Citrus Sinensis ID: 015869
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 399 | ||||||
| 255544149 | 424 | conserved hypothetical protein [Ricinus | 0.984 | 0.926 | 0.769 | 1e-177 | |
| 224095202 | 430 | predicted protein [Populus trichocarpa] | 0.962 | 0.893 | 0.789 | 1e-175 | |
| 15231007 | 425 | uncharacterized protein [Arabidopsis tha | 0.959 | 0.901 | 0.744 | 1e-166 | |
| 11994774 | 450 | unnamed protein product [Arabidopsis tha | 0.959 | 0.851 | 0.744 | 1e-166 | |
| 110743422 | 412 | hypothetical protein [Arabidopsis thalia | 0.947 | 0.917 | 0.753 | 1e-166 | |
| 297830676 | 425 | binding protein [Arabidopsis lyrata subs | 0.959 | 0.901 | 0.744 | 1e-165 | |
| 225463770 | 426 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.896 | 0.762 | 1e-162 | |
| 225463772 | 426 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.896 | 0.757 | 1e-161 | |
| 449464960 | 423 | PREDICTED: uncharacterized protein LOC10 | 0.944 | 0.891 | 0.720 | 1e-161 | |
| 388504458 | 428 | unknown [Medicago truncatula] | 0.962 | 0.897 | 0.697 | 1e-160 |
| >gi|255544149|ref|XP_002513137.1| conserved hypothetical protein [Ricinus communis] gi|223548148|gb|EEF49640.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 627 bits (1616), Expect = e-177, Method: Compositional matrix adjust.
Identities = 307/399 (76%), Positives = 350/399 (87%), Gaps = 6/399 (1%)
Query: 1 MPSQQGNINNDYLETLVASARPFLRGELEAIDKNLPSLIAVLRSVGAGECWHKHGSFLEH 60
MPS ++YL+TL+AS RPFLRGELE++DKNLP+LI+VLRSVGAGECWHKHGSFL+H
Sbjct: 1 MPSSLHQETSNYLQTLLASTRPFLRGELESVDKNLPALISVLRSVGAGECWHKHGSFLDH 60
Query: 61 LVDIYRILKIWKAPDCVCLCGLFHSAYSNSYVNLAIFDPNTGRDVVRGHVGDAAEKLIHL 120
LVDIYRILKIW A D VCLCGLFHSAYSNSYVNLAIFDPNTGRDVVRGHVG AAE+LIHL
Sbjct: 61 LVDIYRILKIWNASDSVCLCGLFHSAYSNSYVNLAIFDPNTGRDVVRGHVGPAAERLIHL 120
Query: 121 FCIVPRQPLIHDDLLFEYSDQELVEHLKASDVSLINAKEKGLFNAEEAWRKKINELLPAD 180
FCIVPRQPLIHDDLLF YSD ELV+HL S++SL NAKEKG+F+AE++WRKKIN LLPA
Sbjct: 121 FCIVPRQPLIHDDLLFNYSDSELVQHLLLSEISLKNAKEKGVFDAEDSWRKKINSLLPAA 180
Query: 181 GLTVKHIKTGEDVGVSRRVVATFVMLTIADFSDQLFGFQDFLFNNSDGKLEFAGNSFSAL 240
G+TVK IKTGEDV V+RR+VA FVM+T+ADFSDQLF FQD LF+NSDG+LEF+GN+ ++L
Sbjct: 181 GITVKRIKTGEDVLVTRRIVAVFVMMTMADFSDQLFSFQDLLFDNSDGRLEFSGNNLASL 240
Query: 241 WPGDGKPGLWMNSLSRMGAIYSLIAREEEIFIQERKTSAAAVGVGVDKERDEDIELPVPP 300
WPGDGKPGLW+NS+SRMGAIY+LI REEEIF++ER A G+ VD+ERDEDIEL VPP
Sbjct: 241 WPGDGKPGLWINSISRMGAIYTLIRREEEIFVEER---IRAGGIEVDEERDEDIELVVPP 297
Query: 301 VFENCTRILDAKEQIEARDLYWEAVCGNSDGSKEKLEKAEELLLRCIEKNPFVGEPHVVL 360
VF+ CTRILDA++QIEARDLYWEAVC D SK L+K EELLL CIEKNP+VGEPHVVL
Sbjct: 298 VFDKCTRILDARQQIEARDLYWEAVC---DLSKRGLDKVEELLLSCIEKNPYVGEPHVVL 354
Query: 361 GQIYLAKGEFEEAEREAGKGLMLLLEWGSPWDKRMSWEG 399
Q+YL K FEEAEREA KG+ L+LEWGSPWDKR SWEG
Sbjct: 355 SQVYLTKDRFEEAEREAEKGVTLMLEWGSPWDKRTSWEG 393
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224095202|ref|XP_002310360.1| predicted protein [Populus trichocarpa] gi|222853263|gb|EEE90810.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15231007|ref|NP_188633.1| uncharacterized protein [Arabidopsis thaliana] gi|63003792|gb|AAY25425.1| At3g19990 [Arabidopsis thaliana] gi|111074436|gb|ABH04591.1| At3g19990 [Arabidopsis thaliana] gi|332642795|gb|AEE76316.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|11994774|dbj|BAB03164.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|110743422|dbj|BAE99597.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297830676|ref|XP_002883220.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329060|gb|EFH59479.1| binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225463770|ref|XP_002268202.1| PREDICTED: uncharacterized protein LOC100257837 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225463772|ref|XP_002268460.1| PREDICTED: uncharacterized protein LOC100252690 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449464960|ref|XP_004150197.1| PREDICTED: uncharacterized protein LOC101221411 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388504458|gb|AFK40295.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 399 | ||||||
| TAIR|locus:2095350 | 425 | AT3G19990 "AT3G19990" [Arabido | 0.959 | 0.901 | 0.718 | 5.2e-152 |
| TAIR|locus:2095350 AT3G19990 "AT3G19990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1483 (527.1 bits), Expect = 5.2e-152, P = 5.2e-152
Identities = 278/387 (71%), Positives = 325/387 (83%)
Query: 14 ETLVASARPFLRGELEAIDKNLPSLIAVLRSVGAGECWHKHGSFLEHLVDIYRILKIWKA 73
+ ++ SARPFLRGELE ID LPSLIAVL+SVGAGECWHKHGSFL+HL+DIY+ILK+WKA
Sbjct: 11 DAVLESARPFLRGELEKIDPKLPSLIAVLKSVGAGECWHKHGSFLDHLIDIYKILKLWKA 70
Query: 74 PDCVCLCGLFHSAYSNSYVNLAIFDPNTGRDVVRGHVGDAAEKLIHLFCIVPRQPLIHDD 133
P+ VCLCGLFHSAYSNSYVNLAIFDP+TGRDVVR HVG+AAE LIHLFC+VPRQ LIHD+
Sbjct: 71 PESVCLCGLFHSAYSNSYVNLAIFDPSTGRDVVRDHVGEAAESLIHLFCVVPRQTLIHDE 130
Query: 134 LLFEYSDQELVEHLKASDVSLINAKEKGLFNAEEAWRKKINELLPADGLTVKHIKTGEDV 193
LLF+YSD ELVEHL S+VSL NAKEKG+F+ +E WRKKIN L+P +G+ VKHIKTGE++
Sbjct: 131 LLFKYSDCELVEHLDCSEVSLRNAKEKGIFDGDEEWRKKINALVPENGVVVKHIKTGEEI 190
Query: 194 GVSRRVVATFVMLTIADFSDQLFGFQDFLFNNSDGKLEFAGNSFSALWPGDGKPGLWMNS 253
VSRRVV F+++T+ADFSDQLFGFQD LF N DG+LEF GN+ +ALWPG+GKPGLWMNS
Sbjct: 191 VVSRRVVGVFLLMTMADFSDQLFGFQDELFCNHDGRLEFRGNNVTALWPGNGKPGLWMNS 250
Query: 254 LSRMGAIYSLIAREEEIFIQERKTSAAAVGVGVDKERDEDIELPVPPVFENCTRILDAKE 313
SRMGAIYSLI REEEI ++ER+ + + G V KERDEDI+L VPPVF CT++LDAKE
Sbjct: 251 NSRMGAIYSLIVREEEILMEERRRAFGS-GFEVRKERDEDIDLVVPPVFSFCTKVLDAKE 309
Query: 314 QIEARDLYWEAVCGNSDGSXXXXXXXXXXXXR-CIEKNPFVGEPHVVLGQIYLAKGEFEE 372
QIEAR++YWE V +SD S CIEKNPFVGEPHV+L Q+YL K F+E
Sbjct: 310 QIEAREMYWEVV--SSDTSKEGYLERAEERLLGCIEKNPFVGEPHVLLSQVYLGKKRFKE 367
Query: 373 AEREAGKGLMLLLEWGSPWDKRMSWEG 399
AEREA KGL+LLL+WGSPWDKRMSWEG
Sbjct: 368 AEREAEKGLLLLLQWGSPWDKRMSWEG 394
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.320 0.138 0.426 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 399 387 0.00093 117 3 11 22 0.40 34
34 0.45 37
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 622 (66 KB)
Total size of DFA: 273 KB (2143 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:02
No. of threads or processors used: 24
Search cpu time: 31.12u 0.08s 31.20t Elapsed: 00:00:10
Total cpu time: 31.12u 0.08s 31.20t Elapsed: 00:00:14
Start: Thu May 9 18:01:45 2013 End: Thu May 9 18:01:59 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00071331 | hypothetical protein (431 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 399 | |||
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 0.002 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 37.4 bits (87), Expect = 0.002
Identities = 14/55 (25%), Positives = 24/55 (43%)
Query: 327 GNSDGSKEKLEKAEELLLRCIEKNPFVGEPHVVLGQIYLAKGEFEEAEREAGKGL 381
GN ++A E + +E +P + + L Y G++EEA + K L
Sbjct: 7 GNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKAL 61
|
Length = 100 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 399 | |||
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.68 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.58 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.46 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 96.08 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 95.15 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.05 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 94.96 | |
| PF13328 | 153 | HD_4: HD domain; PDB: 3NR1_B. | 94.94 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 94.88 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 94.72 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 94.42 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 94.3 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 94.22 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.14 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 94.1 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 94.05 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 93.91 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 93.73 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.28 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 93.27 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 93.06 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 93.03 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 92.77 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 92.6 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 92.07 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 91.79 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 91.4 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 91.2 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 90.75 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 90.69 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 90.45 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 90.25 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 89.74 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 89.55 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 89.14 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 88.89 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 88.62 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 88.56 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 88.36 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 88.21 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 87.68 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 87.33 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 86.99 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 86.76 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 86.7 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 86.59 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 86.59 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 86.17 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 86.13 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 85.67 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 85.11 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 84.05 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 83.9 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 83.38 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 83.22 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 83.12 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 83.01 | |
| TIGR03276 | 179 | Phn-HD phosphonate degradation operons associated | 82.74 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 82.32 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 82.16 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 81.65 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 81.07 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 80.93 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 80.56 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 80.5 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 80.13 |
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
Probab=96.68 E-value=0.0038 Score=45.86 Aligned_cols=50 Identities=22% Similarity=0.351 Sum_probs=44.9
Q ss_pred hhHHHHHHHHHHHHhhCCCcCchHHHHHHHHhccCCcHHHHHHHHHHHHH
Q 015869 334 EKLEKAEELLLRCIEKNPFVGEPHVVLGQIYLAKGEFEEAEREAGKGLML 383 (399)
Q Consensus 334 ~~~d~a~~lL~~~i~~NP~VgEP~~vLAQ~~l~~gr~~eA~~~A~~gL~l 383 (399)
...+.|++.++++++.+|-..+=+..||++|...|++++|...-++++++
T Consensus 11 g~~~~A~~~~~~~l~~~P~~~~a~~~lg~~~~~~g~~~~A~~~~~~a~~~ 60 (65)
T PF13432_consen 11 GDYDEAIAAFEQALKQDPDNPEAWYLLGRILYQQGRYDEALAYYERALEL 60 (65)
T ss_dssp THHHHHHHHHHHHHCCSTTHHHHHHHHHHHHHHTT-HHHHHHHHHHHHHH
T ss_pred CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHH
Confidence 34889999999999999999999999999999999999999888877764
|
|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13328 HD_4: HD domain; PDB: 3NR1_B | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03276 Phn-HD phosphonate degradation operons associated HDIG domain protein | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 399 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-04 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-04 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 7e-04 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 8e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 48.7 bits (115), Expect = 3e-06
Identities = 67/398 (16%), Positives = 128/398 (32%), Gaps = 138/398 (34%)
Query: 11 DYLETLVASA---RPF-LRGELEAIDKNLPSLIAVLRSVGAGECWHKHGSFLEHLVDIYR 66
D +++L+ RP L E+ + S+IA G W +H V+ +
Sbjct: 301 DEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLAT-W----DNWKH-VNCDK 354
Query: 67 ILKIWKAPDCVCLCGLFHSAYSNSYVNLAIFDPNTG----------RDVVRGHVGDAAEK 116
+ I ++ L L + Y + L++F P+ DV++ V K
Sbjct: 355 LTTIIES----SLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNK 410
Query: 117 LIHLFCIVPRQPL-----IHDDLLFEYSDQELVEHLKASDVSLINAKEKGLFNAEEAWRK 171
L H + +V +QP I + E + +E+ A S+++ +N + +
Sbjct: 411 L-HKYSLVEKQPKESTISIP-SIYLELKVK--LENEYALHRSIVDH-----YNIPKTFDS 461
Query: 172 KINELLPADGLTVKHI-------KTGEDVGVSRRVVATFVMLTIADFSDQLFGFQDFLFN 224
D HI + E + + R V F DF F
Sbjct: 462 DDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV------------------FLDFRF- 502
Query: 225 NSDGKLEFAGNSFSALWPGDGKPGLWMNSLSRMGAIYSLIAREEEIFIQERKTSAAAVGV 284
+ K+ +++A G +N+L ++ Y + +I +
Sbjct: 503 -LEQKIRHDSTAWNA-------SGSILNTLQQL-KFY-------KPYICDND-------- 538
Query: 285 GVDKERDEDIELPVPPVFENCTRILDAKEQIEARDLYWEAVCGNSDGSKEKLEKAEELLL 344
P +E R+++ + + L K EE L+
Sbjct: 539 ---------------PKYE---RLVN--------AI------------LDFLPKIEENLI 560
Query: 345 RCIEKNPFVGEPHVVLGQIYL---AKGEFEEAEREAGK 379
+ L +I L + FEEA ++ +
Sbjct: 561 CS---------KYTDLLRIALMAEDEAIFEEAHKQVQR 589
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 399 | |||
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.97 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.55 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.45 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.44 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.39 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.33 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.3 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.24 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.24 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.15 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.14 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.14 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.13 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.12 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.09 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.07 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.05 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.04 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.0 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.98 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.95 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.95 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.82 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.81 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.74 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.73 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.72 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.72 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.68 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.67 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.64 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 95.62 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.61 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.6 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.56 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.53 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 95.52 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.52 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.48 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.46 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.41 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.33 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.27 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.26 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 95.16 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.14 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.1 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.09 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.07 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 94.96 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 94.9 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 94.84 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 94.8 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.76 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 94.75 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 94.75 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.63 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 94.49 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 94.42 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 94.38 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 94.34 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.32 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 94.24 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 94.2 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 94.17 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 94.06 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 94.02 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 94.02 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 94.01 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 93.79 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 93.78 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 93.77 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 93.74 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 93.57 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 93.5 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 93.44 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 93.41 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.39 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 93.38 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 93.26 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 93.19 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 93.13 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.04 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 93.02 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 92.98 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 92.88 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 92.73 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 92.66 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 92.65 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 92.65 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 92.63 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 92.62 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 92.6 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 92.59 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 92.56 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 92.54 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 92.43 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 92.32 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 92.28 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 92.14 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 92.11 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.09 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 92.04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 91.99 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 91.94 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 91.91 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 91.84 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 91.77 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 91.69 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 91.65 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 91.62 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 91.51 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 91.47 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 91.4 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 91.33 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 91.28 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 91.24 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 91.24 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 91.15 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 91.03 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 90.96 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 90.78 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 90.73 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 90.65 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 90.5 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 90.43 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 90.42 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 90.41 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 90.06 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 89.77 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 89.3 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 89.29 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 89.13 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 89.13 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 88.8 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 88.64 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 88.61 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 88.56 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 88.55 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 88.41 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 88.3 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 88.16 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 88.12 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 88.08 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 87.92 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 87.73 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 87.08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 86.77 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 86.13 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 86.11 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 85.72 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 85.68 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 85.61 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 85.52 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 85.24 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 84.66 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 84.53 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 84.24 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 84.0 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 83.83 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 83.56 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 83.54 | |
| 1vj7_A | 393 | Bifunctional RELA/SPOT; HD domain, alpha beta 2-la | 81.91 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 81.78 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 81.55 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 80.38 |
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
Probab=96.97 E-value=0.0017 Score=49.23 Aligned_cols=57 Identities=19% Similarity=0.245 Sum_probs=52.0
Q ss_pred hhHHHHHHHHHHHHhhCCCcCchHHHHHHHHhccCCcHHHHHHHHHHHHHHHhhCCC
Q 015869 334 EKLEKAEELLLRCIEKNPFVGEPHVVLGQIYLAKGEFEEAEREAGKGLMLLLEWGSP 390 (399)
Q Consensus 334 ~~~d~a~~lL~~~i~~NP~VgEP~~vLAQ~~l~~gr~~eA~~~A~~gL~ll~~WG~~ 390 (399)
...+.|.+.++++++.||-..+.+..||++|...|++++|...-++++++--..|..
T Consensus 21 g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~l~~~~~~~ 77 (100)
T 3ma5_A 21 DNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQ 77 (100)
T ss_dssp TCHHHHHHHHHHHHHHSTTCTHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHSCH
T ss_pred CCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhhcCCch
Confidence 348899999999999999999999999999999999999999999999987666554
|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1vj7_A Bifunctional RELA/SPOT; HD domain, alpha beta 2-layer sandwich, helix bundle, mangan PPG2':3'P, (P)PPGPP, PPGPP; HET: GDP GPX; 2.10A {Streptococcus dysgalactiae subsp} SCOP: a.211.1.1 d.218.1.8 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 399 | ||||
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 3e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-04 |
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: ImpE-like superfamily: ImpE-like family: ImpE-like domain: Hypothetical protein VPA1032 species: Vibrio parahaemolyticus [TaxId: 670]
Score = 40.0 bits (93), Expect = 3e-04
Identities = 13/52 (25%), Positives = 27/52 (51%)
Query: 332 SKEKLEKAEELLLRCIEKNPFVGEPHVVLGQIYLAKGEFEEAEREAGKGLML 383
S+ +L++A ELL+ I+ +P ++ G+FE A+ + + + L
Sbjct: 8 SEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKL 59
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 399 | |||
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.12 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 95.87 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.86 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.59 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.47 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.4 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.38 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 95.21 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.02 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 94.7 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.53 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 94.5 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.43 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 94.35 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.32 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.28 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.12 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 94.07 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 93.84 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 92.6 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 92.09 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 91.55 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 91.3 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 91.29 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 90.62 | |
| d1vj7a1 | 192 | Stringent response-like protein RelA N-terminal do | 89.8 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 88.3 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 87.64 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 86.98 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 86.41 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 85.94 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 82.96 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 82.5 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 81.43 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 81.42 |
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Hop species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.12 E-value=0.0039 Score=47.64 Aligned_cols=48 Identities=19% Similarity=0.240 Sum_probs=24.4
Q ss_pred HHHHHHHHHHHHhhCCCcCchHHHHHHHHhccCCcHHHHHHHHHHHHH
Q 015869 336 LEKAEELLLRCIEKNPFVGEPHVVLGQIYLAKGEFEEAEREAGKGLML 383 (399)
Q Consensus 336 ~d~a~~lL~~~i~~NP~VgEP~~vLAQ~~l~~gr~~eA~~~A~~gL~l 383 (399)
.+.|...+.++|++||--.+-+.-+|++|+..|+|++|.....+++++
T Consensus 19 ~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~ 66 (117)
T d1elwa_ 19 IDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDL 66 (117)
T ss_dssp HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHhcCCcchhhhhcccccccccccccccchhhhhHHHh
Confidence 444555555555555555555555555555555555555555544443
|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1vj7a1 a.211.1.1 (A:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|