Citrus Sinensis ID: 016220

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MPKVGAHKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSATPPARSGSGQPRGGNPARR
ccccccccEEEEEEEEEEHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHcHHHHHHHHHHHHHHHHHcHHHHcccccHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MPKVGAHKLEIRCTLIFTCTLDFLFRQVYSKAlhfghpwicessspqyYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELmnapnvdrradgsyggatgnsenetsgrpvgqnayedgygvpqghgpppsattagvvgagpntstsayaatqsgtpmraaydiprgpgyeaskgpgydaskapsydptkgpsydpakgpgydptkgpgydaqkgsnydaqrgpnydihrgpsydpqrglgydmqrgpnydmqrgpgyetqrvpgydvqrgpvyeaqrapsyipqrgpgydlqrgqgydmrrapsydpsrgtgfdgaprgaaphgqvppplnnvpygsatpparsgsgqprggnparr
MPKVGAHKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRADGSYGgatgnsenetsgrpVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAqrapsyipqrgpgydLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSAtpparsgsgqprggnparr
MPKVGAHKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSATPPARSGSGQPRGGNPARR
******HKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKL*****************************************************************************************************************************************************************************************************************************************************************************************
******HKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIF***********************************************************************************************QGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGY********************************************************************************************************************************************************************************************
MPKVGAHKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSA*******************
****GAH*LEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMN***********************************************************************************************************************************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKVGAHKLEIRCTLIFTCTLDFLFRQVYSKALHFGHPWICESSSPQYYFLHLAFQHCYCAIFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESxxxxxxxxxxxxxxxxxxxxxLMNAPNVDRRADGSYGGATGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSAYAATQSGTPMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPRGAAPHGQVPPPLNNVPYGSATPPARSGSGQPRGGNPARR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query393 2.2.26 [Sep-21-2011]
P13821 640 S-antigen protein OS=Plas N/A no 0.391 0.240 0.363 3e-20
P1382276 S-antigen protein (Fragme N/A no 0.173 0.894 0.455 2e-07
A2VD00 1424 Eukaryotic translation in N/A no 0.435 0.120 0.343 3e-07
>sp|P13821|SANT_PLAFW S-antigen protein OS=Plasmodium falciparum (isolate Wellcome) PE=4 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 77/154 (50%)

Query: 198 DIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKGPGYDPTKGPGYDAQKGSNYDAQR 257
           D  +GP  +  KGP  D  K P+ D  KGP+ D  KGP  D  KGP  D  KG N D  +
Sbjct: 94  DGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDK 153

Query: 258 GPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYETQRVPGYDVQRGPVYEAQRAPSY 317
           GPN D  +GP+ D  +G   D  +GPN D  +GP  +  + P  D  +GP  +  + P+ 
Sbjct: 154 GPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNS 213

Query: 318 IPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDG 351
              +GP  D  +G   D  + P+ D  +G   DG
Sbjct: 214 DGDKGPNSDGDKGPNSDGDKGPNSDGDKGPNSDG 247
S antigens are soluble heat-stable proteins present in the sera of some infected individuals.
Plasmodium falciparum (isolate Wellcome) (taxid: 5848)
>sp|P13822|SANT_PLAFP S-antigen protein (Fragment) OS=Plasmodium falciparum (isolate Palo Alto / Uganda) PE=4 SV=1 Back     alignment and function description
>sp|A2VD00|EIF3A_XENLA Eukaryotic translation initiation factor 3 subunit A OS=Xenopus laevis GN=eif3a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query393
255581346467 conserved hypothetical protein [Ricinus 0.699 0.588 0.471 1e-65
224127348482 predicted protein [Populus trichocarpa] 0.743 0.605 0.469 7e-62
356526605418 PREDICTED: uncharacterized protein LOC10 0.511 0.480 0.567 2e-56
147771156 562 hypothetical protein VITISV_025050 [Viti 0.480 0.336 0.618 3e-47
225451915421 PREDICTED: uncharacterized protein LOC10 0.511 0.477 0.594 1e-46
356567168404 PREDICTED: uncharacterized protein LOC10 0.488 0.475 0.509 3e-45
449447462398 PREDICTED: uncharacterized protein LOC10 0.470 0.464 0.468 4e-38
30697468359 uncharacterized protein [Arabidopsis tha 0.333 0.364 0.509 4e-25
4204281346 Hypothetical protein [Arabidopsis thalia 0.333 0.378 0.509 4e-25
167017448238 At1g67170 [Arabidopsis thaliana] gi|1670 0.333 0.550 0.509 5e-25
>gi|255581346|ref|XP_002531483.1| conserved hypothetical protein [Ricinus communis] gi|223528910|gb|EEF30907.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  256 bits (655), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 194/352 (55%), Gaps = 77/352 (21%)

Query: 62  IFLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPN 121
           I +         +  CR +++YEKK ++DH ESLQVME NY+TMA EVEKL  EL N  N
Sbjct: 173 ILISELDSLRQEYQRCRVSFDYEKKLFSDHRESLQVMENNYVTMAREVEKLHLELTNTSN 232

Query: 122 VDRRA--DGSYGGATGNSENETSGRPVGQNAYEDGYGVPQ--GHGPPP----------SA 167
           VD R    G YGGATGN+ENETS R VG+N YED YGV Q  GH P P          + 
Sbjct: 233 VDIRTVTGGPYGGATGNNENETSSRSVGENKYEDSYGVSQSQGHTPIPGNSGSAAATAAG 292

Query: 168 TTAGVVGAGPNTSTSAYAATQSGTP-MRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKG 226
           + +    AG    T  Y   QSG+   R+AYD PRGP YEA                TKG
Sbjct: 293 SASTGAKAGTGAGTPTYTGAQSGSASTRSAYDTPRGPNYEA----------------TKG 336

Query: 227 PSYDPAKGPGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYD 286
           PSYD ++G GYD ++G  YDAQ+G +YDAQRGP Y++ RGPSYD Q       QR P YD
Sbjct: 337 PSYDVSRGSGYDLSRGAAYDAQRGHSYDAQRGPGYNMQRGPSYDAQ-------QRVPGYD 389

Query: 287 MQRGPGYETQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRG 346
           +QR PGY   R PGYDVQ+GP                                 YD SR 
Sbjct: 390 VQRIPGY-APRTPGYDVQQGP--------------------------------HYDASRV 416

Query: 347 TGFDGAPRGAA--PHGQVPPPLNNVPYGSATPPARSGSG---QPRGGNPARR 393
            G+D A RG A  PHGQ+ P  NNVPYGSATP  R+ SG   Q RGGNP RR
Sbjct: 417 AGYDPAARGTAVPPHGQMTPA-NNVPYGSATPSTRAVSGYEAQARGGNPVRR 467

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127348|ref|XP_002329255.1| predicted protein [Populus trichocarpa] gi|222870709|gb|EEF07840.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356526605|ref|XP_003531907.1| PREDICTED: uncharacterized protein LOC100802139 [Glycine max] Back     alignment and taxonomy information
>gi|147771156|emb|CAN65241.1| hypothetical protein VITISV_025050 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451915|ref|XP_002282805.1| PREDICTED: uncharacterized protein LOC100244706 [Vitis vinifera] gi|298204399|emb|CBI16879.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356567168|ref|XP_003551793.1| PREDICTED: uncharacterized protein LOC100783811 [Glycine max] Back     alignment and taxonomy information
>gi|449447462|ref|XP_004141487.1| PREDICTED: uncharacterized protein LOC101210432 [Cucumis sativus] gi|449481420|ref|XP_004156177.1| PREDICTED: uncharacterized protein LOC101226645 [Cucumis sativus] Back     alignment and taxonomy information
>gi|30697468|ref|NP_176888.2| uncharacterized protein [Arabidopsis thaliana] gi|29028878|gb|AAO64818.1| At1g67170 [Arabidopsis thaliana] gi|110736466|dbj|BAF00201.1| hypothetical protein [Arabidopsis thaliana] gi|332196487|gb|AEE34608.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4204281|gb|AAD10662.1| Hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|167017448|gb|ABZ04695.1| At1g67170 [Arabidopsis thaliana] gi|167017450|gb|ABZ04696.1| At1g67170 [Arabidopsis thaliana] gi|167017452|gb|ABZ04697.1| At1g67170 [Arabidopsis thaliana] gi|167017454|gb|ABZ04698.1| At1g67170 [Arabidopsis thaliana] gi|167017462|gb|ABZ04702.1| At1g67170 [Arabidopsis thaliana] gi|167017464|gb|ABZ04703.1| At1g67170 [Arabidopsis thaliana] gi|167017466|gb|ABZ04704.1| At1g67170 [Arabidopsis thaliana] gi|167017468|gb|ABZ04705.1| At1g67170 [Arabidopsis thaliana] gi|167017472|gb|ABZ04707.1| At1g67170 [Arabidopsis thaliana] gi|167017474|gb|ABZ04708.1| At1g67170 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query393
TAIR|locus:2033681359 AT1G67170 "AT1G67170" [Arabido 0.407 0.445 0.477 2.3e-30
FB|FBgn0085362 578 Vml "Vitelline membrane-like" 0.679 0.461 0.293 1e-23
UNIPROTKB|F1S187406 LOC100518332 "Uncharacterized 0.529 0.512 0.312 1.8e-13
UNIPROTKB|P11414 467 POLR2A "DNA-directed RNA polym 0.608 0.511 0.292 2.2e-11
UNIPROTKB|A4II09 1391 eif3a "Eukaryotic translation 0.470 0.132 0.303 8.8e-11
UNIPROTKB|A2VD00 1424 eif3a "Eukaryotic translation 0.404 0.111 0.335 1.6e-10
WB|WBGene00020550 682 T17H7.1 [Caenorhabditis elegan 0.628 0.362 0.274 9.4e-10
FB|FBgn0028573 1729 prc "pericardin" [Drosophila m 0.628 0.142 0.295 4e-09
ZFIN|ZDB-GENE-041008-78 1965 polr2a "polymerase (RNA) II (D 0.452 0.090 0.325 6e-09
UNIPROTKB|P71590 527 fhaA "FHA domain-containing pr 0.529 0.394 0.344 8e-09
TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 335 (123.0 bits), Expect = 2.3e-30, P = 2.3e-30
 Identities = 84/176 (47%), Positives = 99/176 (56%)

Query:    74 FHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRADGSYGGA 133
             +  CR TY+YEKKFYNDHLESLQ MEKNY+TMA EVEKL+A+LMN  N DRRA G YG  
Sbjct:   191 YQQCRATYDYEKKFYNDHLESLQAMEKNYMTMAREVEKLQAQLMNNANSDRRAGGPYGNN 250

Query:   134 TGNSENETSGRPVGQNAYEDGYGVPQGHGPPPSATTAGVVGAGPNTSTSA--Y---AATQ 188
               N+E + SG   G   YED +G PQG+ P P A  A     GPN+   A  Y     TQ
Sbjct:   251 I-NAEIDASGHQSGNGYYEDAFG-PQGYIPQPVAGNA----TGPNSVVGAAQYPYQGVTQ 304

Query:   189 SGT-PMRAAYDIPRGPGYEASKGPGYDASKAPSYDP-TKGPSYD-PAKGPGYDPTK 241
              G  P R  Y+ PRGP    S  P       P   P   GPS + P  G   +P++
Sbjct:   305 PGYFPQRPGYNFPRGP--PGSYDPTTRLPTGPYGAPFPPGPSNNTPYAGTHGNPSR 358
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0085362 Vml "Vitelline membrane-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1S187 LOC100518332 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P11414 POLR2A "DNA-directed RNA polymerase II subunit RPB1" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|A4II09 eif3a "Eukaryotic translation initiation factor 3 subunit A" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|A2VD00 eif3a "Eukaryotic translation initiation factor 3 subunit A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
WB|WBGene00020550 T17H7.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0028573 prc "pericardin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-78 polr2a "polymerase (RNA) II (DNA directed) polypeptide A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P71590 fhaA "FHA domain-containing protein FhaA" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 393
KOG02601605 consensus RNA polymerase II, large subunit [Transc 98.76
KOG02601605 consensus RNA polymerase II, large subunit [Transc 98.67
KOG1999 1024 consensus RNA polymerase II transcription elongati 97.95
KOG19991024 consensus RNA polymerase II transcription elongati 97.88
PF12815123 CTD: Spt5 C-terminal nonapeptide repeat binding Sp 97.71
PF12815123 CTD: Spt5 C-terminal nonapeptide repeat binding Sp 97.29
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 95.51
PHA0175075 hypothetical protein 95.18
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 94.93
PF1259257 DUF3763: Protein of unknown function (DUF3763); In 94.48
KOG4403575 consensus Cell surface glycoprotein STIM, contains 94.47
KOG3433203 consensus Protein involved in meiotic recombinatio 94.45
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 93.62
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.59
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 93.38
KOG09331174 consensus Structural maintenance of chromosome pro 92.85
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 92.82
PRK09039343 hypothetical protein; Validated 92.49
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.5
PF10186302 Atg14: UV radiation resistance protein and autopha 90.84
KOG1103561 consensus Predicted coiled-coil protein [Function 90.78
PF03961451 DUF342: Protein of unknown function (DUF342); Inte 90.72
PRK10884206 SH3 domain-containing protein; Provisional 90.59
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 90.48
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 90.18
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 89.71
COG1315543 Uncharacterized conserved protein [Function unknow 89.65
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.55
KOG4637464 consensus Adaptor for phosphoinositide 3-kinase [S 89.44
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 89.41
PF10186302 Atg14: UV radiation resistance protein and autopha 89.26
PF0834087 DUF1732: Domain of unknown function (DUF1732); Int 89.07
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 88.59
PF14257262 DUF4349: Domain of unknown function (DUF4349) 88.53
COG2433652 Uncharacterized conserved protein [Function unknow 88.26
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 88.14
PF00038312 Filament: Intermediate filament protein; InterPro: 88.08
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 88.0
PF07139302 DUF1387: Protein of unknown function (DUF1387); In 87.66
PF1070471 DUF2508: Protein of unknown function (DUF2508); In 87.59
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 87.14
PF13851201 GAS: Growth-arrest specific micro-tubule binding 86.87
PF04420161 CHD5: CHD5-like protein; InterPro: IPR007514 Membe 86.3
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 86.28
PF07407420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 86.27
PRK11637428 AmiB activator; Provisional 86.2
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 86.16
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.52
KOG0977546 consensus Nuclear envelope protein lamin, intermed 85.44
KOG1962216 consensus B-cell receptor-associated protein and r 85.4
PF05615139 THOC7: Tho complex subunit 7; InterPro: IPR008501 85.36
KOG0432995 consensus Valyl-tRNA synthetase [Translation, ribo 84.85
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 84.78
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 84.71
PRK04778569 septation ring formation regulator EzrA; Provision 84.4
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 84.32
PRK11546143 zraP zinc resistance protein; Provisional 84.21
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 84.12
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 84.11
PF0754483 Med9: RNA polymerase II transcription mediator com 83.94
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 83.93
PF03938158 OmpH: Outer membrane protein (OmpH-like); InterPro 83.62
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 83.59
KOG1937521 consensus Uncharacterized conserved protein [Funct 83.43
PF1518885 CCDC-167: Coiled-coil domain-containing protein 16 83.06
PLN031881320 kinesin-12 family protein; Provisional 82.95
PF0601386 WXG100: Proteins of 100 residues with WXG; InterPr 82.79
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 82.64
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 82.6
COG5124209 Protein predicted to be involved in meiotic recomb 82.5
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 82.2
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 82.04
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 81.95
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 81.74
PRK10780165 periplasmic chaperone; Provisional 81.65
PF00038312 Filament: Intermediate filament protein; InterPro: 81.58
PF0489970 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th 81.51
PF05701522 WEMBL: Weak chloroplast movement under blue light; 81.49
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 80.8
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 80.65
PF03245125 Phage_lysis: Bacteriophage Rz lysis protein; Inter 80.55
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 80.11
COG3879247 Uncharacterized protein conserved in bacteria [Fun 80.08
>KOG0260 consensus RNA polymerase II, large subunit [Transcription] Back     alignment and domain information 
Probab=98.76  E-value=1.6e-07  Score=104.90  Aligned_cols=22  Identities=23%  Similarity=0.264  Sum_probs=14.1

Q ss_pred             Ccceeeeeeeeeeeeccchhhh
Q 016220            5 GAHKLEIRCTLIFTCTLDFLFR   26 (393)
Q Consensus         5 ~~~~~~~~~~~~~~~~~d~~~~   26 (393)
                      .+-||+|||-+.+--+=|...+
T Consensus      1219 na~klv~r~ri~~~~e~D~~l~ 1240 (1605)
T KOG0260|consen 1219 NAEKLVLRLRIAKEEEDDVFLK 1240 (1605)
T ss_pred             CCcceEEEEEecCccchhHHHH
Confidence            3568888887766655555443

>KOG0260 consensus RNA polymerase II, large subunit [Transcription] Back     alignment and domain information
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription] Back     alignment and domain information
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription] Back     alignment and domain information
>PF12815 CTD: Spt5 C-terminal nonapeptide repeat binding Spt4; PDB: 2E70_A Back     alignment and domain information
>PF12815 CTD: Spt5 C-terminal nonapeptide repeat binding Spt4; PDB: 2E70_A Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PHA01750 hypothetical protein Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF12592 DUF3763: Protein of unknown function (DUF3763); InterPro: IPR022547 This domain is found in bacterial regulartory ATPases 3 Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>PF03961 DUF342: Protein of unknown function (DUF342); InterPro: IPR005646 This family of bacterial proteins has no known function Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG1315 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4637 consensus Adaptor for phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF08340 DUF1732: Domain of unknown function (DUF1732); InterPro: IPR013551 This domain of unknown function is found at the C terminus of bacterial proteins, many of which are hypothetical and include proteins of the YicC family Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14257 DUF4349: Domain of unknown function (DUF4349) Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF07139 DUF1387: Protein of unknown function (DUF1387); InterPro: IPR009816 This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals Back     alignment and domain information
>PF10704 DUF2508: Protein of unknown function (DUF2508); InterPro: IPR019644 This entry represents a protein family of unknown function that is conserved in the firmicutes Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF04420 CHD5: CHD5-like protein; InterPro: IPR007514 Members of this family are probably coiled-coil proteins that are similar to the CHD5 (Congenital heart disease 5) protein Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF05615 THOC7: Tho complex subunit 7; InterPro: IPR008501 The Tho complex (THOC) is involved in transcription elongation and mRNA export from the nucleus [] Back     alignment and domain information
>KOG0432 consensus Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07544 Med9: RNA polymerase II transcription mediator complex subunit 9; InterPro: IPR011425 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF03938 OmpH: Outer membrane protein (OmpH-like); InterPro: IPR005632 This entry includes outer membrane proteins such as OmpH (Skp) among others Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15188 CCDC-167: Coiled-coil domain-containing protein 167 Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>PF06013 WXG100: Proteins of 100 residues with WXG; InterPro: IPR010310 ESAT-6 is a small protein appears to be of fundamental importance in virulence and protective immunity in Mycobacterium tuberculosis Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5124 Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PRK10780 periplasmic chaperone; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF03245 Phage_lysis: Bacteriophage Rz lysis protein; InterPro: IPR004929 Many bacteriophages with Gram-negative hosts contain two auxiliary lysis genes Rz and Rz1 Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG3879 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 41.8 bits (97), Expect = 4e-04
 Identities = 25/143 (17%), Positives = 42/143 (29%), Gaps = 33/143 (23%)

Query: 17  FTC--TLDFLFRQVYSKA-----LHFGHP--------WICESSSPQYY--FLHLAFQHCY 59
           F C    D   + + SK      +             W   S   +    F+    +  Y
Sbjct: 33  FDCKDVQDMP-KSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINY 91

Query: 60  CAIFLKIWSKNAITFHLCRGTYEYEK-KFYNDHLESLQVMEKNYITMATEVEKLRAELMN 118
             +             +    Y  ++ + YND+    QV  K  ++      KLR  L+ 
Sbjct: 92  KFLMSP-IKTEQRQPSMMTRMYIEQRDRLYNDN----QVFAKYNVSRLQPYLKLRQALLE 146

Query: 119 ---APNVDRRADGSYG-GATGNS 137
              A NV        G   +G +
Sbjct: 147 LRPAKNV-----LIDGVLGSGKT 164

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query393
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.15
2w6b_A56 RHO guanine nucleotide exchange factor 7; X-RAY cr 94.04
2ke4_A98 CDC42-interacting protein 4; CIP4, TC10, coiled-co 93.97
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 93.62
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.88
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 92.44
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 92.39
3lay_A175 Zinc resistance-associated protein; salmonella typ 92.29
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 91.49
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.31
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 90.29
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 89.95
3l4f_A61 RHO guanine nucleotide exchange factor 7; coiled-c 89.03
2fcw_A109 Alpha-2-macroglobulin receptor-associated protein; 88.72
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 87.39
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 87.08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 86.96
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 86.59
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.32
3lay_A175 Zinc resistance-associated protein; salmonella typ 85.44
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 84.34
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 84.04
4ioe_A93 Secreted protein ESXB; structural genomics, PSI-bi 83.6
2ve7_A315 Kinetochore protein HEC1, kinetochore protein SPC; 83.28
3zbh_A99 ESXA; unknown function, type 7 secretion, ESAT6 fa 83.09
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 81.75
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 80.32
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 80.04
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 80.04
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
Probab=94.15  E-value=0.096  Score=51.91  Aligned_cols=55  Identities=7%  Similarity=-0.101  Sum_probs=35.4

Q ss_pred             HHHHHHHHHhhhhhhhhhhccchhhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 016220           67 WSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPN  121 (393)
Q Consensus        67 id~lrqElqr~R~a~EyEKK~~~e~~Eq~q~MEKnlisMarEvEKLRaElanae~  121 (393)
                      ++.++++++.....++..|+-..+.-.+.+.|++.+..+.+|++++++||...+.
T Consensus       525 ~~~~~~~~~~~~~~~~~~~~~~~~le~~~~~~~~~~~~l~~e~~~~~~~~~~l~~  579 (597)
T 3oja_B          525 TQARRTEADAKQKETEDLEQENIALEKQLDNKRAKQAELRQETSLKRQKVKQLEA  579 (597)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhhhhhhcchhhHHhhhHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            3333333333334444444555566667778888899999999999998875543
>2w6b_A RHO guanine nucleotide exchange factor 7; X-RAY crystallography, phosphoprotein, guanine-nucleotide releasing factor, GIT, PAK, PIX, COOL; 2.80A {Rattus norvegicus} Back     alignment and structure
>2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3l4f_A RHO guanine nucleotide exchange factor 7; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2fcw_A Alpha-2-macroglobulin receptor-associated protein; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: a.13.1.1 PDB: 2ftu_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2ve7_A Kinetochore protein HEC1, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_C* Back     alignment and structure
>3zbh_A ESXA; unknown function, type 7 secretion, ESAT6 family proteins, W protein ESS; 1.94A {Geobacillus thermodenitrificans} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query393
d1wa8a199 ESAT-6 like protein EsxB {Mycobacterium tuberculos 86.49
d2fcwa1105 alpha-2-Macroglobulin receptor associated protein 86.05
d1noga_149 Hypothetical protein Ta0546 {Archaeon Thermoplasma 81.17
>d1wa8a1 a.25.3.1 (A:1-99) ESAT-6 like protein EsxB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: EsxAB dimer-like
family: ESAT-6 like
domain: ESAT-6 like protein EsxB
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=86.49  E-value=1.6  Score=32.29  Aligned_cols=69  Identities=7%  Similarity=-0.024  Sum_probs=49.0

Q ss_pred             HHHHHHHhHHHHH--HHHHHHHHHHHHHhhhhhhhhhhccchhhHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Q 016220           50 FLHLAFQHCYCAI--FLKIWSKNAITFHLCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAP  120 (393)
Q Consensus        50 ~~~~~~~~~~~~~--l~~Eid~lrqElqr~R~a~EyEKK~~~e~~Eq~q~MEKnlisMarEvEKLRaElanae  120 (393)
                      +|+.+.++++..+  |..+|+.|++++..+....  +=.+..--.++.+...+++..|...|++|+..|..+.
T Consensus         9 ~l~~~A~~~~~~~~~l~~~l~~l~~~v~~l~~~W--~G~A~~af~~~~~~w~~~~~~l~~~L~~i~~~L~~aa   79 (99)
T d1wa8a1           9 TLAQEAGNFERISGDLKTQIDQVESTAGSLQGQW--RGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAG   79 (99)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSC--CSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh--hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3445555555444  6777788888887777653  3344555677788888999999999999999887653
>d2fcwa1 a.13.1.1 (A:216-320) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure