Citrus Sinensis ID: 015960

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MTYSLQSPTMFSLSRSPNNKLSPPLINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEVEPDEAE
cccccccccEEEEEccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHccccccccccccccccccccccHHHHHHHHHcccccEEEEEccccccccccccccccccEEEEccccEEEccccccccccEEEEEEccccEEEEEEEEccccccEEEEEEEcccccccEEEcccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEcEEEcccccccEEEEccHHHHHHHHHHHHHHccEEcccEEEEEcccccHHHHccccEEEEEEccccHHHHccccccccccccccccccEEEEEccEEcccHHHHHHHHHccccccEEEEEEEEccEEEEEEEEEEccccccc
cEEEEcccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHcccccHHcccccccHHHHHHHHcccEEEEEEEcccccccccccccccccEEEEccccEEEEccEEEccccEEEEEEccccEEEEEEEEccccccEEEEEEccccccccEEEEccccccccccEEEEEccccccccEEEEEEEEEcccccccccccccccEEEEcccEccccccccEEEcccEEEEEEEEEEcccccccEEEEEccHHHHHHHHHHHHHcccEEEcEEEEEEEEccHHHHHcccEEEEEEccccHHHHccccccccccccEEEEcEEEEEEcccccccHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEcccccccc
mtyslqsptmfslsrspnnklspplinryhfpfmsdskALILtkqsssfslepfsllfsgvgsssthFFVSRqcklktdevetagifeenlpsvVHITNFGMNTFTltmeypqatgtgfiwdedghivtnhhviegassvkvtlfdkttldakvvghdqgtdlAVLHidapnhklrsipvgvsanlrIGQKVYaighplgrkftcTAGIIsafglepitatgppiqgliqidaainrgnsggplldssgsligvntsiitrtdafcgmacsipidtVSGIVDQLVKFgkiirpylgIAHDQLLEKLMGISGGVIFIAveegpagkaglrstkfgangkFILGDIikavngedvsnanDLHNILDQCKVGDEVIVRILRGTQLEEILIILevepdeae
mtyslqsptmfslsrspnnklSPPLINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAgifeenlpsvvHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEgpagkaglrstkFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILrgtqleeiliilevepdeae
MTYSLQSPTMFSLSRSPNNKLSPPLINRYHFPFMSDSKALILTKQsssfslepfsllfsgvgsssTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRgnsggplldssgsligVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQleeiliileVEPDEAE
************************LINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEV******
**********************PPLINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSS********************GIFEENLPSVVHITN*******************FIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILI**********
****************PNNKLSPPLINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEVEPDEAE
MTYSLQSPTMFSLSRSPNNKLSPPLINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGMN**********ATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEV******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYSLQSPTMFSLSRSPNNKLSPPLINRYHFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEVEPDEAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
O22609439 Protease Do-like 1, chlor yes no 0.916 0.829 0.563 1e-106
Q9LU10448 Protease Do-like 8, chlor no no 0.768 0.680 0.417 2e-55
P0A3Z5 513 Probable periplasmic seri yes no 0.685 0.530 0.380 5e-48
P0C114 513 Probable periplasmic seri yes no 0.685 0.530 0.380 5e-48
Q2YMX6 513 Probable periplasmic seri yes no 0.685 0.530 0.380 5e-48
Q8YG32 513 Probable periplasmic seri yes no 0.685 0.530 0.380 5e-48
Q48EU9 479 Probable periplasmic seri yes no 0.677 0.561 0.357 3e-43
A6VUA4469 Probable periplasmic seri yes no 0.664 0.562 0.381 2e-42
B1J4D7 479 Probable periplasmic seri yes no 0.672 0.557 0.352 2e-42
A5W8F5 477 Probable periplasmic seri yes no 0.672 0.559 0.356 1e-41
>sp|O22609|DEGP1_ARATH Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana GN=DEGP1 PE=1 SV=2 Back     alignment and function desciption
 Score =  384 bits (987), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 210/373 (56%), Positives = 263/373 (70%), Gaps = 9/373 (2%)

Query: 30  HFPFMSDSKALILTKQSSSFSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEE 89
           HF   S  K   L   S + S   F+   S    S++ F VS   KL+TDE+ T  +F+E
Sbjct: 70  HFTPFSAVKPFFLLCTSVALSFSLFAA--SPAVESASAFVVSTPKKLQTDELATVRLFQE 127

Query: 90  NLPSVVHITNFGM--NTFTL-TMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFD 146
           N PSVV+ITN  +  + FTL  +E PQ +G+GF+WD+ GHIVTN+HVI GAS ++VTL D
Sbjct: 128 NTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVIRGASDLRVTLAD 187

Query: 147 KTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCT 206
           +TT DAKVVG DQ  D+AVL IDAP +KLR IPVGVSA+L +GQKV+AIG+P G   T T
Sbjct: 188 QTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT 247

Query: 207 AGIISAFGLE-PITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAF 265
            G+IS    E    ATG PIQ +IQ DAAIN GNSGGPLLDSSG+LIG+NT+I + + A 
Sbjct: 248 TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS 307

Query: 266 CGMACSIPIDTVSGIVDQLVKFGKIIRPYLGI--AHDQLLEKLMGISGGVIFIAVEEGPA 323
            G+  SIP+DTV GIVDQLV+FGK+ RP LGI  A DQ +E+L G+SG ++  A   GPA
Sbjct: 308 SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQL-GVSGVLVLDAPPSGPA 366

Query: 324 GKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLE 383
           GKAGL+STK    G+ +LGDII +VNG  VSN +DL+ ILDQCKVGDEV V +LRG   E
Sbjct: 367 GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRGDHKE 426

Query: 384 EILIILEVEPDEA 396
           +I + LE +PDE+
Sbjct: 427 KISVTLEPKPDES 439
Serine protease that is required at high temperature. May be involved in the degradation of damaged proteins. In vivo, can degrade beta-casein.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q9LU10|DEGP8_ARATH Protease Do-like 8, chloroplastic OS=Arabidopsis thaliana GN=DEGP8 PE=1 SV=1 Back     alignment and function description
>sp|P0A3Z5|DEGPL_BRUSU Probable periplasmic serine endoprotease DegP-like OS=Brucella suis biovar 1 (strain 1330) GN=htrA PE=3 SV=1 Back     alignment and function description
>sp|P0C114|DEGPL_BRUAB Probable periplasmic serine endoprotease DegP-like OS=Brucella abortus biovar 1 (strain 9-941) GN=htrA PE=3 SV=1 Back     alignment and function description
>sp|Q2YMX6|DEGPL_BRUA2 Probable periplasmic serine endoprotease DegP-like OS=Brucella abortus (strain 2308) GN=htrA PE=3 SV=1 Back     alignment and function description
>sp|Q8YG32|DEGPL_BRUME Probable periplasmic serine endoprotease DegP-like OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=htrA PE=3 SV=1 Back     alignment and function description
>sp|Q48EU9|DEGPL_PSE14 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=mucD PE=3 SV=1 Back     alignment and function description
>sp|A6VUA4|DEGPL_MARMS Probable periplasmic serine endoprotease DegP-like OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_1102 PE=3 SV=1 Back     alignment and function description
>sp|B1J4D7|DEGPL_PSEPW Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain W619) GN=PputW619_1070 PE=3 SV=1 Back     alignment and function description
>sp|A5W8F5|DEGPL_PSEP1 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=Pput_4291 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
359493091428 PREDICTED: protease Do-like 1, chloropla 0.979 0.908 0.536 1e-105
357495999432 Serine-type peptidase [Medicago truncatu 0.972 0.893 0.551 1e-105
356511668426 PREDICTED: protease Do-like 1, chloropla 0.962 0.896 0.555 1e-105
270342123424 serine-type peptidase [Phaseolus vulgari 0.959 0.898 0.537 1e-105
297818398433 hypothetical protein ARALYDRAFT_484581 [ 0.929 0.852 0.542 1e-104
449450105439 PREDICTED: protease Do-like 1, chloropla 0.906 0.820 0.563 1e-104
449483759438 PREDICTED: protease Do-like 1, chloropla 0.906 0.821 0.563 1e-104
22331378439 protease Do-like 1 [Arabidopsis thaliana 0.916 0.829 0.563 1e-104
2565436437 DegP protease precursor [Arabidopsis tha 0.886 0.805 0.575 1e-104
224060070361 predicted protein [Populus trichocarpa] 0.861 0.947 0.578 1e-103
>gi|359493091|ref|XP_002267510.2| PREDICTED: protease Do-like 1, chloroplastic-like [Vitis vinifera] gi|296081154|emb|CBI18180.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  389 bits (999), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 222/414 (53%), Positives = 285/414 (68%), Gaps = 25/414 (6%)

Query: 1   MTYSLQSPTMFSLSR-------SPNNKLSPPLINRYH-----FPFMSDSKALILTKQSSS 48
            + S  + ++FSLSR       SPN  L+   ++ +H      P  S   +L++   S +
Sbjct: 22  FSRSPNTKSIFSLSRHRVCLHRSPN--LTTFALHNHHNHSSQAPLSSALDSLLVLCTSVA 79

Query: 49  FSLEPFSLLFSGVGSSSTHFFVSRQCKLKTDEVETAGIFEENLPSVVHITNFG--MNTFT 106
            S   FSL  + V S+S  F V+   KL+ DE+ T  +F+EN PSVV+ITN     + FT
Sbjct: 80  LS---FSLFVADVDSASA-FVVTAPRKLQNDELATVRLFQENTPSVVYITNLAARQDAFT 135

Query: 107 L-TMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAV 165
           L  +E PQ +G+GF+WD+DGHIVTN+HVI GAS ++VTL D+TT DA+VVG DQ  D+AV
Sbjct: 136 LDVLEVPQGSGSGFVWDKDGHIVTNYHVIRGASDLRVTLADQTTYDARVVGFDQDKDVAV 195

Query: 166 LHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLE-PITATGPP 224
           L +DAP  KLR IPVGVSA+L +GQKVYAIG+P G   T T G+IS    E    ATG P
Sbjct: 196 LRVDAPKEKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLTTGVISGLRREISSAATGRP 255

Query: 225 IQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQL 284
           IQ +IQ DAAIN GNSGGPLLDSSGSLIG+NT+I + + A  G+  SIP+DTVSGIVDQL
Sbjct: 256 IQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGASSGVGFSIPVDTVSGIVDQL 315

Query: 285 VKFGKIIRPYLGI--AHDQLLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILG 342
           V+FGK+ RP LGI  A DQ +E+L G+SG ++  A   GPAGKAGL  TK  A G+ ILG
Sbjct: 316 VRFGKVTRPILGIKFAPDQSVEQL-GVSGVLVLDAPANGPAGKAGLLPTKRDAYGRLILG 374

Query: 343 DIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEVEPDEA 396
           DII +VNG+ VSN +DL+ ILDQCKVGD V V +LRG  +E+I ++LE +PDE+
Sbjct: 375 DIITSVNGKKVSNGSDLYRILDQCKVGDTVTVEVLRGDHIEKIPVLLEPKPDES 428

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357495999|ref|XP_003618288.1| Serine-type peptidase [Medicago truncatula] gi|355493303|gb|AES74506.1| Serine-type peptidase [Medicago truncatula] gi|388511665|gb|AFK43894.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356511668|ref|XP_003524545.1| PREDICTED: protease Do-like 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|270342123|gb|ACZ74706.1| serine-type peptidase [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|297818398|ref|XP_002877082.1| hypothetical protein ARALYDRAFT_484581 [Arabidopsis lyrata subsp. lyrata] gi|297322920|gb|EFH53341.1| hypothetical protein ARALYDRAFT_484581 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449450105|ref|XP_004142804.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483759|ref|XP_004156682.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22331378|ref|NP_189431.2| protease Do-like 1 [Arabidopsis thaliana] gi|51338737|sp|O22609.2|DEGP1_ARATH RecName: Full=Protease Do-like 1, chloroplastic; Flags: Precursor gi|11994498|dbj|BAB02539.1| DegP protease precursor [Arabidopsis thaliana] gi|14517500|gb|AAK62640.1| K16N12.18/K16N12.18 [Arabidopsis thaliana] gi|21360531|gb|AAM47381.1| At3g27925/K16N12.18 [Arabidopsis thaliana] gi|332643860|gb|AEE77381.1| protease Do-like 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2565436|gb|AAC39436.1| DegP protease precursor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224060070|ref|XP_002300036.1| predicted protein [Populus trichocarpa] gi|222847294|gb|EEE84841.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2086420439 DEG1 "degradation of periplasm 0.826 0.747 0.540 2.4e-85
UNIPROTKB|Q607N4374 MCA1725 "Putative serine prote 0.778 0.826 0.389 8.3e-51
TAIR|locus:2151916448 DEG8 "degradation of periplasm 0.745 0.660 0.372 1e-43
UNIPROTKB|P0A3Z5 513 htrA "Probable periplasmic ser 0.685 0.530 0.335 6.3e-37
UNIPROTKB|P0C114 513 htrA "Probable periplasmic ser 0.685 0.530 0.335 6.3e-37
UNIPROTKB|Q2YMX6 513 htrA "Probable periplasmic ser 0.685 0.530 0.335 6.3e-37
UNIPROTKB|Q8YG32 513 htrA "Probable periplasmic ser 0.685 0.530 0.335 6.3e-37
TAIR|locus:2124509323 DEG5 "degradation of periplasm 0.453 0.557 0.383 7.2e-36
UNIPROTKB|Q3AG05370 CHY_0057 "Putative serine prot 0.715 0.767 0.366 1.7e-34
TIGR_CMR|CHY_0057370 CHY_0057 "putative serine prot 0.715 0.767 0.366 1.7e-34
TAIR|locus:2086420 DEG1 "degradation of periplasmic proteins 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 854 (305.7 bits), Expect = 2.4e-85, P = 2.4e-85
 Identities = 181/335 (54%), Positives = 227/335 (67%)

Query:    68 FFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGM--NTFTL-TMEYPQATGTGFIWDED 124
             F VS   KL+TDE+ T  +F+EN PSVV+ITN  +  + FTL  +E PQ +G+GF+WD+ 
Sbjct:   106 FVVSTPKKLQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQ 165

Query:   125 GHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSA 184
             GHIVTN+HVI GAS ++VTL D+TT DAKVVG DQ  D+AVL IDAP +KLR IPVGVSA
Sbjct:   166 GHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSA 225

Query:   185 NLRIGQKVYAIGHPLGRKFTCTAGIISAFGLE-PITATGPPIQGLIQIDAAINRXXXXXX 243
             +L +GQKV+AIG+P G   T T G+IS    E    ATG PIQ +IQ DAAIN       
Sbjct:   226 DLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGP 285

Query:   244 XXXXXXXXXXVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGI--AHDQ 301
                       +NT+I + + A  G+  SIP+DTV GIVDQLV+FGK+ RP LGI  A DQ
Sbjct:   286 LLDSSGTLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQ 345

Query:   302 LLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHN 361
              +E+L G+SG ++  A   GPAGKAGL+STK    G+ +LGDII +VNG  VSN +DL+ 
Sbjct:   346 SVEQL-GVSGVLVLDAPPSGPAGKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYR 404

Query:   362 ILDQCKVGDEVIVRILRGTQXXXXXXXXXVEPDEA 396
             ILDQCKVGDEV V +LRG            +PDE+
Sbjct:   405 ILDQCKVGDEVTVEVLRGDHKEKISVTLEPKPDES 439
GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA;IDA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=ISS;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0030163 "protein catabolic process" evidence=TAS
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010206 "photosystem II repair" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
UNIPROTKB|Q607N4 MCA1725 "Putative serine protease" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2151916 DEG8 "degradation of periplasmic proteins 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3Z5 htrA "Probable periplasmic serine endoprotease DegP-like" [Brucella suis 1330 (taxid:204722)] Back     alignment and assigned GO terms
UNIPROTKB|P0C114 htrA "Probable periplasmic serine endoprotease DegP-like" [Brucella abortus bv. 1 str. 9-941 (taxid:262698)] Back     alignment and assigned GO terms
UNIPROTKB|Q2YMX6 htrA "Probable periplasmic serine endoprotease DegP-like" [Brucella melitensis biovar Abortus 2308 (taxid:359391)] Back     alignment and assigned GO terms
UNIPROTKB|Q8YG32 htrA "Probable periplasmic serine endoprotease DegP-like" [Brucella melitensis bv. 1 str. 16M (taxid:224914)] Back     alignment and assigned GO terms
TAIR|locus:2124509 DEG5 "degradation of periplasmic proteins 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AG05 CHY_0057 "Putative serine protease Do" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0057 CHY_0057 "putative serine protease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22609DEGP1_ARATH3, ., 4, ., 2, 1, ., -0.56300.91680.8291yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 8e-81
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 5e-68
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 7e-51
PRK10898353 PRK10898, PRK10898, serine endoprotease; Provision 5e-42
PRK10942473 PRK10942, PRK10942, serine endoprotease; Provision 4e-41
PRK10139455 PRK10139, PRK10139, serine endoprotease; Provision 8e-38
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 2e-25
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 4e-12
pfam00089218 pfam00089, Trypsin, Trypsin 2e-11
pfam1318081 pfam13180, PDZ_2, PDZ domain 1e-09
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 2e-06
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 5e-06
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 7e-05
cd0098679 cd00986, PDZ_LON_protease, PDZ domain of ATP-depen 2e-04
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.001
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 0.001
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information 
 Score =  254 bits (650), Expect = 8e-81
 Identities = 113/293 (38%), Positives = 164/293 (55%), Gaps = 26/293 (8%)

Query: 113 QATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPN 172
           +  G+G I   DG+++TN+HV++GA  + VTL D     AK+VG D  TD+AVL IDA  
Sbjct: 57  RGLGSGVIISADGYVLTNNHVVDGADEITVTLSDGREFKAKLVGKDPRTDIAVLKIDAKK 116

Query: 173 HKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQG---LI 229
             L  I +G S  LR+G  V AIG+P G   T T+GI+SA G      +G  I      I
Sbjct: 117 -NLPVIKLGDSDKLRVGDWVLAIGNPFGLGQTVTSGIVSALG-----RSGLGIGDYENFI 170

Query: 230 QIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGK 289
           Q DAAIN GNSGGPL++  G +IG+NT+I++ +    G+  +IP +    +VDQL++ GK
Sbjct: 171 QTDAAINPGNSGGPLVNLRGEVIGINTAILSPSGGNVGIGFAIPSNMAKNVVDQLIEGGK 230

Query: 290 IIRPYLGI---AHDQLLEKLMGI--SGGVIFIAVEEG-PAGKAGLRSTKFGANGKFILGD 343
           + R +LG+        L K +G+    G +   V  G PA KAGL++           GD
Sbjct: 231 VKRGWLGVTIQEVTSDLAKSLGLEKQRGALVAQVLPGSPAEKAGLKA-----------GD 279

Query: 344 IIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILIILEVEPDEA 396
           +I +VNG+ +S+  DL   +   K G +V + ILR  + + I + L   P+E 
Sbjct: 280 VITSVNGKPISSFADLRRAIGTLKPGKKVTLGILRKGKEKTITVTLGASPEEQ 332

This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 428
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238486 cd00986, PDZ_LON_protease, PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
PRK10898353 serine endoprotease; Provisional 100.0
PRK10139455 serine endoprotease; Provisional 100.0
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10942473 serine endoprotease; Provisional 100.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically peri 100.0
KOG1320473 consensus Serine protease [Posttranslational modif 99.96
KOG1421 955 consensus Predicted signaling-associated protein ( 99.91
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.71
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.57
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.55
KOG1421 955 consensus Predicted signaling-associated protein ( 99.49
KOG1320 473 consensus Serine protease [Posttranslational modif 99.44
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.42
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.32
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 99.32
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.32
TIGR01713259 typeII_sec_gspC general secretion pathway protein 99.29
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 99.21
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 99.15
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 99.04
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 99.01
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.94
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.87
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.83
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.73
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.71
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 98.7
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.68
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 98.55
KOG3627256 consensus Trypsin [Amino acid transport and metabo 98.55
PRK10139455 serine endoprotease; Provisional 98.52
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.5
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.49
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.44
PRK10942473 serine endoprotease; Provisional 98.42
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.37
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.34
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.28
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.24
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 98.17
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.17
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 98.08
PRK09681276 putative type II secretion protein GspC; Provision 98.06
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.91
KOG3129231 consensus 26S proteasome regulatory complex, subun 97.87
COG5640413 Secreted trypsin-like serine protease [Posttransla 97.79
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 97.78
COG3975558 Predicted protease with the C-terminal PDZ domain 97.78
PRK11186 667 carboxy-terminal protease; Provisional 97.71
COG3031275 PulC Type II secretory pathway, component PulC [In 97.45
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 97.35
PF10459 698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 97.11
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 97.01
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 96.93
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 96.92
KOG3580 1027 consensus Tight junction proteins [Signal transduc 96.32
PF1281278 PDZ_1: PDZ-like domain 96.15
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 95.69
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 95.66
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 95.22
KOG3209 984 consensus WW domain-containing protein [General fu 94.81
KOG3532 1051 consensus Predicted protein kinase [General functi 94.65
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 94.51
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 94.4
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 94.26
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 94.23
COG0750 375 Predicted membrane-associated Zn-dependent proteas 93.77
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 93.39
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 93.13
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 92.59
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 92.5
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 91.75
KOG3209984 consensus WW domain-containing protein [General fu 91.58
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 91.39
KOG3580 1027 consensus Tight junction proteins [Signal transduc 90.54
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 89.57
KOG3549 505 consensus Syntrophins (type gamma) [Extracellular 89.32
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 88.09
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 87.67
PF03510105 Peptidase_C24: 2C endopeptidase (C24) cysteine pro 87.1
KOG0606 1205 consensus Microtubule-associated serine/threonine 87.07
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 86.53
KOG3651 429 consensus Protein kinase C, alpha binding protein 86.34
KOG2921 484 consensus Intramembrane metalloprotease (sterol-re 82.66
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 81.16
KOG3605829 consensus Beta amyloid precursor-binding protein [ 80.51
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 80.31
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-54  Score=420.31  Aligned_cols=302  Identities=34%  Similarity=0.504  Sum_probs=260.3

Q ss_pred             cccchHHHHHHHcCCceEEEEeeeccccccccCCCCceeEEEEEcCCCEEEEcccccCCCCeEEEEecCCcEEEEEEEEE
Q 015960           78 TDEVETAGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGH  157 (397)
Q Consensus        78 ~~~~~~~~~~~~~~~sVV~I~~~~~~~~~~~~~~~~~~GSG~ii~~~G~ILT~aHvv~~~~~i~V~~~~g~~~~a~vv~~  157 (397)
                      ..+.++.++++++.||||.|................+.||||+|+++||||||+|||.++..+.|++.||+.++|+++++
T Consensus        42 ~~~~~~~~~~~~~~psvV~v~~~~~~~~~~~~~~~~~~GSGfvi~~~G~IlTn~HVv~~a~~i~V~~~dg~~~~a~vv~~  121 (353)
T PRK10898         42 ETPASYNQAVRRAAPAVVNVYNRSLNSTSHNQLEIRTLGSGVIMDQRGYILTNKHVINDADQIIVALQDGRVFEALLVGS  121 (353)
T ss_pred             cccchHHHHHHHhCCcEEEEEeEeccccCcccccccceeeEEEEeCCeEEEecccEeCCCCEEEEEeCCCCEEEEEEEEE
Confidence            34457899999999999999886543322122233478999999999999999999999999999999999999999999


Q ss_pred             cCCCCeEEEEEcCCCCCcceeecCCCCCCCCCCeEEEEecCCCCCCceeeeEEeeccccccCCCCCCcccEEEEccccCC
Q 015960          158 DQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINR  237 (397)
Q Consensus       158 d~~~DlAlL~v~~~~~~~~~~~l~~s~~~~~G~~V~~iG~p~g~~~~~~~G~vs~~~~~~~~~~~~~~~~~i~~~~~i~~  237 (397)
                      |+.+||||||++..  .+++++++++..+++||+|+++|||++...+++.|+|++..+......+  ..+++|+|+++++
T Consensus       122 d~~~DlAvl~v~~~--~l~~~~l~~~~~~~~G~~V~aiG~P~g~~~~~t~Giis~~~r~~~~~~~--~~~~iqtda~i~~  197 (353)
T PRK10898        122 DSLTDLAVLKINAT--NLPVIPINPKRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLSPTG--RQNFLQTDASINH  197 (353)
T ss_pred             cCCCCEEEEEEcCC--CCCeeeccCcCcCCCCCEEEEEeCCCCcCCCcceeEEEeccccccCCcc--ccceEEeccccCC
Confidence            99999999999873  6889999988889999999999999998889999999988775432222  2578999999999


Q ss_pred             CCcccceecCCccEEEEEeeeeccCC---CccCceeeEeccchhHHHHHHHhccccccccCCCchh---HHHHHHcCC--
Q 015960          238 GNSGGPLLDSSGSLIGVNTSIITRTD---AFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHD---QLLEKLMGI--  309 (397)
Q Consensus       238 G~SGGPlvn~~G~vVGI~s~~~~~~~---~~~~~~~aip~~~i~~~~~~l~~~g~~~~~~lGi~~~---~~~~~~~~~--  309 (397)
                      |||||||+|.+|+||||+++.+....   ...+++|+||++.+++++++|+++|++.++|||+..+   +..+...+.  
T Consensus       198 GnSGGPl~n~~G~vvGI~~~~~~~~~~~~~~~g~~faIP~~~~~~~~~~l~~~G~~~~~~lGi~~~~~~~~~~~~~~~~~  277 (353)
T PRK10898        198 GNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPTQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQ  277 (353)
T ss_pred             CCCcceEECCCCeEEEEEEEEecccCCCCcccceEEEEchHHHHHHHHHHhhcCcccccccceEEEECCHHHHHhcCCCC
Confidence            99999999999999999998775432   2367999999999999999999999999999999532   222333333  


Q ss_pred             -CCcEEEEecccCcccccCccccccCCCCcccCCcEEEEECCEecCCHHHHHHHHhcCCCCCEEEEEEEECCeEEEEEEE
Q 015960          310 -SGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILII  388 (397)
Q Consensus       310 -~g~~V~~v~~~spa~~aGl~~~~~~~~~~l~~GDiI~~vng~~v~~~~d~~~~l~~~~~g~~v~l~v~R~g~~~~~~v~  388 (397)
                       .|++|.++.++|||+++||++           ||+|++|||++|.++.++.+.+...++|+++.++|+|+|+.+++.++
T Consensus       278 ~~Gv~V~~V~~~spA~~aGL~~-----------GDvI~~Ing~~V~s~~~l~~~l~~~~~g~~v~l~v~R~g~~~~~~v~  346 (353)
T PRK10898        278 LQGIVVNEVSPDGPAAKAGIQV-----------NDLIISVNNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVT  346 (353)
T ss_pred             CCeEEEEEECCCChHHHcCCCC-----------CCEEEEECCEEcCCHHHHHHHHHhcCCCCEEEEEEEECCEEEEEEEE
Confidence             799999999999999999999           99999999999999999999998878999999999999999999999


Q ss_pred             eeeCCC
Q 015960          389 LEVEPD  394 (397)
Q Consensus       389 l~~~~~  394 (397)
                      +.++|.
T Consensus       347 l~~~p~  352 (353)
T PRK10898        347 IQEYPA  352 (353)
T ss_pred             eccCCC
Confidence            987763

>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3627 consensus Trypsin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03510 Peptidase_C24: 2C endopeptidase (C24) cysteine protease family; InterPro: IPR000317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
3qo6_A348 Crystal Structure Analysis Of The Plant Protease De 2e-91
2zle_A448 Cryo-Em Structure Of Degp12OMP Length = 448 1e-29
4a8d_A448 Degp Dodecamer With Bound Omp Length = 448 1e-29
3otp_A459 Crystal Structure Of The Degp Dodecamer With A Mode 1e-29
3mh5_A456 Htra Proteases Are Activated By A Conserved Mechani 2e-29
3mh4_A456 Htra Proteases Are Activated By A Conserved Mechani 2e-29
3cs0_A448 Crystal Structure Of Degp24 Length = 448 4e-28
1ky9_A448 Crystal Structure Of Degp (Htra) Length = 448 4e-28
3mh7_A456 Htra Proteases Are Activated By A Conserved Mechani 5e-28
3pv3_A451 Structure Of Legionella Fallonii Degq (S193a Varian 7e-27
3pv2_A451 Structure Of Legionella Fallonii Degq (Wt) Length = 7e-27
3pv4_A354 Structure Of Legionella Fallonii Degq (Delta-Pdz2 V 8e-27
3pv5_A451 Structure Of Legionella Fallonii Degq (N189gP190G V 5e-26
3stj_A345 Crystal Structure Of The Protease + Pdz1 Domain Of 4e-25
1soz_A314 Crystal Structure Of Degs Protease In Complex With 6e-25
4a8a_A436 Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 7e-25
3gcn_A340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 9e-25
1l1j_A239 Crystal Structure Of The Protease Domain Of An Atp- 1e-24
1sot_A320 Crystal Structure Of The Degs Stress Sensor Length 1e-24
1te0_A318 Structural Analysis Of Degs, A Stress Sensor Of The 2e-24
3sti_A245 Crystal Structure Of The Protease Domain Of Degq Fr 1e-21
3lgi_A237 Structure Of The Protease Domain Of Degs (Degs-Delt 1e-21
3lgy_A241 R178a Mutant Of The Degs-Deltapdz Protease Length = 1e-21
2qgr_A243 Structure Of The R178a Mutant Of Delta Pdz Degs Pro 1e-21
2qf3_A243 Structure Of The Delta Pdz Truncation Of The Degs P 1e-21
3lh3_A241 Dfp Modified Degs Delta Pdz Length = 241 2e-21
2rce_B243 Dfp Modified Degs Delta Pdz Length = 243 2e-21
3lgu_A241 Y162a Mutant Of The Degs-Deltapdz Protease Length = 2e-21
3lgv_A241 H198p Mutant Of The Degs-Deltapdz Protease Length = 2e-21
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 2e-21
3lgt_A241 Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease 2e-21
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 3e-21
2qf0_A243 Structure Of The Delta Pdz Truncation Of The Degs P 4e-21
3lgw_A241 H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease 7e-21
3lh1_A241 Q191a Mutant Of The Degs-Deltapdz Length = 241 9e-21
3b8j_A243 Q191a Mutant Of Degs-Deltapdz Length = 243 1e-20
2r3u_A211 Crystal Structure Of The Pdz Deletion Mutant Of Deg 1e-19
1y8t_A324 Crystal Structure Of Rv0983 From Mycobacterium Tube 5e-18
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 2e-17
3tjo_A231 Htra1 Catalytic Domain, Mutationally Inactivated Le 3e-17
3tjn_A228 Htra1 Catalytic Domain, Apo Form Length = 228 3e-17
1lcy_A325 Crystal Structure Of The Mitochondrial Serine Prote 1e-16
4fln_A 539 Crystal Structure Of Plant Protease Deg2 Length = 5 2e-05
3k6y_A237 Crystal Structure Of Rv3671c Protease From M. Tuber 2e-05
3k6z_A219 Crystal Structure Of Rv3671c Protease, Inactive For 3e-05
3lt3_A217 Crystal Structure Of Rv3671c From M. Tuberculosis H 3e-05
2l97_A134 Solution Structure Of Htra Pdz Domain From Streptoc 4e-04
>pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 Back     alignment and structure 
Iteration: 1

 Score =  332 bits (851), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 227/335 (67%), Gaps = 7/335 (2%)
Query: 68  FFVSRQCKLKTDEVETAGIFEENLPSVVHITNFGM--NTFTL-TMEYPQATGTGFIWDED 124
           F VS   KL+TDE+ T  +F+EN PSVV+ITN  +  + FTL  +E PQ +G+GF+WD+ 
Sbjct: 4   FVVSTPKKLQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQ 63
Query: 125 GHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSA 184
           GHIVTN+HVI GAS ++VTL D+TT DAKVVG DQ  D+AVL IDAP +KLR IPVGVSA
Sbjct: 64  GHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSA 123
Query: 185 NLRIGQKVYAIGHPLGRKFTCTAGIISAFGLE-PITATGPPIQGLIQIDAAINRXXXXXX 243
           +L +GQKV+AIG+P G   T T G+IS    E    ATG PIQ +IQ DAAIN       
Sbjct: 124 DLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGP 183
Query: 244 XXXXXXXXXXVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGI--AHDQ 301
                     +NT+I + + A  G+  SIP+DTV GIVDQLV+FGK+ RP LGI  A DQ
Sbjct: 184 LLDSSGTLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQ 243
Query: 302 LLEKLMGISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHN 361
            +E+L G+SG ++  A   GPAGKAGL+STK    G+ +LGDII +VNG  VSN +DL+ 
Sbjct: 244 SVEQL-GVSGVLVLDAPPSGPAGKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYR 302
Query: 362 ILDQCKVGDEVIVRILRGTQXXXXXXXXXVEPDEA 396
           ILDQCKVGDEV V +LRG            +PDE+
Sbjct: 303 ILDQCKVGDEVTVEVLRGDHKEKISVTLEPKPDES 337
>pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure
>pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 Back     alignment and structure
>pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 Back     alignment and structure
>pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 Back     alignment and structure
>pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 Back     alignment and structure
>pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 Back     alignment and structure
>pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 Back     alignment and structure
>pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 Back     alignment and structure
>pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 Back     alignment and structure
>pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 Back     alignment and structure
>pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 Back     alignment and structure
>pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 Back     alignment and structure
>pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 Back     alignment and structure
>pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 Back     alignment and structure
>pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 Back     alignment and structure
>pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 Back     alignment and structure
>pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 Back     alignment and structure
>pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 Back     alignment and structure
>pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241 Back     alignment and structure
>pdb|3B8J|A Chain A, Q191a Mutant Of Degs-Deltapdz Length = 243 Back     alignment and structure
>pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 Back     alignment and structure
>pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 Back     alignment and structure
>pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 Back     alignment and structure
>pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 Back     alignment and structure
>pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure
>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 Back     alignment and structure
>pdb|3K6Y|A Chain A, Crystal Structure Of Rv3671c Protease From M. Tuberculosis, Active Form Length = 237 Back     alignment and structure
>pdb|3K6Z|A Chain A, Crystal Structure Of Rv3671c Protease, Inactive Form Length = 219 Back     alignment and structure
>pdb|3LT3|A Chain A, Crystal Structure Of Rv3671c From M. Tuberculosis H37rv, Ser343ala Mutant, Inactive Form Length = 217 Back     alignment and structure
>pdb|2L97|A Chain A, Solution Structure Of Htra Pdz Domain From Streptococcus Pneumoniae Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 1e-129
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 1e-90
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 4e-87
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 5e-87
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 4e-06
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 8e-87
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 4e-86
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 4e-86
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 3e-84
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 9e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 7e-84
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-06
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 8e-75
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 1e-69
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 1e-67
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 3e-66
3k6y_A237 Serine protease, possible membrane-associated seri 2e-54
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 4e-51
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 1e-49
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 7e-45
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 3e-44
2w5e_A163 Putative serine protease; coiled coil, transmembra 6e-36
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 9e-36
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 3e-27
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 9e-26
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 2e-25
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 9e-19
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 4e-15
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 2e-13
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 1e-12
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-12
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 4e-12
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 8e-11
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 1e-10
1hpg_A187 Glutamic acid specific protease; serine protease, 2e-10
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 4e-10
2kl1_A94 YLBL protein; structure genomics, structural genom 4e-10
2hga_A125 Conserved protein MTH1368; GFT structural genomics 9e-09
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 2e-08
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 5e-08
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 8e-08
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 2e-07
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 9e-07
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
4fgm_A597 Aminopeptidase N family protein; structural genomi 1e-05
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 8e-05
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-04
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 2e-04
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-04
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 3e-04
2ego_A96 General receptor for phosphoinositides 1- associat 3e-04
2eaq_A90 LIM domain only protein 7; conserved hypothetical 4e-04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-04
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 5e-04
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 6e-04
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 6e-04
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 6e-04
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 9e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 9e-04
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
 Score =  373 bits (961), Expect = e-129
 Identities = 192/328 (58%), Positives = 241/328 (73%), Gaps = 5/328 (1%)

Query: 75  KLKTDEVETAGIFEENLPSVVHITNFGM--NTFTLTM-EYPQATGTGFIWDEDGHIVTNH 131
           KL+TDE+ T  +F+EN PSVV+ITN  +  + FTL + E PQ +G+GF+WD+ GHIVTN+
Sbjct: 11  KLQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNY 70

Query: 132 HVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQK 191
           HVI GAS ++VTL D+TT DAKVVG DQ  D+AVL IDAP +KLR IPVGVSA+L +GQK
Sbjct: 71  HVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQK 130

Query: 192 VYAIGHPLGRKFTCTAGIISAFGLE-PITATGPPIQGLIQIDAAINRGNSGGPLLDSSGS 250
           V+AIG+P G   T T G+IS    E    ATG PIQ +IQ DAAIN GNSGGPLLDSSG+
Sbjct: 131 VFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGT 190

Query: 251 LIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIA-HDQLLEKLMGI 309
           LIG+NT+I + + A  G+  SIP+DTV GIVDQLV+FGK+ RP LGI        + +G+
Sbjct: 191 LIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV 250

Query: 310 SGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVG 369
           SG ++  A   GPAGKAGL+STK    G+ +LGDII +VNG  VSN +DL+ ILDQCKVG
Sbjct: 251 SGVLVLDAPPSGPAGKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVG 310

Query: 370 DEVIVRILRGTQLEEILIILEVEPDEAE 397
           DEV V +LRG   E+I + LE +PDE+ 
Sbjct: 311 DEVTVEVLRGDHKEKISVTLEPKPDESA 338
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Length = 209 Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Length = 198 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 100.0
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 100.0
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 100.0
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 100.0
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 100.0
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 100.0
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 100.0
3k6y_A237 Serine protease, possible membrane-associated seri 99.97
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.92
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.91
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.89
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.86
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.86
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.84
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.84
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.83
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.83
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.82
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.81
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.81
1hpg_A187 Glutamic acid specific protease; serine protease, 99.8
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.77
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.76
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.73
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.72
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 99.61
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.58
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.56
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.55
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.55
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.54
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.54
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.54
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.54
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.53
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.53
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.53
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.53
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.53
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.52
1a7s_A225 Heparin binding protein; serine protease homolog, 99.52
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.52
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.52
2aiq_A231 Protein C activator; snake venom serine proteinase 99.52
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.52
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.51
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.51
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.51
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.51
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.51
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.51
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.51
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.51
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.51
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.51
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.51
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.51
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.5
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.49
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.49
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.49
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.49
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.49
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.49
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.48
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.48
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.48
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.48
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.47
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.47
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.46
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.46
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.46
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.46
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.45
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.45
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.45
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.45
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.44
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.44
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.44
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.44
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.44
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.43
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.43
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.43
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.42
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.41
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 99.41
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.41
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.41
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.41
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.41
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.4
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.4
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.4
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.39
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 99.39
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.38
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.37
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.36
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.36
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.36
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.35
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.35
2kl1_A94 YLBL protein; structure genomics, structural genom 99.34
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.34
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.33
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.33
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.33
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 99.32
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.32
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.32
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.31
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.28
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.28
1md8_A329 C1R complement serine protease; innate immunity, a 99.28
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.28
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 99.27
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.25
1elv_A333 Complement C1S component; trypsin-like serin prote 99.24
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.24
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.23
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 99.19
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.18
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.17
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.16
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.12
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.1
3hrz_D741 Complement factor B; serine protease, glycosilated 99.09
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.08
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.08
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.06
2hga_A125 Conserved protein MTH1368; GFT structural genomics 99.06
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.04
2xrc_A565 Human complement factor I; immune system, hydrolas 99.01
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.01
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.01
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.0
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 99.0
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.0
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.0
2odp_A509 Complement C2; C3/C5 convertase, complement serin 98.98
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.97
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.97
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.97
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.96
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.96
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.95
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.94
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.93
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.92
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.92
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.92
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.92
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.92
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.92
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.91
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.91
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.9
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.9
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.9
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.89
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.88
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.88
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.88
2awx_A105 Synapse associated protein 97; membrane protein, s 98.88
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.87
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.87
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.86
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.86
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.86
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.86
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.86
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.85
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.85
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.84
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.84
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.83
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.83
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.83
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.83
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.82
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.82
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.82
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.81
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.81
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.81
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.8
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.8
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.8
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.79
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.79
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.79
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.79
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.79
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.78
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.78
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.78
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 98.78
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.77
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.77
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.77
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.77
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.77
2d90_A102 PDZ domain containing protein 1; structural genomi 98.76
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.76
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.76
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.75
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.75
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.75
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.74
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.74
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.74
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.74
2ego_A96 General receptor for phosphoinositides 1- associat 98.74
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.74
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.73
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.73
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.73
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.73
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.72
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.72
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.71
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.71
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.71
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.71
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.7
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.7
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.7
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.7
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.7
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.69
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.69
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.69
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.69
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.69
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.68
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.68
1lvm_A229 Catalytic domain of the nuclear inclusion protein 98.67
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.67
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.67
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.66
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.66
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.66
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.66
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.65
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.65
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.65
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.65
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.65
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.64
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.64
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.64
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.63
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.63
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.63
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.63
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.63
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.62
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.61
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.61
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.61
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.6
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.6
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.59
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.59
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.58
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.57
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.57
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.56
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.56
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.56
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.56
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.56
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.56
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.55
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.54
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.54
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.53
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.53
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.52
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.51
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.51
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.51
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.5
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.5
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.49
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.48
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.48
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.48
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.46
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.46
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.45
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.44
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.43
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.43
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.42
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 98.41
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.39
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.39
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.34
3k50_A 403 Putative S41 protease; structural genomics, joint 98.29
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.27
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.26
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.21
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.18
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 97.47
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.05
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.01
3qzr_A187 3C protein; chymotrypsin-fold, beta-ribbon, hydrol 97.9
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.87
2hal_A212 Hepatitis A protease 3C; 3C protease, inhibitor de 97.85
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.83
3zve_A190 3C protease; hydrolase, michael inhibitor; HET: G8 97.76
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.75
3q3y_A191 HEVB EV93 3C protease; cysteine trypsin-like prote 97.75
2b0f_A182 Picornain 3C (protease 3C) (P3C); beta barrel, hyd 97.7
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 97.68
1cqq_A180 Type 2 rhinovirus 3C protease; viral protein, hydr 97.66
4dcd_A190 Protease 3C, genome polyprotein; antiviral inhibit 97.64
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.62
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.25
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.0
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 97.0
2ijd_1 644 Picornain 3C, RNA-directed RNA polymerase; RNA-dep 96.7
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 95.95
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 94.8
4ash_A185 NS6 protease; hydrolase, trypsin-like, calicivirus 92.97
2fp7_B172 Serine protease NS3; flavivirus, NS3 protease, NS2 92.0
2ggv_B185 NS3, non-structural protein 3; beta barrel, serine 91.88
3e90_B198 NS3 protease; trypsin-like serine protease, protea 91.69
2fom_B185 Polyprotein; flavivirus, NS3 protease, NS2B cofact 91.67
3u1j_B191 Serine protease NS3; serine protease, ER MEM hydro 91.09
3lkw_A236 Fusion protein of nonstructural protein 2B and non 90.77
2fyq_A194 Chymotrypsin-like cysteine proteinase; protease, n 90.39
1vcp_A149 Semliki forest virus capsid protein; virus coat pr 90.37
4agk_A158 Capsid protein, coat protein, C; hydrolase, viral 90.05
1svp_A161 Sindbis virus capsid protein; chymotrypsin-like se 89.88
1ep5_B157 Capsid protein C, coat protein C; beta barrel, hyd 89.4
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 89.16
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 87.93
3su6_A203 NS3 protease, NS4A protein; drug resistance, drug 81.51
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=1.2e-56  Score=438.21  Aligned_cols=322  Identities=59%  Similarity=0.906  Sum_probs=280.3

Q ss_pred             ccCCcccchHHHHHHHcCCceEEEEeeeccccccc---cCCCCceeEEEEEcCCCEEEEcccccCCCCeEEEEecCCcEE
Q 015960           74 CKLKTDEVETAGIFEENLPSVVHITNFGMNTFTLT---MEYPQATGTGFIWDEDGHIVTNHHVIEGASSVKVTLFDKTTL  150 (397)
Q Consensus        74 ~~~~~~~~~~~~~~~~~~~sVV~I~~~~~~~~~~~---~~~~~~~GSG~ii~~~G~ILT~aHvv~~~~~i~V~~~~g~~~  150 (397)
                      ..+.+++.+..++++++.||||.|.+...+...+.   .....+.||||+|+++||||||+||+.++..+.|.+.+++.+
T Consensus        10 ~~~~~~e~~~~~~~~~~~~sVV~I~~~~~~~~~~~~~~~~~~~g~GSG~iI~~~G~IlT~aHvv~~~~~i~V~~~~g~~~   89 (348)
T 3qo6_A           10 KKLQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVIRGASDLRVTLADQTTF   89 (348)
T ss_dssp             CCCCHHHHHHHHHHHHHGGGEEEEEEEEEEECSSSCCEEEEEEEEEEEEEEETTTEEEECHHHHTTCSEEEEECTTSCEE
T ss_pred             cccCcchhHHHHHHHHhCCCEEEEEEEeecccccccccccccCceEEEEEEeCCCEEEECHHHhCCCcEEEEEECCCCEE
Confidence            34566778899999999999999987654222111   112356899999999999999999999999999999999999


Q ss_pred             EEEEEEEcCCCCeEEEEEcCCCCCcceeecCCCCCCCCCCeEEEEecCCCCCCceeeeEEeeccccccCC-CCCCcccEE
Q 015960          151 DAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYAIGHPLGRKFTCTAGIISAFGLEPITA-TGPPIQGLI  229 (397)
Q Consensus       151 ~a~vv~~d~~~DlAlL~v~~~~~~~~~~~l~~s~~~~~G~~V~~iG~p~g~~~~~~~G~vs~~~~~~~~~-~~~~~~~~i  229 (397)
                      ++++++.|+.+||||||++.+...+++++++++..+..|+.|+++|||.+...+++.|+++.+.+..... .+.....++
T Consensus        90 ~a~~v~~d~~~DlAlLkl~~~~~~~~~i~l~~s~~~~~G~~v~~iG~p~g~~~~~~~g~vs~~~~~~~~~~~~~~~~~~i  169 (348)
T 3qo6_A           90 DAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVI  169 (348)
T ss_dssp             EEEEEEEEGGGTEEEEECCCCGGGCCCCCBCCSTTCCTTCEEEEEECGGGCTTEEEEEEEEEEEEEECCSSSSSCEEEEE
T ss_pred             EEEEEEEcCcCCEEEEEEcCCCCCceeEEecCcccCCCCCEEEEEECCCCCCCcEeEEEEEeeccccccccCCCcccCEE
Confidence            9999999999999999999865578999998888899999999999999988899999999887754332 233345789


Q ss_pred             EEccccCCCCcccceecCCccEEEEEeeeeccCCCccCceeeEeccchhHHHHHHHhccccccccCCCchhHH-HHHHcC
Q 015960          230 QIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSIPIDTVSGIVDQLVKFGKIIRPYLGIAHDQL-LEKLMG  308 (397)
Q Consensus       230 ~~~~~i~~G~SGGPlvn~~G~vVGI~s~~~~~~~~~~~~~~aip~~~i~~~~~~l~~~g~~~~~~lGi~~~~~-~~~~~~  308 (397)
                      ++|+.+|+|||||||+|.+|+||||+++.+...+...+++|+||++.+++++++|+++|++.|||||+...+. ..+.++
T Consensus       170 ~~da~i~~G~SGGPLvn~~G~vvGI~s~~~~~~~~~~g~gfaiP~~~~~~~~~~l~~~g~~~~~~lGi~~~~~~~~~~~~  249 (348)
T 3qo6_A          170 QTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLG  249 (348)
T ss_dssp             EECSCCCTTCTTCEEECTTSCEEEEEEEEECSSSSCSSCEEEEEHHHHHHHHHHHHHHSSCCCEECCCEECCTTTTTTTT
T ss_pred             EEeCCcCCCCcHHHhhCCCCeEEEEEEeeecCCCCcccEEEEEEecchHHHHHHHHhCCceeeeecCcEEccchhhhhcC
Confidence            9999999999999999999999999999987766678899999999999999999999999999999965422 123356


Q ss_pred             CCCcEEEEecccCcccccCccccccCCCCcccCCcEEEEECCEecCCHHHHHHHHhcCCCCCEEEEEEEECCeEEEEEEE
Q 015960          309 ISGGVIFIAVEEGPAGKAGLRSTKFGANGKFILGDIIKAVNGEDVSNANDLHNILDQCKVGDEVIVRILRGTQLEEILII  388 (397)
Q Consensus       309 ~~g~~V~~v~~~spa~~aGl~~~~~~~~~~l~~GDiI~~vng~~v~~~~d~~~~l~~~~~g~~v~l~v~R~g~~~~~~v~  388 (397)
                      ..|++|.+|.++|||+++||++..++..+.|+.||+|++|||++|.++.|+..+|...++|++++|+|+|+|++++++++
T Consensus       250 ~~Gv~V~~V~~~spA~~AGl~~~~~~~~~~l~~GDvI~~ing~~v~~~~dl~~~l~~~~~g~~v~l~v~R~g~~~~~~v~  329 (348)
T 3qo6_A          250 VSGVLVLDAPPSGPAGKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRGDHKEKISVT  329 (348)
T ss_dssp             CSSEEEEECCSSSHHHHHTCCCCEECSSSCEECCCEECEETTBCCSSSHHHHHHHTTCCTTCEEEEEEECSSSEEEEEEE
T ss_pred             CceEEEEEecCCChHHHcCCccccccccCCCCCCCEEEEECCEEeCCHHHHHHHHHhCCCcCEEEEEEEECCEEEEEEEE
Confidence            68999999999999999999998889999999999999999999999999999998888999999999999999999999


Q ss_pred             eeeCCCC
Q 015960          389 LEVEPDE  395 (397)
Q Consensus       389 l~~~~~~  395 (397)
                      +.+++++
T Consensus       330 l~~~~~~  336 (348)
T 3qo6_A          330 LEPKPDE  336 (348)
T ss_dssp             CEECC--
T ss_pred             EccCCCC
Confidence            9988754
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... Back     alignment and structure
>2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Back     alignment and structure
>1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* Back     alignment and structure
>4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} Back     alignment and structure
>2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B Back     alignment and structure
>3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A Back     alignment and structure
>3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B Back     alignment and structure
>3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A Back     alignment and structure
>2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* Back     alignment and structure
>1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A Back     alignment and structure
>4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Back     alignment and structure
>3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 1e-35
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 7e-34
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 2e-33
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 5e-31
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 7e-29
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 7e-29
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 5e-28
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 2e-27
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 1e-25
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 5e-25
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 2e-23
d1lvmb_219 b.47.1.3 (B:) TEV protease (nucleat inclusion prot 2e-18
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 9e-15
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 2e-14
d1cqqa_180 b.47.1.4 (A:) 3C cysteine protease (picornain 3C) 6e-11
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 5e-09
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 1e-08
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 1e-07
d1sota199 b.36.1.4 (A:255-353) Stress sensor protease DegS, 2e-07
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 2e-07
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-07
d1ky9a194 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-t 2e-06
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 1e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-04
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.001
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 0.001
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 0.003
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease PepD
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  128 bits (321), Expect = 1e-35
 Identities = 75/226 (33%), Positives = 107/226 (47%), Gaps = 29/226 (12%)

Query: 84  AGIFEENLPSVVHITNFGMNTFTLTMEYPQATGTGFIWDEDGHIVTNHHVIEGASSVK-- 141
             +  + +PSVV +                  G+G I   +G I+TN+HVI  A+     
Sbjct: 4   EQVAAKVVPSVVMLETDLGRQ--------SEEGSGIILSAEGLILTNNHVIAAAAKPPLG 55

Query: 142 -------VTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKVYA 194
                  VT  D  T    VVG D  +D+AV+ +   +     I +G S++LR+GQ V A
Sbjct: 56  SPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGL-TPISLGSSSDLRVGQPVLA 114

Query: 195 IGHPLGRKFTCTAGIISAFGLEPITATG----PPIQGLIQIDAAINRGNSGGPLLDSSGS 250
           IG PLG + T T GI+SA      T         +   IQ DAAIN GNSGG L++ +  
Sbjct: 115 IGSPLGLEGTVTTGIVSALNRPVSTTGEAGNQNTVLDAIQTDAAINPGNSGGALVNMNAQ 174

Query: 251 LIGVNTSIIT-------RTDAFCGMACSIPIDTVSGIVDQLVKFGK 289
           L+GVN++I T             G+  +IP+D    I D+L+  GK
Sbjct: 175 LVGVNSAIATLGADSADAQSGSIGLGFAIPVDQAKRIADELISTGK 220
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Length = 180 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 94 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 100.0
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 100.0
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 100.0
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 100.0
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 100.0
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.91
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.89
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.86
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.77
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.76
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.75
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.72
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.69
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.66
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.62
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.61
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.6
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.56
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.56
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 99.36
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.35
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.35
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.34
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.33
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.32
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.32
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.32
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.31
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.3
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 99.29
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.29
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.28
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.28
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.27
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.26
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.26
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.24
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.23
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.22
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.22
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.2
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.19
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.17
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.17
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.16
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.16
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.14
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.14
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.13
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.13
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.12
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 99.12
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.12
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.11
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.1
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.1
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.09
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.09
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.08
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.07
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.06
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.05
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.04
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.03
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.03
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.02
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.02
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 98.96
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 98.95
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 98.95
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 98.87
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.79
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.73
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.7
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.63
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.62
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.6
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.59
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.56
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.55
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.54
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.52
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.52
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.47
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.46
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.46
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.45
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.44
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.42
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.42
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.41
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.41
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.39
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.38
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.38
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.37
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.34
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.34
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.33
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.32
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.31
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.31
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.31
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.3
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.28
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.27
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.23
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.22
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.2
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.2
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.17
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.17
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.15
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.13
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.13
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.12
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.06
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.05
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.04
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 98.03
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.03
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.98
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.85
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.59
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 97.57
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 97.34
d2fp7b1152 NS3 protease {West nile virus [TaxId: 11082]} 93.66
d2fomb1150 NS3 protease {Dengue virus type 2 [TaxId: 11060]} 93.32
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 90.75
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 90.62
d1vcpa_149 Viral capsid protein {Semliki forest virus [TaxId: 90.41
g1dy9.1187 NS3 protease {Human hepatitis C virus (HCV), diffe 81.54
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.3e-38  Score=290.54  Aligned_cols=173  Identities=42%  Similarity=0.713  Sum_probs=155.5

Q ss_pred             ceeEEEEEcCC-CEEEEcccccCCCCeEEEEecCCcEEEEEEEEEcCCCCeEEEEEcCCCCCcceeecCCCCCCCCCCeE
Q 015960          114 ATGTGFIWDED-GHIVTNHHVIEGASSVKVTLFDKTTLDAKVVGHDQGTDLAVLHIDAPNHKLRSIPVGVSANLRIGQKV  192 (397)
Q Consensus       114 ~~GSG~ii~~~-G~ILT~aHvv~~~~~i~V~~~~g~~~~a~vv~~d~~~DlAlL~v~~~~~~~~~~~l~~s~~~~~G~~V  192 (397)
                      +.||||+|+++ ||||||+|||+++..+.|.+.+++.++|+++..|+..|+|+|+++.+. .+++++++++..++.||+|
T Consensus        76 ~~GSG~iI~~~~g~IlTn~HVv~~~~~~~v~~~~~~~~~a~~~~~d~~~dlavl~i~~~~-~~~~~~l~~~~~~~~G~~v  154 (249)
T d1ky9a2          76 ALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPK-NLTAIKMADSDALRVGDYT  154 (249)
T ss_dssp             EEEEEEEEETTTTEEEEEHHHHTTEEEEEEEETTSCEEEEEEEEEETTTTEEEEEESSCC-SCCCCCBCCGGGCCTTCEE
T ss_pred             ccccEEEEeccCceEEeeccccccceeeeeeecccccccceeeEeccchhhceeeecccc-cceEEEcCCcCcCCcCCEE
Confidence            57999999875 899999999999999999999999999999999999999999998753 7899999988889999999


Q ss_pred             EEEecCCCCCCceeeeEEeeccccccCCCCCCcccEEEEccccCCCCcccceecCCccEEEEEeeeeccCCCccCceeeE
Q 015960          193 YAIGHPLGRKFTCTAGIISAFGLEPITATGPPIQGLIQIDAAINRGNSGGPLLDSSGSLIGVNTSIITRTDAFCGMACSI  272 (397)
Q Consensus       193 ~~iG~p~g~~~~~~~G~vs~~~~~~~~~~~~~~~~~i~~~~~i~~G~SGGPlvn~~G~vVGI~s~~~~~~~~~~~~~~ai  272 (397)
                      +++|||++...+++.+.++...+.....  .....++|+|+++++|||||||+|.+|+||||+++.+...+...+++|||
T Consensus       155 ~aiG~P~g~~~tvt~~~~~~~~~~~~~~--~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faI  232 (249)
T d1ky9a2         155 VAIGNPFGLGETVTSGIVSALGRSGLNA--ENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAI  232 (249)
T ss_dssp             EEEECTTSSSCEEEEEEEEEESSCC-------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEE
T ss_pred             EEEecccccCCceeecceeecccccccC--ccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEE
Confidence            9999999999999999998887654322  23356899999999999999999999999999999987776678899999


Q ss_pred             eccchhHHHHHHHhccc
Q 015960          273 PIDTVSGIVDQLVKFGK  289 (397)
Q Consensus       273 p~~~i~~~~~~l~~~g~  289 (397)
                      |++.+++++++|+++|+
T Consensus       233 P~~~~~~~~~~l~~~G~  249 (249)
T d1ky9a2         233 PSNMVKNLTSQMVEYGQ  249 (249)
T ss_dssp             EHHHHHHHHHHHHHHSS
T ss_pred             EHHHHHHHHHHHHHhCc
Confidence            99999999999999875
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} Back     information, alignment and structure
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} Back     information, alignment and structure