Citrus Sinensis ID: 015999


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
cEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccccEEEEEEcccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHcHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHcccccccc
cEEEEEEccccEEEEEEccHHHHHHHHHHHHHHcccccccHHHHHEEEcccEEcccccHHHccEccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHcccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHcccccccccccccccccccccEEEEcHHHHHHHHHHHHccccHHHEEEEEEEccccHHHHHHHHHHccccccc
MKVFVKTlkgthfeievkpedkvsdVKKNIetvqgsdvypasQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYsgipeqtavppvarasaggqagnppaqtqaqqpaapaptsgpnanpldlfpqglpnmgsnagagtLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLinepveggegnvLGQLAsampqavtvtpEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
mkvfvktlkgthfeievkpedkvsdvkKNIETvqgsdvypasqQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVlrllprhnqrlhlrllhqlwhrhnlslnlllllllllllllllllqlHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARasaggqagnppaqtqaqqpaapaptsgpNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
****VKTLKGTHFEI*********************DVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGI**************************************************************LDFLR***QFQALRTMVQANPQILQPML*******PHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLA******VT*******AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH******
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLT***********************************************************************************************************************************************************************************************************QQFQ***************MLQELG***P*********************************************EREAIERLEAMGFDRALVLEVFFACNKNEELAANYL**H******
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVA***************************GPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKV************************************************************************************VAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE**********************************************************GTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP***************MPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
Q84L31419 Putative DNA repair prote yes no 0.624 0.591 0.820 1e-117
Q40742392 Probable DNA repair prote yes no 0.969 0.982 0.567 1e-116
Q84L32368 Putative DNA repair prote no no 0.919 0.991 0.52 1e-108
Q84L30378 Putative DNA repair prote no no 0.619 0.650 0.797 1e-107
Q84L33371 Putative DNA repair prote no no 0.591 0.633 0.630 9e-85
P54728416 UV excision repair protei yes no 0.549 0.524 0.379 1e-37
Q4KMA2415 UV excision repair protei yes no 0.549 0.525 0.373 1e-37
Q29RK4408 UV excision repair protei yes no 0.541 0.526 0.392 4e-37
P54727409 UV excision repair protei yes no 0.549 0.533 0.385 4e-37
O74803368 UV excision repair protei yes no 0.886 0.956 0.313 8e-36
>sp|Q84L31|RD23C_ARATH Putative DNA repair protein RAD23-3 OS=Arabidopsis thaliana GN=RAD23-3 PE=2 SV=2 Back     alignment and function desciption
 Score =  421 bits (1082), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/256 (82%), Positives = 227/256 (88%), Gaps = 8/256 (3%)

Query: 147 LHSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLY 206
           + S  DVYGQAASNL AGSNLE+T+QQILDMGGG+WDRETV+ ALRAA+NNPERAVEYLY
Sbjct: 167 VGSQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLY 226

Query: 207 SGIPEQTAVPPVARASA-GGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGS 265
           +GIPEQ  VPPVAR  A  GQ  NPPAQTQ  QPAA AP SGPNANPLDLFPQGLPN+G 
Sbjct: 227 TGIPEQAEVPPVARPPASAGQPANPPAQTQ--QPAA-APASGPNANPLDLFPQGLPNVGG 283

Query: 266 NAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLIN 325
           N GAGTLDFLRNSQQFQALR MVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQ DFLRLIN
Sbjct: 284 NPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLIN 343

Query: 326 EPVEGG--EGNVLGQLASAM--PQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNE 381
           EPVEGG   GN+LGQ+A+ M  PQA+ VT EEREAIERLEAMGF+RALVLEVFFACNKNE
Sbjct: 344 EPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNE 403

Query: 382 ELAANYLLDHMHEFED 397
           ELAANYLLDHMHEFE+
Sbjct: 404 ELAANYLLDHMHEFEE 419




May be involved in nucleotide excision repair.
Arabidopsis thaliana (taxid: 3702)
>sp|Q40742|RAD23_ORYSJ Probable DNA repair protein RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 Back     alignment and function description
>sp|Q84L32|RD23B_ARATH Putative DNA repair protein RAD23-2 OS=Arabidopsis thaliana GN=RAD23-2 PE=2 SV=2 Back     alignment and function description
>sp|Q84L30|RD23D_ARATH Putative DNA repair protein RAD23-4 OS=Arabidopsis thaliana GN=RAD23-4 PE=2 SV=2 Back     alignment and function description
>sp|Q84L33|RD23A_ARATH Putative DNA repair protein RAD23-1 OS=Arabidopsis thaliana GN=RAD23-1 PE=2 SV=3 Back     alignment and function description
>sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 Back     alignment and function description
>sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 Back     alignment and function description
>sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 Back     alignment and function description
>sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 Back     alignment and function description
>sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
255551362381 uv excision repair protein rad23, putati 0.937 0.976 0.692 1e-148
225452017381 PREDICTED: putative DNA repair protein R 0.957 0.997 0.698 1e-147
77999269382 unknown [Solanum tuberosum] 0.962 1.0 0.680 1e-142
225452019361 PREDICTED: putative DNA repair protein R 0.906 0.997 0.650 1e-133
225423953397 PREDICTED: putative DNA repair protein R 0.619 0.619 0.876 1e-124
90657662435 hypothetical protein [Cleome spinosa] 0.622 0.567 0.864 1e-121
363807216400 uncharacterized protein LOC100813881 [Gl 0.619 0.615 0.847 1e-120
255636381382 unknown [Glycine max] 0.619 0.643 0.847 1e-119
356575534402 PREDICTED: putative DNA repair protein R 0.619 0.611 0.831 1e-118
197717669390 RAD23 [Pinus sylvestris var. mongolica] 0.964 0.982 0.574 1e-118
>gi|255551362|ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis] gi|223544100|gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  532 bits (1370), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 281/406 (69%), Positives = 308/406 (75%), Gaps = 34/406 (8%)

Query: 1   MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE 60
           MKVFVKTLKGT+FEI+VKPED V DVK NIE  QG+DVYPASQQMLIHQGKVLKD TTLE
Sbjct: 1   MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE 60

Query: 61  ENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRP-KLQVLRLLPRHNQRLHLRL---- 115
           ENKVAENSF+V+ML+K     +V P          P + Q    LP    +         
Sbjct: 61  ENKVAENSFIVIMLSK----RKVSPSGGSTASSAPPSQAQPASTLPPSATQPSTTAQAPA 116

Query: 116 ----LHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATV 171
               L Q        +N                  + S +D+YGQAASNLVAGSNLEATV
Sbjct: 117 VTAELPQSAAESTPVVN-----------------PVSSETDIYGQAASNLVAGSNLEATV 159

Query: 172 QQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPP 231
           QQILDMGGGSWDRETV RALRAA+NNPERAVEYLYSGIPEQ  V P+ RA + GQA  P 
Sbjct: 160 QQILDMGGGSWDRETVARALRAAFNNPERAVEYLYSGIPEQPEVQPLPRAPSSGQAAIPS 219

Query: 232 AQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQAN 291
           A   AQ+PAAP  + G NANPLDLFPQGLP +GS   AGTLDFLRNSQQFQALR MVQAN
Sbjct: 220 AT--AQEPAAPT-SGGANANPLDLFPQGLPTIGSTTSAGTLDFLRNSQQFQALRAMVQAN 276

Query: 292 PQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTP 351
           PQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE G+GN+LGQLASA+PQ+V+VTP
Sbjct: 277 PQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE-GDGNLLGQLASAVPQSVSVTP 335

Query: 352 EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED 397
           EEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMH+FE+
Sbjct: 336 EEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHDFEE 381




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225452017|ref|XP_002283656.1| PREDICTED: putative DNA repair protein RAD23-3 isoform 1 [Vitis vinifera] gi|296087286|emb|CBI33660.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|77999269|gb|ABB16981.1| unknown [Solanum tuberosum] Back     alignment and taxonomy information
>gi|225452019|ref|XP_002283661.1| PREDICTED: putative DNA repair protein RAD23-3 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225423953|ref|XP_002282352.1| PREDICTED: putative DNA repair protein RAD23-3 [Vitis vinifera] gi|297737829|emb|CBI27030.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|90657662|gb|ABD96960.1| hypothetical protein [Cleome spinosa] Back     alignment and taxonomy information
>gi|363807216|ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max] gi|255641670|gb|ACU21107.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255636381|gb|ACU18529.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356575534|ref|XP_003555895.1| PREDICTED: putative DNA repair protein RAD23-3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|197717669|gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2076944419 RAD23C "RADIATION SENSITIVE23C 0.622 0.589 0.754 3e-129
TAIR|locus:2177376378 RAD23D "RADIATION SENSITIVE23D 0.619 0.650 0.757 9.2e-124
TAIR|locus:2200522368 RAD23A "RADIATION SENSITIVE23A 0.596 0.644 0.582 1.1e-95
UNIPROTKB|D4AD39363 Rad23a "RAD23a homolog (S. cer 0.322 0.352 0.460 2.7e-56
UNIPROTKB|A3KMV2362 RAD23A "UV excision repair pro 0.327 0.359 0.446 3.4e-56
MGI|MGI:105126363 Rad23a "RAD23a homolog (S. cer 0.322 0.352 0.453 3.4e-56
UNIPROTKB|P54725363 RAD23A "UV excision repair pro 0.322 0.352 0.453 4.4e-56
UNIPROTKB|F1SD96380 RAD23A "Uncharacterized protei 0.322 0.336 0.453 9e-56
UNIPROTKB|F1PTL1362 RAD23A "Uncharacterized protei 0.327 0.359 0.439 9e-56
ZFIN|ZDB-GENE-040808-59362 rad23aa "RAD23 homolog Aa (S. 0.350 0.383 0.440 1.9e-55
TAIR|locus:2076944 RAD23C "RADIATION SENSITIVE23C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 954 (340.9 bits), Expect = 3.0e-129, Sum P(2) = 3.0e-129
 Identities = 191/253 (75%), Positives = 207/253 (81%)

Query:   149 SVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG 208
             S  DVYGQAASNL AGSNLE+T+QQILDMGGG+WDRETV+ ALRAA+NNPERAVEYLY+G
Sbjct:   169 SQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTG 228

Query:   209 IPEQTAVPPVARXXXXXXXXXXXXXXXXXXXXXXXXXXXXNANPLDLFPQGLPNMGSNAG 268
             IPEQ  VPPVAR                            NANPLDLFPQGLPN+G N G
Sbjct:   229 IPEQAEVPPVARPPASAGQPANPPAQTQQPAAAPASGP--NANPLDLFPQGLPNVGGNPG 286

Query:   269 AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV 328
             AGTLDFLRNSQQFQALR MVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQ DFLRLINEPV
Sbjct:   287 AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV 346

Query:   329 EGG--EGNVLGQLASAMPQ--AVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA 384
             EGG   GN+LGQ+A+ MPQ  A+ VT EEREAIERLEAMGF+RALVLEVFFACNKNEELA
Sbjct:   347 EGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELA 406

Query:   385 ANYLLDHMHEFED 397
             ANYLLDHMHEFE+
Sbjct:   407 ANYLLDHMHEFEE 419


GO:0003684 "damaged DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006289 "nucleotide-excision repair" evidence=IEA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0043130 "ubiquitin binding" evidence=IDA
GO:0070628 "proteasome binding" evidence=IDA
TAIR|locus:2177376 RAD23D "RADIATION SENSITIVE23D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200522 RAD23A "RADIATION SENSITIVE23A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|D4AD39 Rad23a "RAD23a homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV2 RAD23A "UV excision repair protein RAD23 homolog A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:105126 Rad23a "RAD23a homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P54725 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD96 RAD23A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTL1 RAD23A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040808-59 rad23aa "RAD23 homolog Aa (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q40742RAD23_ORYSJNo assigned EC number0.56750.96970.9821yesno
O74803RHP23_SCHPONo assigned EC number0.31380.88660.9565yesno
Q84L31RD23C_ARATHNo assigned EC number0.82030.62460.5918yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
TIGR00601378 TIGR00601, rad23, UV excision repair protein Rad23 1e-76
cd0180577 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 5e-32
TIGR00601378 TIGR00601, rad23, UV excision repair protein Rad23 5e-20
smart0021372 smart00213, UBQ, Ubiquitin homologues 1e-17
pfam0928059 pfam09280, XPC-binding, XPC-binding domain 1e-17
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 9e-16
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 3e-15
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 6e-09
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 1e-08
pfam0062737 pfam00627, UBA, UBA/TS-N domain 1e-08
cd0180376 cd01803, Ubiquitin, Ubiquitin 4e-08
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 8e-08
smart0016537 smart00165, UBA, Ubiquitin associated domain 1e-07
cd0019438 cd00194, UBA, Ubiquitin Associated domain 4e-07
pfam0062737 pfam00627, UBA, UBA/TS-N domain 1e-06
cd0019438 cd00194, UBA, Ubiquitin Associated domain 2e-06
cd01802103 cd01802, AN1_N, ubiquitin-like domain of AN1 2e-06
pfam1197672 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- 1e-05
smart0016537 smart00165, UBA, Ubiquitin associated domain 4e-05
PTZ0004476 PTZ00044, PTZ00044, ubiquitin; Provisional 5e-04
cd0181271 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 0.001
cd0179870 cd01798, parkin_N, amino-terminal ubiquitin-like o 0.002
cd0180871 cd01808, hPLIC_N, Ubiquitin-like domain of hPLIC-1 0.002
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
 Score =  242 bits (618), Expect = 1e-76
 Identities = 109/254 (42%), Positives = 148/254 (58%), Gaps = 21/254 (8%)

Query: 149 SVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSG 208
           SV      AAS LV GS  E T+++I++MG   ++RE V RALRAA+NNP+RAVEYL +G
Sbjct: 138 SVPSSGSDAASTLVVGSERETTIEEIMEMG---YEREEVERALRAAFNNPDRAVEYLLTG 194

Query: 209 IPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAG 268
           IPE    P   + +A   A       Q       A   G             P   +  G
Sbjct: 195 IPEDPEQPEPVQQTAASTAAATTETPQHGSVFEQAAQGGTEQ----------PATEAAQG 244

Query: 269 AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV 328
              L+FLRN  QFQ LR +VQ NPQ+L P+LQ++G++NP L++ I +H   FL+++NEPV
Sbjct: 245 GNPLEFLRNQPQFQQLRQVVQQNPQLLPPLLQQIGQENPQLLQQISQHPEQFLQMLNEPV 304

Query: 329 EG--GEGNVLGQLASAMPQA------VTVTPEEREAIERLEAMGFDRALVLEVFFACNKN 380
                E ++ G + +           + VTPEE+EAIERL A+GFDR LV++ +FAC+KN
Sbjct: 305 GELASESDMEGGVGAIAEAGLPQMNQIQVTPEEKEAIERLCALGFDRGLVIQAYFACDKN 364

Query: 381 EELAANYLLDHMHE 394
           EELAANYLL    +
Sbjct: 365 EELAANYLLSQNFD 378


All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 378

>gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|192241 pfam09280, XPC-binding, XPC-binding domain Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|176397 cd01802, AN1_N, ubiquitin-like domain of AN1 Back     alignment and domain information
>gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|185411 PTZ00044, PTZ00044, ubiquitin; Provisional Back     alignment and domain information
>gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 Back     alignment and domain information
>gnl|CDD|176393 cd01798, parkin_N, amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>gnl|CDD|176403 cd01808, hPLIC_N, Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
KOG0011340 consensus Nucleotide excision repair factor NEF2, 100.0
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 100.0
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 99.83
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.76
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.74
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 99.74
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.73
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.72
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.72
PTZ0004476 ubiquitin; Provisional 99.71
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.7
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.69
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.68
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.68
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.68
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.68
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.68
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.67
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.66
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.65
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.65
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.63
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.61
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.59
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.57
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.56
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.54
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.48
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.44
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.44
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.44
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.4
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.33
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.29
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.28
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.19
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.03
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 98.91
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.91
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 98.89
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 98.87
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.86
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.81
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 98.8
PLN02560308 enoyl-CoA reductase 98.8
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.73
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.67
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.66
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.65
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.61
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.61
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.39
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.38
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 98.27
KOG1872473 consensus Ubiquitin-specific protease [Posttransla 98.16
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 98.01
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 97.77
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 97.66
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 97.6
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 97.43
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 97.37
KOG4495110 consensus RNA polymerase II transcription elongati 97.37
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 97.34
KOG4583391 consensus Membrane-associated ER protein involved 97.29
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.09
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 97.03
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.99
COG541781 Uncharacterized small protein [Function unknown] 96.85
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 96.8
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.79
KOG1639297 consensus Steroid reductase required for elongatio 96.76
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 96.73
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 96.73
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 96.63
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 96.6
KOG0013231 consensus Uncharacterized conserved protein [Funct 96.56
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 96.43
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 96.35
smart0072741 STI1 Heat shock chaperonin-binding motif. 96.32
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 96.24
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 96.1
PF13019162 Telomere_Sde2: Telomere stability and silencing 95.98
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 95.95
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 95.93
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 95.88
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 95.64
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 95.42
smart0054643 CUE Domain that may be involved in binding ubiquit 95.31
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 94.95
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 94.93
smart0054643 CUE Domain that may be involved in binding ubiquit 94.86
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 94.38
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 93.76
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 93.2
PF1445357 ThiS-like: ThiS-like ubiquitin 93.18
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 93.05
KOG0012380 consensus DNA damage inducible protein [Replicatio 92.58
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 92.36
PRK0643767 hypothetical protein; Provisional 92.36
PLN0279982 Molybdopterin synthase sulfur carrier subunit 90.94
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 90.82
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 90.2
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 89.71
PRK0836470 sulfur carrier protein ThiS; Provisional 89.57
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 89.03
PRK0648865 sulfur carrier protein ThiS; Validated 89.02
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 88.72
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 88.65
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 88.56
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 88.53
PF10209122 DUF2340: Uncharacterized conserved protein (DUF234 87.05
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 86.96
PF1154753 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro 86.64
PF12754309 Blt1: Cell-cycle control medial ring component; In 86.57
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 86.53
cd0792281 CarBa CarBa is the A subunit of 2-aminophenol 1,6- 84.54
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 83.44
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 83.14
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 82.87
PRK0586365 sulfur carrier protein ThiS; Provisional 81.66
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 81.48
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 81.35
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 80.87
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 80.59
PF0893879 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This 80.59
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 80.37
PF0893879 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This 80.12
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
Probab=100.00  E-value=2.2e-88  Score=651.88  Aligned_cols=339  Identities=55%  Similarity=0.810  Sum_probs=271.0

Q ss_pred             CEEEEEeCCCcEEEEEeCCCCCHHHHHHHHHHHhCCCCCCCCCeEEEeCCeecCCCCchhhcccCCCCEEEEEEeecCCC
Q 015999            1 MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIRF   80 (397)
Q Consensus         1 MkI~Vktl~gk~~~veV~~~~TV~dLK~~I~~~~g~~~ip~~~qrLiy~GKiL~D~~tL~d~gI~~gstI~v~v~k~~~~   80 (397)
                      |+|+||++++.+|+++|.+++||.++|++|+...|.+ +|+++|||||+||+|+|+++|++|+|+++++|+||++|+|..
T Consensus         1 m~lt~KtL~q~~F~iev~Pe~tV~evK~kIet~~g~d-yP~~~QkLIy~GkiL~D~~tv~Eykv~E~~fiVvMlsK~k~~   79 (340)
T KOG0011|consen    1 MKLTVKTLKQQTFTIEVKPEDTVVEVKKKIETEKGPD-YPAEQQKLIYSGKILKDETTVGEYKVKEKKFIVVMLSKDKSA   79 (340)
T ss_pred             CeeEeeeccCceeEeecCcchhHHHHHHHHHhccCCC-CchhhheeeecceeccCCcchhhhccccCceEEEEEecCccc
Confidence            8999999999999999999999999999999999988 999999999999999999999999999999999999998831


Q ss_pred             CCCCCCcccccCCCCCccccccCCCCCchhhHHHHhhhhhhccccchhhHHHHHHHHHHHHHHhhccCCCCccccccccc
Q 015999           81 HQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLWHRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASN  160 (397)
Q Consensus        81 ~~~~~~~~~~~~~~~p~~~~~a~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~s~  160 (397)
                      .+..++.+. +..+-|   ..+.+|+.+..            . .. .++ ++            ..++..+.++.++|+
T Consensus        80 ~t~~ap~s~-~~~~~p---~~~~ap~~s~a------------~-~~-s~~-~~------------~~~~~~~~~~~aas~  128 (340)
T KOG0011|consen   80 STQVAPQSS-AATHLP---KAAEAPPSSAA------------E-DA-SPA-TP------------AQTSQEDTYEIAAST  128 (340)
T ss_pred             ccCCCCCCc-cccCCC---ccCCCCCcccc------------c-cC-CCC-cc------------ccccccchhhhhhhh
Confidence            111110000 000000   11111111110            0 00 000 00            011234456778899


Q ss_pred             ccCCcchHHHHHHHHHcCCCCCCHHHHHHHHHHhcCChHHHHHHHHcCCCCCCCCCccccccCCCCCCCCCCccccCCCC
Q 015999          161 LVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPA  240 (397)
Q Consensus       161 l~~g~~~e~~I~~i~~MG~~~f~r~~v~~ALrAafnNpdrAveyL~~GIP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (397)
                      |++|+++|.+|.+||+||   |+||+|+|||||||||||||||||++|||++...+.+...++..               
T Consensus       129 Lv~G~~~e~~V~~Im~MG---y~re~V~~AlRAafNNPeRAVEYLl~GIP~~~~~~~~~~~~~~~---------------  190 (340)
T KOG0011|consen  129 LVVGSEYEQTVQQIMEMG---YDREEVERALRAAFNNPERAVEYLLNGIPEDAEVPEPEKSTAAA---------------  190 (340)
T ss_pred             hhccchhHHHHHHHHHhC---ccHHHHHHHHHHhhCChhhhHHHHhcCCcccccCCcccCCcccC---------------
Confidence            999999999999999999   99999999999999999999999999999987666643211100               


Q ss_pred             CCCCCCCCCCCCCCCcCCCCCCCCCCCCCCchHHhhccHHHHHHHHHHHhCccchHHHHHHHhhhCHHHHHHHHHhHHHH
Q 015999          241 APAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDF  320 (397)
Q Consensus       241 ~~~~~~~~~~~~~~lf~~~~~~~~~~~~~~~l~~L~~~P~f~~lrq~vq~NP~ll~~~Lqqi~~~nP~l~~~I~~n~~~F  320 (397)
                      ...++   +.+|.++|++++....   |+++|+|||++|+|++||++|++||++|+++||+|+++||+|+++|++||++|
T Consensus       191 ~~~p~---~~~p~~~~~~~~~~~~---~~~~l~fLr~~~qf~~lR~~iqqNP~ll~~~Lqqlg~~nP~L~q~Iq~nqe~F  264 (340)
T KOG0011|consen  191 AELPA---NAQPLDLFPQGAVEAS---GGDPLEFLRNQPQFQQLRQMIQQNPELLHPLLQQLGKQNPQLLQLIQENQEAF  264 (340)
T ss_pred             CCCCC---CCChhhcCCccchhhh---cCCchhhhhccHHHHHHHHHHhhCHHHHHHHHHHHhhhCHHHHHHHHHHHHHH
Confidence            00011   3356788988665543   34899999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCCCCcccccccccCC-CcccCCHHHHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHhccCCCC
Q 015999          321 LRLINEPVEGGEGNVLGQLASAMP-QAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  395 (397)
Q Consensus       321 l~~l~~~~~~~~g~~~~~~~~~~~-~~~~lt~Ee~~ai~rL~~lGF~r~~~iqAy~ac~kne~~Aan~L~~~~~d~  395 (397)
                      |+||+++.+++++++.++.+..++ ..|++||||+++|+||++|||+|..|||||||||||||+||||||+++|||
T Consensus       265 l~mlnep~~~~~~~~~~~~~~~~~~~~I~vtpee~eAIeRL~alGF~ralViqayfACdKNEelAAN~Ll~~~f~d  340 (340)
T KOG0011|consen  265 LQLLNEPVEGGDGGGTGAPAAEGPGHQIQVTPEEKEAIERLEALGFPRALVIQAYFACDKNEELAANYLLSHSFED  340 (340)
T ss_pred             HHHhhcccccccccccccccccCCcceEecCHHHHHHHHHHHHhCCcHHHHHHHHHhcCccHHHHHHHHHhhccCC
Confidence            999999988766666676666665 689999999999999999999999999999999999999999999998543



>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG0013 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd07922 CarBa CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
1oqy_A368 Structure Of The Dna Repair Protein Hhr23a Length = 3e-33
2qsg_X171 Crystal Structure Of The Rad4-Rad23 Complex Length 2e-13
1uel_A95 Solution Structure Of Ubiquitin-Like Domain Of Hhr2 9e-13
1p1a_A85 Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Le 1e-12
1pve_A72 Solution Structure Of Xpc Binding Domain Of Hhr23b 2e-10
2f4m_B61 The Mouse Pngase-Hr23 Complex Reveals A Complete Re 3e-10
2wyq_A85 The Crystal Structure Of The Ubiquitin-Like (Ubl) D 2e-09
1p98_A78 High-Resolution Nmr Structure Of The Ubl-Domain Of 3e-09
1ify_A49 Solution Structure Of The Internal Uba Domain Of Hh 1e-08
1f4i_A45 Solution Structure Of The Hhr23a Uba(2) Mutant P333 8e-08
1dv0_A47 Refined Nmr Solution Structure Of The C-Terminal Ub 1e-07
3v6c_B91 Crystal Structure Of Usp2 In Complex With Mutated U 2e-07
3v6e_B91 Crystal Structure Of Usp2 And A Mutant Form Of Ubiq 9e-07
2k25_A103 Automated Nmr Structure Of The Ubb By Fapsy Length 9e-07
1tp4_A97 Solution Structure Of The Xpc Binding Domain Of Hhr 1e-06
3vdz_A111 Tailoring Encodable Lanthanide-Binding Tags As Mri 2e-06
2ojr_A111 Structure Of Ubiquitin Solved By Sad Using The Lant 2e-06
3k9o_B96 The Crystal Structure Of E2-25k And Ubb+1 Complex L 2e-06
1yx5_B98 Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le 4e-06
4ap4_C80 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 4e-06
3jvz_X81 E2~ubiquitin-Hect Length = 81 5e-06
3dvg_X80 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 5e-06
2k6d_B76 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 5e-06
3dvg_Y79 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 5e-06
2khw_B79 Solution Structure Of The Human Polymerase Iota Ubm 5e-06
2znv_C77 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 5e-06
2ld9_A77 Backbone Structure Of Ubiquitin Determined Using Ba 5e-06
3u30_A172 Crystal Structure Of A Linear-Specific Ubiquitin Fa 5e-06
3nob_A78 Structure Of K11-Linked Di-Ubiquitin Length = 78 5e-06
2znv_B76 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 6e-06
1aar_A76 Structure Of A Diubiquitin Conjugate And A Model Fo 6e-06
1xd3_B75 Crystal Structure Of Uchl3-Ubvme Complex Length = 7 6e-06
1cmx_B76 Structural Basis For The Specificity Of Ubiquitin C 6e-06
2zvn_A154 Nemo Cozi Domain Incomplex With Diubiquitin In P212 6e-06
2w9n_A152 Crystal Structure Of Linear Di-Ubiquitin Length = 1 6e-06
3b08_A152 Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl 6e-06
2xk5_B76 Crystal Structure Of K6-Linked Diubiquitin Length = 6e-06
2y5b_B152 Structure Of Usp21 In Complex With Linear Diubiquit 7e-06
2gbr_A81 Crystal Structure Of The 35-36 Moad Insertion Mutan 7e-06
3ai5_A307 Crystal Structure Of Yeast Enhanced Green Fluoresce 8e-06
4i6l_B76 Crystal Structure Of Otub1 In Complex With Ubiquiti 8e-06
3rul_A79 New Strategy To Analyze Structures Of Glycopeptide- 8e-06
3ldz_F73 Crystal Structure Of Human Stam1 Vhs Domain In Comp 8e-06
3ons_A72 Crystal Structure Of Human Ubiquitin In A New Cryst 8e-06
3u5e_m128 The Structure Of The Eukaryotic Ribosome At 3.0 A R 8e-06
1zgu_B76 Solution Structure Of The Human Mms2-Ubiquitin Comp 9e-06
2o6v_D76 Crystal Structure And Solution Nmr Studies Of Lys48 9e-06
1ud7_A76 Solution Structure Of The Designed Hydrophobic Core 1e-05
2zcb_A76 Crystal Structure Of Ubiquitin P37aP38A Length = 76 1e-05
3mtn_B85 Usp21 In Complex With A Ubiquitin-based, Usp21-spec 1e-05
4hjk_A77 U7ub7 Disulfide Variant Length = 77 1e-05
3dbh_I88 Structural Dissection Of A Gating Mechanism Prevent 1e-05
1sif_A88 Crystal Structure Of A Multiple Hydrophobic Core Mu 1e-05
1yiw_A76 X-Ray Crystal Structure Of A Chemically Synthesized 2e-05
3q3f_A189 Engineering Domain-Swapped Binding Interfaces By Mu 2e-05
2nvu_I81 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-05
3dbl_I88 Structural Dissection Of A Gating Mechanism Prevent 2e-05
1c3t_A76 Rotamer Strain As A Determinant Of Protein Structur 2e-05
2o6v_B76 Crystal Structure And Solution Nmr Studies Of Lys48 2e-05
3h7s_A76 Crystal Structures Of K63-Linked Di- And Tri-Ubiqui 2e-05
2bkr_B77 Nedd8 Nedp1 Complex Length = 77 2e-05
4f8c_B88 Structure Of The Cif:nedd8 Complex - Yersinia Pseud 2e-05
4hcp_B78 Crystal Structure Of Burkholderia Pseudomallei Effe 3e-05
1ndd_B76 Structure Of Nedd8 Length = 76 3e-05
3gzn_I82 Structure Of Nedd8-Activating Enzyme In Complex Wit 3e-05
4a18_K129 T.Thermophila 60s Ribosomal Subunit In Complex With 3e-05
1s1q_B76 Tsg101(Uev) Domain In Complex With Ubiquitin Length 3e-05
1yj1_A76 X-Ray Crystal Structure Of A Chemically Synthesized 3e-05
4ii3_B96 Crystal Structure Of S. Pombe Ubiquitin Activating 3e-05
1zw7_A82 Elimination Of The C-Cap In Ubiquitin Structure, Dy 3e-05
2fcs_A76 X-Ray Crystal Structure Of A Chemically Synthesized 4e-05
4hcn_B98 Crystal Structure Of Burkholderia Pseudomallei Effe 4e-05
1ogw_A76 Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Le 4e-05
1otr_B76 Solution Structure Of A Cue-Ubiquitin Complex Lengt 4e-05
3olm_D79 Structure And Function Of A Ubiquitin Binding Site 4e-05
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 4e-05
3u5g_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 4e-05
3zf7_s128 High-resolution Cryo-electron Microscopy Structure 4e-05
2jwz_A76 Mutations In The Hydrophobic Core Of Ubiquitin Diff 5e-05
4gsw_A80 Crystal Structure Of Ubiquitin From Entamoeba Histo 5e-05
3dqv_A81 Structural Insights Into Nedd8 Activation Of Cullin 6e-05
3u5c_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 8e-05
4hk2_A78 U7ub25.2540 Length = 78 1e-04
4ii2_B83 Crystal Structure Of Ubiquitin Activating Enzyme 1 1e-04
3n3k_B85 The Catalytic Domain Of Usp8 In Complex With A Usp8 1e-04
2gbm_A84 Crystal Structure Of The 35-36 8 Glycine Insertion 2e-04
1bt0_A76 Structure Of Ubiquitin-Like Protein, Rub1 Length = 2e-04
1gjz_A53 Solution Structure Of A Dimeric N-Terminal Fragment 5e-04
2kdi_A114 Solution Structure Of A UbiquitinUIM FUSION PROTEIN 7e-04
2gbk_A83 Crystal Structure Of The 9-10 Moad Insertion Mutant 7e-04
>pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 Back     alignment and structure

Iteration: 1

Score = 139 bits (349), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 94/249 (37%), Positives = 131/249 (52%), Gaps = 47/249 (18%) Query: 157 AASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVP 216 AAS LV GS E + +I+ MG ++RE V+ ALRA+YNNP RAVEYL +GIP Sbjct: 158 AASTLVTGSEYETMLTEIMSMG---YERERVVAALRASYNNPHRAVEYLLTGIP------ 208 Query: 217 PVARXXXXXXXXXXXXXXXXXXXXXXXXXXXXNANPLDLFPQGLPNMGSNAGAGTLDFLR 276 NPL +FLR Sbjct: 209 --------GSPEPEHGSVQESQVSEQPATEAAGENPL-------------------EFLR 241 Query: 277 NSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP------VEG 330 + QFQ +R ++Q NP +L +LQ+LG++NP L++ I HQ F++++NEP + Sbjct: 242 DQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISD 301 Query: 331 GEGNVLGQLASAMPQA--VTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL 388 EG V G + PQ + VTP+E+EAIERL+A+GF +LV++ +FAC KNE LAAN+L Sbjct: 302 VEGEV-GAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFL 360 Query: 389 LDHMHEFED 397 L F+D Sbjct: 361 LS--QNFDD 367
>pdb|2QSG|X Chain X, Crystal Structure Of Rad4-Rad23 Bound To A Uv-Damaged Dna Length = 171 Back     alignment and structure
>pdb|1UEL|A Chain A, Solution Structure Of Ubiquitin-Like Domain Of Hhr23b Complexed With Ubiquitin-Interacting Motif Of Proteasome Subunit S5a Length = 95 Back     alignment and structure
>pdb|1P1A|A Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Length = 85 Back     alignment and structure
>pdb|1PVE|A Chain A, Solution Structure Of Xpc Binding Domain Of Hhr23b Length = 72 Back     alignment and structure
>pdb|2F4M|B Chain B, The Mouse Pngase-Hr23 Complex Reveals A Complete Remodulation Of The Protein-Protein Interface Compared To Its Yeast Orthologs Length = 61 Back     alignment and structure
>pdb|2WYQ|A Chain A, The Crystal Structure Of The Ubiquitin-Like (Ubl) Domain Of Hhr23a (Human Homologue A Of Rad23) Length = 85 Back     alignment and structure
>pdb|1P98|A Chain A, High-Resolution Nmr Structure Of The Ubl-Domain Of Hhr23a Length = 78 Back     alignment and structure
>pdb|1IFY|A Chain A, Solution Structure Of The Internal Uba Domain Of Hhr23a Length = 49 Back     alignment and structure
>pdb|1F4I|A Chain A, Solution Structure Of The Hhr23a Uba(2) Mutant P333e, Deficient In Binding The Hiv-1 Accessory Protein Vpr Length = 45 Back     alignment and structure
>pdb|1DV0|A Chain A, Refined Nmr Solution Structure Of The C-Terminal Uba Domain Of The Human Homologue Of Rad23a (Hhr23a) Length = 47 Back     alignment and structure
>pdb|3V6C|B Chain B, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 91 Back     alignment and structure
>pdb|3V6E|B Chain B, Crystal Structure Of Usp2 And A Mutant Form Of Ubiquitin Length = 91 Back     alignment and structure
>pdb|2K25|A Chain A, Automated Nmr Structure Of The Ubb By Fapsy Length = 103 Back     alignment and structure
>pdb|1TP4|A Chain A, Solution Structure Of The Xpc Binding Domain Of Hhr23a Protein Length = 97 Back     alignment and structure
>pdb|3VDZ|A Chain A, Tailoring Encodable Lanthanide-Binding Tags As Mri Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms Length = 111 Back     alignment and structure
>pdb|2OJR|A Chain A, Structure Of Ubiquitin Solved By Sad Using The Lanthanide- Binding Tag Length = 111 Back     alignment and structure
>pdb|3K9O|B Chain B, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 96 Back     alignment and structure
>pdb|1YX5|B Chain B, Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Length = 98 Back     alignment and structure
>pdb|4AP4|C Chain C, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 80 Back     alignment and structure
>pdb|3JVZ|X Chain X, E2~ubiquitin-Hect Length = 81 Back     alignment and structure
>pdb|3DVG|X Chain X, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 80 Back     alignment and structure
>pdb|2K6D|B Chain B, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|3DVG|Y Chain Y, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 79 Back     alignment and structure
>pdb|2KHW|B Chain B, Solution Structure Of The Human Polymerase Iota Ubm2- Ubiquitin Complex Length = 79 Back     alignment and structure
>pdb|2ZNV|C Chain C, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 77 Back     alignment and structure
>pdb|2LD9|A Chain A, Backbone Structure Of Ubiquitin Determined Using Backbone Amide Noes And Backbone N-H And N-C Rdcs Length = 77 Back     alignment and structure
>pdb|3U30|A Chain A, Crystal Structure Of A Linear-Specific Ubiquitin Fab Bound To Linear Ubiquitin Length = 172 Back     alignment and structure
>pdb|3NOB|A Chain A, Structure Of K11-Linked Di-Ubiquitin Length = 78 Back     alignment and structure
>pdb|2ZNV|B Chain B, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 76 Back     alignment and structure
>pdb|1AAR|A Chain A, Structure Of A Diubiquitin Conjugate And A Model For Interaction With Ubiquitin Conjugating Enzyme (E2) Length = 76 Back     alignment and structure
>pdb|1XD3|B Chain B, Crystal Structure Of Uchl3-Ubvme Complex Length = 75 Back     alignment and structure
>pdb|1CMX|B Chain B, Structural Basis For The Specificity Of Ubiquitin C- Terminal Hydrolases Length = 76 Back     alignment and structure
>pdb|2ZVN|A Chain A, Nemo Cozi Domain Incomplex With Diubiquitin In P212121 Space Group Length = 154 Back     alignment and structure
>pdb|2W9N|A Chain A, Crystal Structure Of Linear Di-Ubiquitin Length = 152 Back     alignment and structure
>pdb|3B08|A Chain A, Crystal Structure Of The Mouse Hoil1-L-Nzf In Complex With Linear Di- Ubiquitin Length = 152 Back     alignment and structure
>pdb|2XK5|B Chain B, Crystal Structure Of K6-Linked Diubiquitin Length = 76 Back     alignment and structure
>pdb|2Y5B|B Chain B, Structure Of Usp21 In Complex With Linear Diubiquitin-Aldehyde Length = 152 Back     alignment and structure
>pdb|2GBR|A Chain A, Crystal Structure Of The 35-36 Moad Insertion Mutant Of Ubiquitin Length = 81 Back     alignment and structure
>pdb|3AI5|A Chain A, Crystal Structure Of Yeast Enhanced Green Fluorescent Protein- Ubiquitin Fusion Protein Length = 307 Back     alignment and structure
>pdb|4I6L|B Chain B, Crystal Structure Of Otub1 In Complex With Ubiquitin Variant Length = 76 Back     alignment and structure
>pdb|3RUL|A Chain A, New Strategy To Analyze Structures Of Glycopeptide-Target Complexes Length = 79 Back     alignment and structure
>pdb|3LDZ|F Chain F, Crystal Structure Of Human Stam1 Vhs Domain In Complex With Ubiquitin Length = 73 Back     alignment and structure
>pdb|3ONS|A Chain A, Crystal Structure Of Human Ubiquitin In A New Crystal Form Length = 72 Back     alignment and structure
>pdb|3U5E|MM Chain m, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 60s Subunit, Ribosome A Length = 128 Back     alignment and structure
>pdb|1ZGU|B Chain B, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|2O6V|D Chain D, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|1UD7|A Chain A, Solution Structure Of The Designed Hydrophobic Core Mutant Of Ubiquitin, 1d7 Length = 76 Back     alignment and structure
>pdb|2ZCB|A Chain A, Crystal Structure Of Ubiquitin P37aP38A Length = 76 Back     alignment and structure
>pdb|3MTN|B Chain B, Usp21 In Complex With A Ubiquitin-based, Usp21-specific Inhibitor Length = 85 Back     alignment and structure
>pdb|4HJK|A Chain A, U7ub7 Disulfide Variant Length = 77 Back     alignment and structure
>pdb|3DBH|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 88 Back     alignment and structure
>pdb|1SIF|A Chain A, Crystal Structure Of A Multiple Hydrophobic Core Mutant Of Ubiquitin Length = 88 Back     alignment and structure
>pdb|1YIW|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized Ubiquitin Length = 76 Back     alignment and structure
>pdb|3Q3F|A Chain A, Engineering Domain-Swapped Binding Interfaces By Mutually Exclusive Folding: Insertion Of Ubiquitin Into Position 103 Of Barnase Length = 189 Back     alignment and structure
>pdb|2NVU|I Chain I, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 81 Back     alignment and structure
>pdb|3DBL|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 88 Back     alignment and structure
>pdb|1C3T|A Chain A, Rotamer Strain As A Determinant Of Protein Structural Specificity Length = 76 Back     alignment and structure
>pdb|2O6V|B Chain B, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|3H7S|A Chain A, Crystal Structures Of K63-Linked Di- And Tri-Ubiquitin Reveal A Highly Extended Chain Architecture Length = 76 Back     alignment and structure
>pdb|2BKR|B Chain B, Nedd8 Nedp1 Complex Length = 77 Back     alignment and structure
>pdb|4F8C|B Chain B, Structure Of The Cif:nedd8 Complex - Yersinia Pseudotuberculosis Cycle Inhibiting Factor In Complex With Human Nedd8 Length = 88 Back     alignment and structure
>pdb|4HCP|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Nedd8 Length = 78 Back     alignment and structure
>pdb|1NDD|B Chain B, Structure Of Nedd8 Length = 76 Back     alignment and structure
>pdb|3GZN|I Chain I, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 82 Back     alignment and structure
>pdb|4A18|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 129 Back     alignment and structure
>pdb|1S1Q|B Chain B, Tsg101(Uev) Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|1YJ1|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [d-Gln35]ubiquitin Length = 76 Back     alignment and structure
>pdb|4II3|B Chain B, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme 1 (uba1) In Complex With Ubiquitin And Atp/mg Length = 96 Back     alignment and structure
>pdb|1ZW7|A Chain A, Elimination Of The C-Cap In Ubiquitin Structure, Dynamics And Thermodynamic Consequences Length = 82 Back     alignment and structure
>pdb|2FCS|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [l-Gln35]ubiquitin With A Cubic Space Group Length = 76 Back     alignment and structure
>pdb|4HCN|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Ubiquitin Length = 98 Back     alignment and structure
>pdb|1OGW|A Chain A, Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Length = 76 Back     alignment and structure
>pdb|1OTR|B Chain B, Solution Structure Of A Cue-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|3OLM|D Chain D, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 79 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152 Back     alignment and structure
>pdb|3ZF7|SS Chain s, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 128 Back     alignment and structure
>pdb|2JWZ|A Chain A, Mutations In The Hydrophobic Core Of Ubiquitin Differentially Affect Its Recognition By Receptor Proteins Length = 76 Back     alignment and structure
>pdb|4GSW|A Chain A, Crystal Structure Of Ubiquitin From Entamoeba Histolytica To 2.15 Angstrom Length = 80 Back     alignment and structure
>pdb|3DQV|A Chain A, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 81 Back     alignment and structure
>pdb|3U5C|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 152 Back     alignment and structure
>pdb|4HK2|A Chain A, U7ub25.2540 Length = 78 Back     alignment and structure
>pdb|4II2|B Chain B, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 83 Back     alignment and structure
>pdb|3N3K|B Chain B, The Catalytic Domain Of Usp8 In Complex With A Usp8 Specific Inhibitor Length = 85 Back     alignment and structure
>pdb|2GBM|A Chain A, Crystal Structure Of The 35-36 8 Glycine Insertion Mutant Of Ubiquitin Length = 84 Back     alignment and structure
>pdb|1BT0|A Chain A, Structure Of Ubiquitin-Like Protein, Rub1 Length = 76 Back     alignment and structure
>pdb|1GJZ|A Chain A, Solution Structure Of A Dimeric N-Terminal Fragment Of Human Ubiquitin Length = 53 Back     alignment and structure
>pdb|2KDI|A Chain A, Solution Structure Of A UbiquitinUIM FUSION PROTEIN Length = 114 Back     alignment and structure
>pdb|2GBK|A Chain A, Crystal Structure Of The 9-10 Moad Insertion Mutant Of Ubiquitin Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 4e-86
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 1e-41
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 2e-35
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 1e-34
3m62_B106 UV excision repair protein RAD23; armadillo-like r 9e-30
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 2e-29
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 7e-23
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 2e-22
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 2e-22
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 8e-22
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 9e-22
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 3e-04
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 2e-21
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 5e-21
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 2e-20
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 2e-20
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 7e-20
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 2e-19
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 3e-19
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 4e-19
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 4e-19
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 1e-18
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 1e-18
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 2e-18
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 3e-18
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 3e-18
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 5e-18
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 1e-17
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 1e-17
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 2e-17
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 4e-17
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 7e-17
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 2e-16
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 3e-16
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 4e-16
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 4e-16
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 3e-15
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 5e-15
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 6e-15
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 1e-14
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 2e-14
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 1e-13
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 2e-13
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 2e-13
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 4e-13
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 1e-12
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 1e-06
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 1e-11
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 6e-06
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 2e-11
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 4e-11
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 2e-10
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 3e-07
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 2e-09
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 4e-09
1we6_A111 Splicing factor, putative; structural genomics, ub 5e-09
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 6e-09
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 1e-07
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 6e-09
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 2e-08
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 2e-08
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 4e-08
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 1e-06
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 2e-06
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 2e-06
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 2e-06
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 4e-06
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 6e-05
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 8e-06
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 1e-05
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 2e-05
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 3e-05
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 4e-05
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 4e-05
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 1e-04
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 1e-04
2fnj_B118 Transcription elongation factor B polypeptide 2; b 1e-04
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 1e-04
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 5e-04
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 8e-04
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 9e-04
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
 Score =  265 bits (678), Expect = 4e-86
 Identities = 120/403 (29%), Positives = 182/403 (45%), Gaps = 49/403 (12%)

Query: 1   MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE 60
           + + +KTL+   F+I ++P++ V  +K+ IE  +G D +P + Q LI+ GK+L D   + 
Sbjct: 8   VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIR 67

Query: 61  ENKVAENSFVVVMLTKVIRFHQVGPQLFQLHQQIRPKLQVLRLLPRHNQRLHLRLLHQLW 120
           + ++ E +FVVVM+TK                            P           H   
Sbjct: 68  DYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMS------HPPP 121

Query: 121 HRHNLSLNLLLLLLLLLLLLLLLLLQLHSVSDVYGQAASNLVAGSNLEATVQQILDMGGG 180
                               +   +     S     AAS LV GS  E  + +I+ MG  
Sbjct: 122 AAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMG-- 179

Query: 181 SWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPA 240
            ++RE V+ ALRA+YNNP RAVEYL +GIP                          +   
Sbjct: 180 -YERERVVAALRASYNNPHRAVEYLLTGIPG-----------------------SPEPEH 215

Query: 241 APAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQ 300
                S  +  P              AG   L+FLR+  QFQ +R ++Q NP +L  +LQ
Sbjct: 216 GSVQESQVSEQP----------ATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQ 265

Query: 301 ELGKQNPHLMRLIQEHQTDFLRLINEPVE-------GGEGNVLGQLASAMPQAVTVTPEE 353
           +LG++NP L++ I  HQ  F++++NEP                    +     + VTP+E
Sbjct: 266 QLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQE 325

Query: 354 REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE 396
           +EAIERL+A+GF  +LV++ +FAC KNE LAAN+LL    + E
Sbjct: 326 KEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE 368


>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Length = 72 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Length = 47 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Length = 61 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Length = 307 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Length = 105 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Length = 43 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Length = 93 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Length = 118 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 116 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 100.0
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 100.0
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.79
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 99.78
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.77
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.77
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.76
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 99.76
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.76
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.75
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.75
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.74
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.74
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.74
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.74
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.73
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.73
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.73
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.73
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.72
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.72
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.72
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.72
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.71
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.71
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.71
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.71
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.71
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.71
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.71
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.71
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.71
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.71
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.7
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.7
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.7
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.69
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.69
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.69
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.68
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.68
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.68
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.68
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.68
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.68
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.67
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.67
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.49
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.67
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.66
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.65
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.65
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.64
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.64
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.64
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.64
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.64
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.63
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.63
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.63
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.62
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.62
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.62
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.62
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.62
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.62
1we6_A111 Splicing factor, putative; structural genomics, ub 99.61
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.6
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.6
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.6
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.59
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.59
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.59
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.59
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.58
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.56
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.55
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.55
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.55
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.53
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.53
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.51
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.47
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.44
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.44
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.43
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.43
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.39
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.39
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.37
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.35
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.31
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.28
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.28
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.27
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 99.26
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.25
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 99.25
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 99.24
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 99.23
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.23
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.21
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.2
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 99.19
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.18
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.18
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.16
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.14
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 99.13
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.11
2dna_A67 Unnamed protein product; ubiquitin associated doma 99.11
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 99.1
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.08
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.06
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.05
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 99.04
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 99.04
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.03
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 99.01
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.01
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.01
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 99.0
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.0
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 98.99
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 98.99
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 98.99
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 98.98
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.98
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 98.98
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 98.97
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 98.96
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 98.96
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 98.95
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 98.94
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 98.93
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 98.92
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.92
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.91
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 98.9
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 98.89
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 98.87
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 98.87
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 98.86
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 98.84
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 98.83
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.81
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.8
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.79
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 98.78
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.77
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 98.77
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 98.76
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.75
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.75
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 98.69
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.66
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 98.57
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 98.52
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.51
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.49
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.49
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.47
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.46
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.46
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.46
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 98.4
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.39
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 98.36
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.28
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.28
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.16
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 98.13
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.12
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 98.11
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 98.1
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 98.0
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 97.91
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.86
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 97.8
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.78
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 97.78
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.76
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.72
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.69
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.61
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.6
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.33
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 97.29
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.27
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 97.2
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 97.11
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 97.03
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 96.63
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.52
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 96.08
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 96.06
2dhy_A67 CUE domain-containing protein 1; structural genomi 95.93
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 95.84
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 95.71
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 95.61
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 95.33
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 95.23
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 95.12
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 94.85
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 94.63
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 94.59
2dhy_A67 CUE domain-containing protein 1; structural genomi 94.58
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 94.46
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 94.27
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 94.17
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 93.57
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 93.41
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 93.39
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 93.39
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 93.32
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 93.25
2di0_A71 Activating signal cointegrator 1 complex subunit 2 93.22
4fp9_B 335 Mterf domain-containing protein 2; modification en 92.75
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 92.68
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 92.56
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 92.18
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 92.08
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 91.27
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 91.23
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 90.9
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 89.25
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 89.24
1ufz_A83 Hypothetical protein BAB28515; HBS1-like domain, s 89.04
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 88.76
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 88.16
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 87.79
2qho_B53 E3 ubiquitin-protein ligase EDD1; protein-protein 87.17
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 86.83
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 86.37
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 85.88
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 85.49
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 84.62
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 83.8
3hm6_X644 Plexin-B1; structural genomics consortium, SGC, me 83.64
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 83.37
3m66_A270 Mterf3, mterf domain-containing protein 1, mitocho 83.36
3kuz_A126 Plexin-C1; structural genomics, structural genomic 83.05
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 82.92
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 82.34
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 81.94
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 81.56
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 81.33
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 80.55
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 80.45
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 80.13
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
Probab=100.00  E-value=7.1e-73  Score=567.11  Aligned_cols=345  Identities=34%  Similarity=0.525  Sum_probs=244.1

Q ss_pred             CEEEEEeCCCcEEEEEeCCCCCHHHHHHHHHHH---hCCCCCCCCCeEEEeCCeecCCCCchhhcccCCCCEEEEEEeec
Q 015999            1 MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETV---QGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKV   77 (397)
Q Consensus         1 MkI~Vktl~gk~~~veV~~~~TV~dLK~~I~~~---~g~~~ip~~~qrLiy~GKiL~D~~tL~d~gI~~gstI~v~v~k~   77 (397)
                      |+|+||+++|++|.|+|++++||.+||++|+++   .|   +++++|||||+||+|+|+++|++|+|+++++|++++.+.
T Consensus         8 M~I~VKtl~Gk~~~leV~~~~TV~~LK~~I~~~~~~~g---ip~~~QrLiy~GK~L~D~~tL~dygI~~gstIv~lv~k~   84 (368)
T 1oqy_A            8 VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDA---FPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKT   84 (368)
T ss_dssp             CCEEEEETTTEEEEECCCTTCBHHHHHHHHHHHTCSSS---CCSTEEEEESSSSEECSSSBTTTTCCCTTSCEEEEEECC
T ss_pred             EEEEEEeCCCCEEEEEeCCCChHHHHHHHHHHHhCcCC---CChhheEEEECCeecCCcCCHHHcCCCCCCEEEEEEecC
Confidence            899999999999999999999999999999994   56   999999999999999999999999999999996666665


Q ss_pred             CCCCC-CCCCcccccCCCC---CccccccCCCCCchhhHHHHhhhhhhccc--cchhhHHHHHHHHHHHHHHhhccCCCC
Q 015999           78 IRFHQ-VGPQLFQLHQQIR---PKLQVLRLLPRHNQRLHLRLLHQLWHRHN--LSLNLLLLLLLLLLLLLLLLLQLHSVS  151 (397)
Q Consensus        78 ~~~~~-~~~~~~~~~~~~~---p~~~~~a~~p~~~~~~~~~~~~~~~~~~~--~~~~~~~~p~~~~~~~~~~~~~~~~~~  151 (397)
                      +..+. +.+..+.+.+.+.   ++.+.+...|.++.+       ...+...  ..+.++++|    ..++. ..+.....
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~p----~~~~~-~~~~~~~~  152 (368)
T 1oqy_A           85 KAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPP-------AAREDKSPSEESAPTTSP----ESVSG-SVPSSGSS  152 (368)
T ss_dssp             CSSSCCCCCSSCCCCCSSSCCCSCCCSSSCCCCCCCS-------SSSCCCCCSCSCCCCSST----TCSCC-CSCSCCCS
T ss_pred             CCCCCCCCCcccCCCCCccccCCCCCCCCCCCCCCCc-------cccccCCccccCCCCCCC----Ccccc-cccccccc
Confidence            54332 1111111111110   000000000000000       0000000  000000011    00000 00011112


Q ss_pred             cccccccccccCCcchHHHHHHHHHcCCCCCCHHHHHHHHHHhcCChHHHHHHHHcCCCCCCCCCccccccCCCCCCCCC
Q 015999          152 DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPP  231 (397)
Q Consensus       152 ~~~~~~~s~l~~g~~~e~~I~~i~~MG~~~f~r~~v~~ALrAafnNpdrAveyL~~GIP~~~~~~~~~~~~~~~~~~~~~  231 (397)
                      ..+..+.|+||+|+++|.+|++||+||   |+|++|++|||++|||||||||||++|||++.+...+    .    ..+ 
T Consensus       153 ~~~~~~~s~l~~g~~~~~~i~~l~~MG---f~~~~~~~AL~a~~nn~~~A~e~L~~gip~~~~~~~~----~----~~~-  220 (368)
T 1oqy_A          153 GREEDAASTLVTGSEYETMLTEIMSMG---YERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHG----S----VQE-  220 (368)
T ss_dssp             CCCCCCCTTTCCTTTHHHHHHHHHTTT---CCSHHHHHHHHHSCSSTTHHHHTTTTSSTTCSSCCCC----C----CCC-
T ss_pred             cccccccccccCCcchHHHHHHHHHcC---CCHHHHHHHHHHcCCCHHHHHHHHHhCCCcccccccC----C----ccc-
Confidence            334566899999999999999999999   9999999999999999999999999999987442210    0    000 


Q ss_pred             CccccCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCCchHHhhccHHHHHHHHHHHhCccchHHHHHHHhhhCHHHHH
Q 015999          232 AQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMR  311 (397)
Q Consensus       232 ~~~~~~~~~~~~~~~~~~~~~~~lf~~~~~~~~~~~~~~~l~~L~~~P~f~~lrq~vq~NP~ll~~~Lqqi~~~nP~l~~  311 (397)
                        .      ......                +.++++.++|+|||++|+|++||++||+||++|+++||+|+++||+|++
T Consensus       221 --~------~~~~~~----------------~~~~~~~~~l~~Lr~~pqf~~lR~~vq~nP~~l~~~lq~l~~~nP~l~~  276 (368)
T 1oqy_A          221 --S------QVSEQP----------------ATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQ  276 (368)
T ss_dssp             --C------CSSCCC----------------CSSCCSCCTTHHHHHSHHHHHHHHSTTTCTTHHHHHHTTTTTTCHHHHH
T ss_pred             --c------cccccc----------------CccccccchHHHHhcChHHHHHHHHHHhChHHHHHHHHHHHhhCHHHHH
Confidence              0      000000                0122356789999999999999999999999999999999999999999


Q ss_pred             HHHHhHHHHHHHhcCCCCCC-CCc----cccccc--ccCCCcccCCHHHHHHHHHHHHcCCChHHHHHHHHHhCCCHHHH
Q 015999          312 LIQEHQTDFLRLINEPVEGG-EGN----VLGQLA--SAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  384 (397)
Q Consensus       312 ~I~~n~~~Fl~~l~~~~~~~-~g~----~~~~~~--~~~~~~~~lt~Ee~~ai~rL~~lGF~r~~~iqAy~ac~kne~~A  384 (397)
                      +|++||++||+||+++.++. .+.    ..+...  ......|++|+||+++|+||++|||+|++||+||++|+||+++|
T Consensus       277 ~I~~n~~~Fl~~l~e~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~t~ee~eaI~rL~~mGF~~~~a~~al~a~~~n~e~A  356 (368)
T 1oqy_A          277 QISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLA  356 (368)
T ss_dssp             HHHHHHHHHHHHHHSCCCCSCSSCCCSSSSCCCSCCCTTCSSCCCCTTTHHHHHHHHHHTCCSHHHHHHTSSSSSCSSHH
T ss_pred             HHHHCHHHHHHHHcCcccccccccccccccccccccCCccccccCCCcCHHHHHHHHHcCCCHHHHHHHHHHcCCCHHHH
Confidence            99999999999999985421 110    011110  11124689999999999999999999999999999999999999


Q ss_pred             HHHHhccCCCCC
Q 015999          385 ANYLLDHMHEFE  396 (397)
Q Consensus       385 an~L~~~~~d~~  396 (397)
                      +||||+|.+|+|
T Consensus       357 ~~~L~~~~~d~~  368 (368)
T 1oqy_A          357 ANFLLSQNFDDE  368 (368)
T ss_dssp             HHHHHHHHCCCC
T ss_pred             HHHHhhCcCcCC
Confidence            999999987754



>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure
>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>3m66_A Mterf3, mterf domain-containing protein 1, mitochondrial; mitochondrion, DNA binding protein, transcription factor, transcription termination; 1.60A {Homo sapiens} PDB: 3opg_A 3my3_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 7e-25
d1oqya244 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Hum 1e-21
d2f4mb158 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 8e-21
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 4e-20
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 1e-17
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 9e-17
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 9e-17
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 3e-16
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 1e-15
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 2e-09
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 1e-15
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 1e-07
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 2e-15
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 2e-15
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 2e-15
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 3e-15
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 5e-15
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 1e-14
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 2e-08
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 4e-14
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 4e-14
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 6e-14
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 7e-14
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 1e-13
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 3e-13
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 1e-12
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 1e-12
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 2e-12
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 5e-11
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 6e-12
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 8e-12
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 1e-11
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 1e-11
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 1e-11
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 2e-11
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 8e-10
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 4e-11
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 7e-11
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 3e-10
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 4e-04
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 1e-09
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 1e-09
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 8e-09
d1se9a_101 d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal 1e-08
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 2e-08
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 1e-07
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 5e-07
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 1e-06
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 6e-06
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 1e-06
d2g3qa143 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL0 7e-06
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 1e-05
d2crna151 a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig 6e-05
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-04
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 9e-04
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 0.003
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like domain of Rad23 homolog A (Hhr23a)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.5 bits (235), Expect = 7e-25
 Identities = 27/75 (36%), Positives = 49/75 (65%)

Query: 1  MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE 60
          + + +KTL+   F+I ++P++ V  +K+ IE  +G D +P + Q LI+ GK+L D   + 
Sbjct: 3  VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIR 62

Query: 61 ENKVAENSFVVVMLT 75
          + ++ E +FVVVM+T
Sbjct: 63 DYRIDEKNFVVVMVT 77


>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Length = 43 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.84
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.83
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.82
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 99.81
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.81
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.8
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.79
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.79
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.79
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.78
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.78
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.76
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.75
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.75
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.74
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.74
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.73
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.72
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.7
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.7
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.69
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.69
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.69
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.67
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.67
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.66
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.64
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.61
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.6
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.6
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.59
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.57
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.43
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.32
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.29
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.28
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.24
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.23
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.17
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.16
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.13
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.11
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.11
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.1
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.09
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 99.08
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.07
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.03
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.02
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 98.98
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 98.83
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.82
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 98.77
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 98.74
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 98.7
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 98.7
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.67
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 98.64
d1x3zb157 Rad23 STI1 domain {Baker's yeast (Saccharomyces ce 98.52
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 98.42
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.41
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.37
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 98.37
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 98.36
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.13
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 98.13
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 97.8
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 97.56
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 97.41
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.28
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 97.11
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 97.07
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 96.96
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 96.79
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 96.69
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.67
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 96.27
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 96.25
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 96.11
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 96.09
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 95.63
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 95.23
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 95.18
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 94.96
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 94.84
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 94.54
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 94.01
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 93.44
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 93.41
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 92.35
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 92.28
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 91.82
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 91.77
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 91.23
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 91.01
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 89.5
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 89.44
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 89.28
d1ufza_83 HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 88.58
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 87.26
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 85.5
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 84.41
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 84.31
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 80.52
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like domain of Rad23 homolog B (Hhr23B)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84  E-value=1.2e-20  Score=152.43  Aligned_cols=79  Identities=44%  Similarity=0.706  Sum_probs=74.1

Q ss_pred             CEEEEEeCCCcEEEEEeCCCCCHHHHHHHHHHHhCCCCCCCCCeEEEeCCeecCCCCchhhcccCCCCEEEEEEeecCC
Q 015999            1 MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKVIR   79 (397)
Q Consensus         1 MkI~Vktl~gk~~~veV~~~~TV~dLK~~I~~~~g~~~ip~~~qrLiy~GKiL~D~~tL~d~gI~~gstI~v~v~k~~~   79 (397)
                      |+|+||+++|++|+|+|++++||.+||++|+++.|.+.+|+++|||||+||+|+|+++|++|||+++++|+|++++++.
T Consensus         1 M~I~vk~~~g~~~~l~v~~~~TV~~lK~~i~~~~~~~~i~~~~qrLi~~Gk~L~d~~tL~~y~I~~~s~i~lv~~~~~~   79 (95)
T d1uela_           1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKA   79 (95)
T ss_dssp             CEEEEEETTCCEEEEECCTTSBHHHHHHHHHHHHCTTTCCTTTEEEEETTEECCTTSBGGGGTCCSSSEEEEEESSCCC
T ss_pred             CEEEEEeCCCCEEEEEECCCccHHHHHHHHHhhhcccCCCccceEEEECCeEccCCCcHHHcCCCCCCEEEEEECCCCC
Confidence            9999999999999999999999999999999998765589999999999999999999999999999999999976553



>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure