~aps~~~~~~~~~~----~g~-~~~~~~~p~~mt~~eI~~ii~  183 (399)
                      ||+++++||++|+++++||+|+||++.....+.+..+++||+++.......    .+. ...+..+|++||.+||++||+
T Consensus        84 ~k~l~~~vh~~G~~i~~QL~H~Gr~~~~~~~~~g~~~~~ps~~~~~~~~~~~~~~~~~~~~~~~~~p~~mt~~eI~~ii~  163 (374)
T d1gwja_          84 WKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDGIPGIVE  163 (374)
T ss_dssp             HHHHHHHHHHTTCCEEEEEECCTTSCCTTTSGGGCCCEESSSCCCTTCEEEEECTTSCEEEEECCCCEECCGGGHHHHHH
T ss_pred             hhhHHHHHhccCcceEeeeeccCcccccccCCCCCceeccccccccCccccccccccccccCCCCCccccCHHHHHHHHH
Confidence            999999999999999999999999987665545677899998765421100    000 001245789999999999999


Q ss_pred             HHHHHHHHHHHhCCCEEEEccccchhhhhcccCcccCCCCCCCCchhhhhHHHHHHHHHHHHHhCCCceEEEecCCcccC
Q 015862          184 DFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYM  263 (399)
Q Consensus       184 ~f~~aA~~a~~aGfDgVeIh~~~GyLl~qFlSp~~N~R~D~yGGslenR~r~~~eii~avR~~vg~~~v~vrls~~~~~~  263 (399)
                      +|++||+||++|||||||||++|||||+|||||.+|+|||+||||+|||+||++|||++||++||++.|++|+++.++..
T Consensus       164 ~f~~AA~rA~~AGfDgVEIH~ahGYLl~qFLSp~~N~RtDeYGGSlENR~Rf~~EIi~aIR~~vg~~~v~~r~~~~~~~~  243 (374)
T d1gwja_         164 DYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELF  243 (374)
T ss_dssp             HHHHHHHHHHHTTCSEEEEEECTTCHHHHHHSTTTCCCCSTTSSSHHHHTHHHHHHHHHHHHHHCGGGEEEEECTTCCCT
T ss_pred             HHHHHHHHHHHhCCCEEEeccchhhhHHHHHHhhcCccccccccchhhhhhhHHHHHHHHHHHcCCcceeeeeeeecccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999888999999876666


Q ss_pred             CCCCCChHHHHHHHHHhhhhhCceEEEEeCCCcccccccCCCchhhHHHHhhcCCcEEEeCCCCHHHHHHHHHcCCCcEE
Q 015862          264 ESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLV  343 (399)
Q Consensus       264 ~~~~~~~~~~~~~l~~~Le~~Gvd~l~v~~~~~~~~~~~~~~~~~~~~ir~~~~~pvi~~Ggit~~~a~~~L~~G~~D~V  343 (399)
                      +....++...+..++..|+..|+++++++.+.+..... .....+++.+|+.+++||+++|+++++.|+++|++|.||+|
T Consensus       244 g~~~~~~~~~~~~~~~~ld~~~i~~~~~~~~~~~~~~~-~~~~~~~~~i~~~~~~pvi~~G~i~~~~ae~~l~~g~aDlV  322 (374)
T d1gwja_         244 GLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDWIGGDI-TYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAV  322 (374)
T ss_dssp             TCCCSCHHHHHHHHHHHHHHHTCSEEEEECSCBTTBCC-CCCTTHHHHHHHHCCSEEEEESSCCHHHHHHHHHTTSCSEE
T ss_pred             CCcccchHHHHHHhhccccccCceEEEeccCcccCCCc-chhHHHHHHHHHHcCCCEEEECCcCHHHHHHHHHcCCCcEe
Confidence            65556667777888999999999999998876432211 12234788899999999999999999999999999999999


Q ss_pred             EechHHhhCCcHHHHHHhCCCCCCCCcccccccCCCCCccccCCCCcccccc
Q 015862          344 VYGRLFLANPDLPRRFELNAPLNKYNRETFYTSDPVVGYTDYPFLNTSSLVT  395 (399)
Q Consensus       344 ~~gR~~iadPdl~~k~~~g~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~  395 (399)
                      +|||++|+|||||+|+++|++++++++.+||. ....||+|||++...|-.+
T Consensus       323 ~~gR~~iadPd~~~K~~~G~~l~~~~~~~~~~-~~~~g~~~~p~~~~~~~~~  373 (374)
T d1gwja_         323 AFGRPFIANPDLPERFRLGAALNEPDPSTFYG-GAEVGYTDYPFLDNGHDRL  373 (374)
T ss_dssp             EESHHHHHCTTHHHHHHHTCCCCCCCGGGSSS-SSSTTTTCCCCCCCSSCCC
T ss_pred             hhhHHHHHCccHHHHHHcCCCCCCCChhhccC-CCCCCcCCCCCcchhhhhc
Confidence            99999999999999999999999999999999 6789999999998876543
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure